Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHKE:scaffold_9870341710062229273e-110
PHSO:scaffold_1280289428035592228869e-105
PHRA:scaffold_561474621481272228788e-104
PHCA:scaffold_841032371039292318496e-100
PHIF:NW_003303697.14340284346932228435e-99
PHPA:scaffold_632540092546742228427e-99
PLHA:NW_020189861.1184174718424122227844e-91
PYUU:scaffold_2037131047013111292226405e-72
PYIW:scaffold_71113100138702596282e-70
PYIR:scaffold_898482991412226071e-67
PYAP:scaffold_16222520231822235903e-65
ALCA:scaffold_90602767792534472e-46
ALLA:FR824104869493442194411e-45
APIN:scaffold_203784123787531162522e-31
SADI:scaffold_41748841752251162523e-30
APAS:scaffold_127301447304851162359e-30
SAPA:scaffold_244277884285342512737e-24
PYAR:scaffold_291322913354421561e-18
PYIW:scaffold_9631208312178321384e-07
PYVX:scaffold_2751285135624990.016
SAPA:scaffold_719420319444883793.9
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYKE_8394

Length=428
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  361        3e-110
PHSO:scaffold_1                                                       345        9e-105
PHRA:scaffold_56                                                      342        8e-104
PHCA:scaffold_84 PHYCAscaffold_84                                     331        6e-100
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  329        5e-99 
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  328        7e-99 
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  306        4e-91 
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  251        5e-72 
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  246        2e-70 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  238        1e-67 
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  231        3e-65 
ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig sup...  176        2e-46 
ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:...  174        1e-45 
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  101        2e-31 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  101        3e-30 
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  95.1       9e-30 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  109        7e-24 
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  64.7       1e-18 
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  57.8       4e-07 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  42.7       0.016 
SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154...  35.0       3.9   

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 361 bits (927),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 198/222 (89%), Positives = 199/222 (90%), Gaps = 23/222 (10%)
 Frame = +3

Query  178    ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
              ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL
Sbjct  70341  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  70520

Query  238    VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
              VFPEQALRFP+                       GKDAYLVMGLPGAEDQRLAIALDLPI
Sbjct  70521  VFPEQALRFPSHFSLSSLLLYSPHCLRRIRHYTAGKDAYLVMGLPGAEDQRLAIALDLPI  70700

Query  275    lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
              LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL
Sbjct  70701  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  70880

Query  335    KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
              KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD
Sbjct  70881  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  71006

 Score = 200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 134/178 (75%), Gaps = 44/178 (25%)
 Frame = +3

Query  1      MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
              MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTV          
Sbjct  68421  MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVVTTAEVQAFN  68600

Query  51     ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                  KTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG
Sbjct  68601  AILQKTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVGAPPSIRLRGGYDSVG  68780

Query  107    KPKMTTRKDGGSIPMEFFRE------------------------------RFRNSNVE  134
              KPKMTTRKDGGSIPMEFFRE                              RFRNSNVE
Sbjct  68781  KPKMTTRKDGGSIPMEFFREVSDLVCIASIACYRDDTKPENIGCCVVPLQRFRNSNVE  68954

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/44 (95%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +3

Query  134    EDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
              +DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAY+
Sbjct  69612  QDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYS  69743

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  390    VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK  425
              VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK
Sbjct  71262  VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK  71369

>PHSO:scaffold_1
Length=13391543

 Score = 345 bits (886),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 187/222 (84%), Positives = 192/222 (86%), Gaps = 23/222 (10%)
 Frame = +3

Query  178      ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
                ENFAVQQNLQLTRICAAALDSNVDLLVYV+PFELTADVS YFLKLLQLGGLADSRPRVKL
Sbjct  2802894  ENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKL  2803073

Query  238      VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
                VFPEQA RFP                        GKDAYLVMGLPG EDQRLAIALDLPI
Sbjct  2803074  VFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPI  2803253

Query  275      lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
                LGAPP QALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HMDQPRWLL
Sbjct  2803254  LGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLL  2803433

Query  335      KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
                KLDYDPLGVGEA++DLSGMQAMRELRREK+ PEYWRQPGPRD
Sbjct  2803434  KLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRD  2803559

 Score = 150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 115/166 (69%), Gaps = 35/166 (21%)
 Frame = +3

Query  1        MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
                MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  2801037  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  2801216

Query  51       ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                    +TE ELRAKAELVLNGMVNSSS+ Q+NQ+Q GTLLPAVTV APPS R R GY    
Sbjct  2801217  AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHRSGY---A  2801387

Query  107      KPKMTTRKDGGSIPMEFFRE------------------RFRNSNVE  134
                KP++    D  SIPMEFFRE                  +FRNS+VE
Sbjct  2801388  KPRVAKSMDASSIPMEFFREVSPLLMC*ITS*LTLYAQQFRNSSVE  2801525

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  390      VHVTSTQNVLASGSGLNRKTVAYTFPQTAAPHEAVK  425
                VH+TSTQNVLASG GLNRKTVA+TFPQT APHEAVK
Sbjct  2803800  VHITSTQNVLASGGGLNRKTVAFTFPQTVAPHEAVK  2803907

 Score = 42.7 bits (99),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 18/19 (95%), Positives = 19/19 (100%), Gaps = 0/19 (0%)
 Frame = +3

Query  159      LGANVDKIRGYNELLDAYT  177
                LGANVDKIRGYNELLDAY+
Sbjct  2802240  LGANVDKIRGYNELLDAYS  2802296

>PHRA:scaffold_56
Length=334739

 Score = 342 bits (878),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 186/222 (84%), Positives = 195/222 (88%), Gaps = 23/222 (10%)
 Frame = -1

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               ENFAVQQNLQLTRICAAALDS+VDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL
Sbjct  148127  ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  147948

Query  238     VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
               VFPEQA RFP                        GK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  147947  VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPI  147768

Query  275     lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
               LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYD+HELFAALAKLAV HM+QP+WLL
Sbjct  147767  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  147588

Query  335     KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
               KLDYDPLG+GEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  147587  KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  147462

 Score = 157 bits (397),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 108/140 (77%), Gaps = 14/140 (10%)
 Frame = -2

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
               MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS V          
Sbjct  150004  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  149825

Query  51      ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                   +TE+ELRAKAELVL GMVNSSS+ Q+NQ+Q GTLLP VTV APPS R R GY    
Sbjct  149824  AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYGGAN  149645

Query  107     KPKMTTRKDGGSIPMEFFRE  126
               KP +T+R D  SIP+EFFRE
Sbjct  149644  KPTLTSRTDASSIPIEFFRE  149585

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -1

Query  135     DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
               D ++SDEDQG A ND+DE+AEMEELGANVDKIRGYN+LLDAY+
Sbjct  148853  DGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYS  148725

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 1/37 (3%)
 Frame = -1

Query  390     VHVTSTQNVLAS-GSGLNRKTVAYTFPQTAAPHEAVK  425
               V++TSTQNVLAS G GLNRKTVA+TFPQTAAPHEAV+
Sbjct  147221  VYITSTQNVLASSGGGLNRKTVAFTFPQTAAPHEAVQ  147111

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 331 bits (849),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 193/231 (84%), Gaps = 27/231 (12%)
 Frame = +1

Query  173     LDAYT----ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGL  228
               LD Y+    EN AV+QNLQLTRICAAALDS VDLLVYVSPFELT DVSQYF+KLLQLGGL
Sbjct  103237  LDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVSPFELTTDVSQYFIKLLQLGGL  103416

Query  229     ADSRPRVKLVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQR  265
               ADSRPRVKL+FPEQA RFP                        GK+AYLVMGLPGAEDQR
Sbjct  103417  ADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQR  103596

Query  266     LAIALDlpilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVT  325
               LA+ LDLPILGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HELF+ALAKLAV 
Sbjct  103597  LAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPAGTYELYDEHELFSALAKLAVA  103776

Query  326     HMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
               HMDQP+WL KLDYDPLGVGEA++DLSGMQAMRELRREKR PEYWRQPGPRD
Sbjct  103777  HMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRD  103929

 Score = 146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 108/169 (64%), Gaps = 42/169 (25%)
 Frame = +1

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
               MEK+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEAN+SPMRHS V          
Sbjct  101446  MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANSSPMRHSAVVTTAEVQAFN  101625

Query  51      ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                   +TE ELRAKAELVLNGMVNSS     +    GT+LPAVTV  PPSI+ R GY    
Sbjct  101626  AILQRTETELRAKAELVLNGMVNSSFEPSQS----GTVLPAVTVANPPSIKRRSGYRRAY  101793

Query  107     KPKMTTRKDGGSIPMEFFRE---------------------RFRNSNVE  134
               KP+   R D  SIPMEFFRE                     +FRNS+VE
Sbjct  101794  KPR---RTDASSIPMEFFREVNGGVNVVLC*NAILM*SCL*QFRNSSVE  101931

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +1

Query  390     VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
               VHVTST N+LA+G G LNR+TVA+TFPQTAAPHEAVK
Sbjct  104170  VHVTSTLNMLATGGGGLNRRTVAFTFPQTAAPHEAVK  104280

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 7/53 (13%)
 Frame = +1

Query  125     RERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
               R+RF +   + DD+SDE+Q       D+D E EELGANVDKIRGYNELLDAY+
Sbjct  102529  RDRFSD---QPDDVSDEEQKDE----DKDEETEELGANVDKIRGYNELLDAYS  102666

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 329 bits (843),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 190/222 (86%), Gaps = 23/222 (10%)
 Frame = +3

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               ENFA+QQNLQLTR+CAAALDSNV+LL+YVSPFELT+DVSQYFLKLLQLGGL DSRPRVKL
Sbjct  434028  ENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKL  434207

Query  238     VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
               VFPEQ  RFP                       TGK+AYLVMGLPGAEDQRLA+ALDLPI
Sbjct  434208  VFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPI  434387

Query  275     lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
               LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HE+ AALAKLA+ HMDQPRWL+
Sbjct  434388  LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLI  434567

Query  335     KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
               KLDYDPL VGEA++DLS MQAMRELRREKR PEYWRQPGPRD
Sbjct  434568  KLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRD  434693

 Score = 145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 106/140 (76%), Gaps = 17/140 (12%)
 Frame = +3

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
               M+K+QQQHHVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRH+ +          
Sbjct  432171  MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  432350

Query  51      ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                   +TE ELRAKAELVLNGMVNSSS+ ++NQ Q GTLLPAVTV A PSI  R GYD   
Sbjct  432351  AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  432530

Query  107     KPKMTTRKDGGSIPMEFFRE  126
               KP+   + D  SIP+EFFRE
Sbjct  432531  KPR---QMDASSIPVEFFRE  432581

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 5/53 (9%)
 Frame = +3

Query  125     RERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
               R+RF      DDD+SDE+Q +  ND+DE AEME+LGANVDKIRGYNELLD Y+
Sbjct  433287  RDRF-----SDDDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYS  433430

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 1/37 (3%)
 Frame = +3

Query  390     VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
               VH++STQNVLA+G G LNRKTVA+TFPQTAAP+EA+K
Sbjct  434934  VHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIK  435044

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 328 bits (842),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 178/222 (80%), Positives = 188/222 (85%), Gaps = 23/222 (10%)
 Frame = +2

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               ENFAVQQNLQLTR+CA ALDSNVDLLVYVSPFELTADV QYFLKLLQLGGL DS PRVK 
Sbjct  254009  ENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKF  254188

Query  238     VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIALDlpi  274
               VFPEQ+ RFP                       TGK+AYLVMGLPGAEDQRLAIALDLPI
Sbjct  254189  VFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPI  254368

Query  275     lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
               LGAPPAQALPLLTRSGGKRLLIRADVNVP GTYELYD+HEL AALAKLA+ HMDQP+WL+
Sbjct  254369  LGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLI  254548

Query  335     KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
               KLDYDPLGVGEA++DLS +QAMRELRREKR PEYWRQPGPRD
Sbjct  254549  KLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRD  254674

 Score = 138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 111/170 (65%), Gaps = 39/170 (23%)
 Frame = +2

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
               MEK+QQQ HVEDVGRLLLQTQEQLRVMREQMTAAA AVEANASPMRHS +          
Sbjct  252143  MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  252322

Query  51      ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                   +TE ELR+KAELVLNGMVNSS+N Q+NQ Q G  LPAVTV A PS + R GY+   
Sbjct  252323  AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  252502

Query  107     KPKMTTRKDGGSIPMEFFRE----------------------RFRNSNVE  134
               KP+   + D  SIPMEFFRE                      +FRNS+VE
Sbjct  252503  KPR---QMDASSIPMEFFREVSAVG*SCEKEIPNVSLLYGLQQFRNSSVE  252643

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 43/57 (75%), Gaps = 5/57 (9%)
 Frame = +2

Query  121     MEFFRERFRNSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
               M+  R RF      DDD+SDEDQ    N +DEDAEMEELGANVDKIRGYNELLDAY+
Sbjct  253256  MDNNRGRF-----SDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYS  253411

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 1/37 (3%)
 Frame = +2

Query  390     VHVTSTQNVLASGSG-LNRKTVAYTFPQTAAPHEAVK  425
               VHVTSTQNVLA+G G LNRKTVA+TFPQTAAPHEA+K
Sbjct  254915  VHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIK  255025

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 306 bits (784),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 179/222 (81%), Gaps = 23/222 (10%)
 Frame = -3

Query  178      ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
                ENFAVQQNLQLTRICAAALD  VDLLVYVSP+ELTADVSQYF KLLQL G ADSRPRVK 
Sbjct  1842412  ENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKF  1842233

Query  238      VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
                V+PEQA RFP                        G +AYLVMGLPG EDQRLAI LDLPI
Sbjct  1842232  VYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPI  1842053

Query  275      lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
                LGA P+QALPLLTRSGGKRLLI+AD+NVPTGTYELYD+HE+  ALAKLAV H+DQ +WL+
Sbjct  1842052  LGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLI  1841873

Query  335      KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
                KLDYDPLGVGEA++DLS MQAMREL REKR PEYWRQPG RD
Sbjct  1841872  KLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRD  1841747

 Score = 118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 94/140 (67%), Gaps = 14/140 (10%)
 Frame = -3

Query  1        MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
                MEK+QQ +HVEDVGRLLL+TQEQLR MREQMTAAA ++EAN SP RHS+V          
Sbjct  1844209  MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  1844030

Query  51       ----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVG  106
                    +TE ELRAKAELVLNG++NSS++  ++Q Q  T LPAV+V AP  I+ R G     
Sbjct  1844029  ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRRGDSRAD  1843850

Query  107      KPKMTTRKDGGSIPMEFFRE  126
                +     R D  S  MEFFR+
Sbjct  1843849  EFGHINRIDNNSTSMEFFRQ  1843790

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = -3

Query  390      VHVTSTQNVLASG-SGLNRKTVAYTFPQTAAPHEAVK  425
                VH+TSTQNVL +   GL+RK+  + FPQT APH A+K
Sbjct  1841524  VHMTSTQNVLTTTRGGLSRKSEIFAFPQTVAPHAAIK  1841414

 Score = 36.2 bits (82),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 7/58 (12%)
 Frame = -3

Query  127      RFRNSNVEDDDL-SDEDQ----GAAGND--RDEDAEMEELGANVDKIRGYNELLDAYT  177
                R +N ++E++   S EDQ    G+  +D  +DE    ++L  NV KIR YN+L+DAY+
Sbjct  1843183  RNQNEDIENNCTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAVNVAKIREYNDLVDAYS  1843010

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 251 bits (640),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 166/222 (75%), Gaps = 25/222 (11%)
 Frame = +1

Query  178      ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
                +NFAV+QNLQL+R+C   +D+NVD+ VYVSPFELT++V QYF+KLLQLGG+AD   RVKL
Sbjct  1310470  DNFAVKQNLQLSRLCGI-IDANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKL  1310643

Query  238      VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
                VFPEQA RFP                        GK+AYLV G+PG ED+RLA+AL++PI
Sbjct  1310644  VFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPI  1310823

Query  275      lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
                LG  P   LPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL V+H++Q  WLL
Sbjct  1310824  LGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLL  1311003

Query  335      KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
                K+DYDP G G AI+D S + A+RE+RREK++PEYWRQPG RD
Sbjct  1311004  KIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWRQPGTRD  1311129

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (57%), Gaps = 18/150 (12%)
 Frame = +3

Query  1        MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeavean---------aSPMRHSTVK  51
                M+++QQQHHVEDVGR+LLQTQEQLR+MREQM +   A              +  +    +
Sbjct  1308606  MDQIQQQHHVEDVGRILLQTQEQLRLMREQMASTTAATTPTRFHQTAPADVAAFQEILQR  1308785

Query  52       TEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLR--GGYDSVGKPK  109
                 E+E+RAKAELVLNG+VN+SS   +      + LPAV   + P+ R +  G +      +
Sbjct  1308786  AELEIRAKAELVLNGLVNTSSQAAAASTL--STLPAVVSSSSPTTRKQNLGAF----LVR  1308947

Query  110      MTTRKDGGSIPMEFFRERFRNSNVEDDDLS  139
                  +R +   + +++FR   R S+ +   LS
Sbjct  1308948  HQSRSENYEMDLDYFRS-VRESSAKATTLS  1309034

 Score = 44.7 bits (104),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +1

Query  390      VHVTSTQNVLASGSGLNRKTVA-YTFPQTAAPHEAVK  425
                VHV+STQ+V+ S + ++++ VA Y FPQT AP+EA++
Sbjct  1311325  VHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYEAIR  1311435

 Score = 38.9 bits (89),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 24/30 (80%), Gaps = 1/30 (3%)
 Frame = +1

Query  149      DRDEDAE-MEELGANVDKIRGYNELLDAYT  177
                + D+DA  M++L  NV+KIRGYNELLD Y+
Sbjct  1309783  EEDDDANAMDDLRKNVEKIRGYNELLDTYS  1309872

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 179/259 (69%), Gaps = 37/259 (14%)
 Frame = -3

Query  153    DAEMEELGANVDKIRG------------YNELLDAYTENFAVQQNLQLTRICAAALDSNV  200
              +A+M+ L  +  +I+G             +E L    +NF+V+QNLQL+R+C   +DSNV
Sbjct  13870  EAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNV  13694

Query  201    DLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT------------  248
              D+ VYVSPFELT DV QY +KLLQLGG+AD   RVKLVFPE A RFPT            
Sbjct  13693  DI-VYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSP  13517

Query  249    -----------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIR  297
                          K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +R
Sbjct  13516  HCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMR  13337

Query  298    ADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMR  357
              ADVNVPTGTY++YD+ EL  +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+R
Sbjct  13336  ADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALR  13157

Query  358    ELRREKRAPEYWRQPGPRD  376
              E+RREKR+PEYWRQPG RD
Sbjct  13156  EIRREKRSPEYWRQPGTRD  13100

 Score = 44.3 bits (103),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 9/48 (19%)
 Frame = -3

Query  131    SNVEDDDLSDEDQGAAGNDRDEDAE-MEELGANVDKIRGYNELLDAYT  177
              +NV++D + DE        +D+DA  M+EL  NV+KIRGYNELLD Y+
Sbjct  14476  TNVDEDLMYDE--------KDDDANAMDELRKNVEKIRGYNELLDTYS  14357

 Score = 39.3 bits (90),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 9/45 (20%)
 Frame = -3

Query  390    VHVTSTQNVL---------ASGSGLNRKTVAYTFPQTAAPHEAVK  425
              VHV+STQ++L           G     K+V Y FPQTAAP+EA++
Sbjct  12904  VHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIR  12770

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 238 bits (607),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 164/222 (74%), Gaps = 25/222 (11%)
 Frame = -1

Query  178    ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
              +NF+V+QN+QL+R+C   +D NVD+ VYVSPFELTADV+QY +KLLQLGG+AD   RVKL
Sbjct  99141  DNFSVKQNIQLSRLCGL-IDPNVDI-VYVSPFELTADVAQYSMKLLQLGGIADPVARVKL  98968

Query  238    VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
              V+PEQA RFP                         K+AYLV G+PG ED+RLA+AL++PI
Sbjct  98967  VYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPI  98788

Query  275    lgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334
              LG  P  ALPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL ++H++Q  W+L
Sbjct  98787  LGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVL  98608

Query  335    KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
              K+DYDP G G A++D+S M  +RE+RREK++PEYW+QP  RD
Sbjct  98607  KIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRD  98482

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 74/144 (51%), Gaps = 30/144 (21%)
 Frame = -3

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTV----------  50
               M++ QQQHHVEDVGR+LLQTQEQLR+MREQM          +S MR ++           
Sbjct  101023  MDQFQQQHHVEDVGRILLQTQEQLRLMREQMA---ATSTTPSSSMRFASSGASQPDVLAF  100853

Query  51      -----KTEMELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVG----APPSIRLRGG  101
                    + E+E+RAKAELVLNG V        N +   + LP V+      A P  RLR  
Sbjct  100852  QEILQRAEVEIRAKAELVLNGFV--------NTSSQASALPTVSSSANGNASPKARLRQN  100697

Query  102     YDSVGKPKMTTRKDGGSIPMEFFR  125
                 S+   +  +R       +++FR
Sbjct  100696  VTSLTAARRNSRLASDEPDLDYFR  100625

 Score = 39.3 bits (90),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  135    DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
              DD+++      A +D D+ + M+EL  NV+KIRGYNELLD Y+
Sbjct  99867  DDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYS  99739

 Score = 38.1 bits (87),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 14/50 (28%)
 Frame = -1

Query  390    VHVTSTQNVLASGSG--------------LNRKTVAYTFPQTAAPHEAVK  425
              VHV+STQ+++ + S                  KTV Y FPQTAAP+EA++
Sbjct  98286  VHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIR  98137

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 161/223 (72%), Gaps = 26/223 (12%)
 Frame = +2

Query  178    ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
              ENF+V+QNLQL+R+ A  +D NV++ VYV+PFEL+ +VSQYF+KLLQL G+A++  RV+L
Sbjct  22520  ENFSVKQNLQLSRL-AGLVDQNVEI-VYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRL  22693

Query  238    VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
              VFPE A +FP                        GK+AYLVMG+PG EDQRLA+AL +PI
Sbjct  22694  VFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPI  22873

Query  275    lgappaqalp-llTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333
              LG     ++  L+TRSG KR  I+ADVNVPTGTY++YD  EL  +LAKL ++H++Q  WL
Sbjct  22874  LGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWL  23053

Query  334    LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
              LKLD DPLG G AI+D+S M  +R++RREKR PEYW+QPG RD
Sbjct  23054  LKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRD  23182

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 78/144 (54%), Gaps = 17/144 (12%)
 Frame = +2

Query  1      MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT-------aaaeaveanaSPMRHSTVKTE  53
              ME++QQ+HHVEDVGR+LLQTQ+QLR +REQ+         +  A     + +     + E
Sbjct  20813  MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAEIEEILQRAE  20992

Query  54     MELRAKAELVLNGMVnsssndqsnqnqHGTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTR  113
               ELR KAELVL+ +V +        ++ G L+P  TV                K ++   
Sbjct  20993  DELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRR-----PPIARRRRRKAEL---  21148

Query  114    KDGGS--IPMEFFRERFRNSNVED  135
               DGGS  + +E+FR+RF+ + V+D
Sbjct  21149  HDGGSYDLDIEYFRQRFKRTAVDD  21220

 Score = 40.4 bits (93),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = +2

Query  151    DEDA-EMEELGANVDKIRGYNELLDAYT  177
              DE A  ME+L  NV+KIRGYNELLDAY+
Sbjct  21839  DEAANSMEDLRNNVEKIRGYNELLDAYS  21922

 Score = 37.7 bits (86),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 6/40 (15%)
 Frame = +2

Query  390    VHVTSTQNVLASGSGLN-----RKTVAYTFPQTAAPHEAV  424
              VHV ST +VL SG+G       R+  A+ FPQT  PHEA+
Sbjct  23378  VHVMSTNDVL-SGNGTTLSQRQRRPAAFVFPQTLVPHEAI  23494

>ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_90_length_79489:1:79489:1 
REF
Length=79489

 Score = 176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 146/253 (58%), Gaps = 37/253 (15%)
 Frame = -3

Query  155   EMEELGANVDKIRGYNELL------------DAYTENFAVQQNLQLTRICAAALDSNVDL  202
              M    +N DKIR     +               TE F++QQNLQL R+CA  +D NV+L
Sbjct  6779  SMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAV-IDENVEL  6603

Query  203   LVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT--------------  248
              +Y+ PFELT D+ QY++KLLQLGG++D+  R+KL+ PE A RFP+              
Sbjct  6602  -IYICPFELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRT  6426

Query  249   ---------GKDAYLVMGLPGAEDQRLAIALDlpilgappaqalpllTRSGGKRLLIRAD  299
                      G++AY+V G PG ED+R+A  L +PILG    ++L   T SG KR   +A+
Sbjct  6425  LNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKAN  6246

Query  300   VNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMREL  359
             VN      +LYD++EL  +LAKL  +H  Q   +L+LDYDP G G A++D+S +Q+++E+
Sbjct  6245  VNTLPACIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEV  6066

Query  360   RREKRAPEYWRQP  372
             R   +  E W QP
Sbjct  6065  RLRTKTLESWLQP  6027

 Score = 43.9 bits (102),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  1     MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
             M+ ++Q+HH ED+GR+LLQTQ++LR +R +++
Sbjct  8389  MDHLEQKHHTEDIGRILLQTQQELREIRAEIS  8294

>ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:1 
REF
Length=105594

 Score = 174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/219 (45%), Positives = 137/219 (63%), Gaps = 25/219 (11%)
 Frame = -2

Query  177   TENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVK  236
             TE F++QQNLQL R+CA  +D NV+L +Y+ PFELT D+ QY++KLLQL G++D+  R+K
Sbjct  9344  TEQFSIQQNLQLQRLCAL-IDENVEL-IYICPFELTDDIVQYYMKLLQLAGISDAAARIK  9171

Query  237   LVFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlp  273
             L+ PE A RFP+                       G++AYLV G PG ED+RLA  L +P
Sbjct  9170  LMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIP  8991

Query  274   ilgappaqalpllTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWL  333
             ILG  PA+   + T SG KR   + + N   G+ +LYD++EL  +LAKL   +  Q   +
Sbjct  8990  ILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMV  8811

Query  334   LKLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQP  372
             LKLDYDP   G A++D+S +Q+++ LR   R  +YWRQP
Sbjct  8810  LKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQP  8694

 Score = 42.0 bits (97),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  1      MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
              ME+++Q++H EDVGR+LLQTQ++LR +R +++
Sbjct  11100  MEQVEQKYHKEDVGRILLQTQQELRDIRAEIS  11005

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 101 bits (252),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 74/116 (64%), Gaps = 25/116 (22%)
 Frame = -3

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               ENF++QQNLQ+ R+CA A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD + R+++
Sbjct  378753  ENFSIQQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQKYQVRLLQLGGIADPQTRIRM  378580

Query  238     VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIAL  270
               + PE   RFP                        GKDAY+V G  G ED+RLAIAL
Sbjct  378579  LHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIAL  378412

 Score = 58.5 bits (140),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -2

Query  289     SGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKL  336
               SGGKR+ + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+
Sbjct  378307  SGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKV  378164

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 3/62 (5%)
 Frame = -3

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
               MEK+ QQ+H EDVGR+LLQ Q++LR MRE++             +     + E +LRAKA
Sbjct  380796  MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAI---LERAEADLRAKA  380626

Query  61      EL  62
               E+
Sbjct  380625  EV  380620

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 101 bits (252),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 74/116 (64%), Gaps = 25/116 (22%)
 Frame = -1

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               +NFA++QNLQ+ R+CA A D NVD+ +Y+SPFEL+AD+ +Y ++LLQLGG+AD   RV++
Sbjct  175225  DNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRM  175052

Query  238     VFPEQALRFP-----------------------TGKDAYLVMGLPGAEDQRLAIAL  270
               + PE A RFP                        GK+AY+V G  G ED+RLAI L
Sbjct  175051  LHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRL  174884

 Score = 54.3 bits (129),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  289     SGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKL  336
               SG KRL  +ADVN+P G +++YD+ EL  +LAKL   ++ Q  WL+K+
Sbjct  174786  SGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKV  174643

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = -3

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
               M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +          +     + E++LR+KA
Sbjct  177176  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILE---RAELDLRSKA  177006

Query  61      ELV  63
               E+ 
Sbjct  177005  EVT  176997

 Score = 35.8 bits (81),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 14/50 (28%)
 Frame = -3

Query  158     ELGANVDKIRGYNELLDAYTENFAVQQNLQLTRICAAALDSNVDL-LVYV  206
               EL  NV+KIRGYN+LLD Y          +  R C    DS +DL LVY+
Sbjct  175964  ELRNNVEKIRGYNDLLDTY----------RSPRCCH---DSYIDLGLVYI  175854

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 95.1 bits (235),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 73/116 (63%), Gaps = 25/116 (22%)
 Frame = +1

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               +NF+++QNLQ+ R+CA A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D + R+++
Sbjct  730144  DNFSIRQNLQMARMCAIA-DPNVDI-IYISPFELSPDIQRYQVRLLQLGGITDPQTRIRM  730317

Query  238     VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIAL  270
               + PE   RFP                        GK+AY+V G  G ED+RLAIAL
Sbjct  730318  LHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIAL  730485

 Score = 59.3 bits (142),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  287     TRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDY  338
               T SGGKR+ + ADVN+P G +++YD+ EL  +L+KL    +DQ  WL+K+ Y
Sbjct  730592  T*SGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKVRY  730747

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 39/62 (63%), Gaps = 3/62 (5%)
 Frame = +3

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
               M+K+ QQ+H EDVGR+LLQ Q++LR MRE++           + +     + E +LRAKA
Sbjct  728103  MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILE---RAEADLRAKA  728273

Query  61      EL  62
               E+
Sbjct  728274  EV  728279

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 123/251 (49%), Gaps = 54/251 (22%)
 Frame = +3

Query  178     ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237
               +NFA++QNLQ+ R+CA A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD   RV++
Sbjct  427788  DNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRM  427961

Query  238     VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDlpi  274
               + PE A RFP                        GK+AY+V G  G ED+RLAI L LP+
Sbjct  427962  LHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPL  428141

Query  275     lgappaqalpllTRSGG--KRLLIRADVNVPTGTYELYDDHELFAA--------------  318
               LG  P +AL   TR      RLL+   V      Y     H +                 
Sbjct  428142  LGMDPDRALLYGTRVRCLFCRLLMLGVVGCEAAFYASRRQHSVRRPRHLRRRRADSELGQ  428321

Query  319     -----LAKLAVTH-----MDQPRWLLKLDYDPLGVGEAIIDLSGMQAMRELRREKRA---  365
                    LA   V H        P     LD DP   G A ID+  ++ + ++R EKRA   
Sbjct  428322  AHGRQLAPRHVAHQGALTFSHPYHSA*LDADPSDTGLAAIDMHALECVNKVRAEKRAMKN  428501

Query  366     PEYWRQPGPRD  376
                EY+ QP  ++
Sbjct  428502  DEYYSQPNIKE  428534

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = +1

Query  1       MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTaaaeaveanaSPMRHSTVKTEMELRAKA  60
               M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +          +     + E++LR+KA
Sbjct  425827  MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDVDALQAILE---RAELDLRSKA  425997

Query  61      EL  62
               E+
Sbjct  425998  EV  426003

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 64.7 bits (156),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  287    TRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMD  328
              TR+G KRL ++ADVNVPTGTY+LYD  EL  ALAKL ++H+D
Sbjct  13354  TRAGAKRLFLKADVNVPTGTYDLYDVDELLFALAKLIISHLD  13229

 Score = 52.0 bits (123),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 32/46 (70%), Gaps = 1/46 (2%)
 Frame = -2

Query  332    WLLKLD-YDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376
              W+L+LD +D    G A++D+S +  +RE+RR  + P YW+QPG RD
Sbjct  13202  WVLRLDAHDVRATGTALLDVSALTTLREIRRAHKPPAYWKQPGIRD  13065

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = -3

Query  178    ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLK  221
              ++FAVQQNLQL R+ AA +D+ V+ +VYVSPFEL  D+SQY +K
Sbjct  13792  DHFAVQQNLQLARL-AAVVDATVEYVVYVSPFELPTDLSQYVVK  13664

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -2

Query  1      MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
              ME++QQQHHVEDVGR+LL TQ+QLR +REQ++
Sbjct  15764  MEQLQQQHHVEDVGRILLHTQDQLRHLREQLS  15669

 Score = 38.9 bits (89),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 28/46 (61%), Gaps = 10/46 (22%)
 Frame = -2

Query  132    NVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177
              +++D D S+ D  A          M++L  NV+KIRGYNELLD Y+
Sbjct  14534  HIDDADASESDANA----------MDDLRKNVEKIRGYNELLDTYS  14427

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  1      MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMT  32
              M++ QQ HHVEDVGR+LLQTQEQLR+MREQMT
Sbjct  12083  MDQFQQHHHVEDVGRILLQTQEQLRLMREQMT  12178

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 42.7 bits (99),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -1

Query  1     MEKMQQQHHVEDVGRLLLQTQEQL  24
             ME ++QQHH EDVGR+LLQTQE +
Sbjct  1356  MEPLEQQHHAEDVGRILLQTQEHV  1285

 Score = 37.4 bits (85),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 26/46 (57%), Gaps = 7/46 (15%)
 Frame = -3

Query  130  NSNVEDDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDA  175
            ++++  DD  D D G AG        MEELGANV KIRGY   L A
Sbjct  196  DASMRPDDPIDADDGEAG-------AMEELGANVAKIRGYTAQLAA  80

>SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154v2:supercont2.7:1:943373:1 
REF
Length=943373

 Score = 35.0 bits (79),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 41/83 (49%), Gaps = 5/83 (6%)
 Frame = +1

Query  82      GTLLPAVTVGAPPSIRLRGGYDSVGKPKMTTRKDGGSIPMEFFRERFRNS---NVEDDDL  138
               G L P  T G P S R R  + + G    T R  G   PM   R R R++   +VEDD +
Sbjct  194203  GCLAPRRTPGCPASRRPRALFGANG*AARTIRPRGTLSPM-IHRRRARST*GAHVEDDAV  194379

Query  139     SDEDQGAAGNDRDEDA-EMEELG  160
                 ++  AAG+ R+ +A EM   G
Sbjct  194380  ESDEAAAAGDIRELEALEMRARG  194448

Lambda      K        H        a         alpha
   0.317    0.134    0.388    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 126845562948

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40