Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHSO:scaffold_1279913027996211665034e-58
PLHA:NW_020189861.1184554418460801794382e-49
HYAP:scaffold_591899761905662004233e-47
PHCA:scaffold_8499875100144903046e-45
PHKE:scaffold_986679966987633315e-35
PHPA:scaffold_63250552250749662982e-30
PHRA:scaffold_56151403151591632911e-29
PHIF:NW_003303697.1430597430785632911e-29
PYAP:scaffold_16219066195841742822e-28
ALLA:FR8240811015491020341652213e-20
PYVX:scaffold_27526972888642118e-19
SADI:scaffold_42052472056901511843e-15
ALCA:scaffold_801823418386541511e-10
PYIR:scaffold_8102735102890551492e-10
PYUU:scaffold_203713064911306631471483e-10
PYIW:scaffold_9631023110389561457e-10
APAS:scaffold_12707007707162541385e-09
APIN:scaffold_20400835401002581299e-08
SAPA:scaffold_24393651393788491244e-07
PYAR:scaffold_291705017139301136e-07
HYAP:scaffold_82156991584550940.004
PYVX:scaffold_5755743587444770.76
APIN:scaffold_2358686558698440723.6
ALCA:scaffold_64762347635340723.7
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYKE_8392

Length=138
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHSO:scaffold_1                                                       198        4e-58
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  173        2e-49
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  167        3e-47
PHCA:scaffold_84 PHYCAscaffold_84                                     121        6e-45
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  132        5e-35
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  119        2e-30
PHRA:scaffold_56                                                      116        1e-29
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  116        1e-29
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  113        2e-28
ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:...  89.7       3e-20
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  85.9       8e-19
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  75.5       3e-15
ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig sup...  62.8       1e-10
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  62.0       2e-10
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  61.6       3e-10
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  60.5       7e-10
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  57.8       5e-09
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  54.3       9e-08
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  52.4       4e-07
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  48.1       6e-07
HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  40.8       0.004
PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pv...  34.3       0.76 
APIN:scaffold_23 supercont1.23 dna:supercontig supercontig:Apha_i...  32.3       3.6  
ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig sup...  32.3       3.7  

>PHSO:scaffold_1
Length=13391543

 Score = 198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 128/166 (77%), Gaps = 30/166 (18%)
 Frame = +1

Query  1        MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPK------------  48
                MAEAARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+HGDL+DP+            
Sbjct  2799130  MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGCVHVVSCPSCP  2799309

Query  49       ----------------EVskllqlaqsslsylkIVTPRDETESNSGVQRYIYRNGQRVNA  92
                                 VS L+Q AQSSLSYLKIVTPR E  SN+GVQR+IYRNGQRVNA
Sbjct  2799310  AV*SLYCVDAMSVCGCRVSALIQRAQSSLSYLKIVTPRGE--SNTGVQRFIYRNGQRVNA  2799483

Query  93       AELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138
                AE E KGEENARYKTQD+EAGLKRHHQL+RRQ+FMDRKSGPPRP+F
Sbjct  2799484  AEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRKSGPPRPIF  2799621

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 121/179 (68%), Gaps = 41/179 (23%)
 Frame = -1

Query  1        MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE-----------  49
                M+ A RELRPLYKKLLR+AQ LP+ KR  S+ QIRREFR H DL+DPKE           
Sbjct  1846080  MSNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKE*LDEVNFSCLS  1845901

Query  50       -----------VskllqlaqsslsylkIVTPR-------------------DETESNSGV  79
                           VS+ +Q AQSSLSYLKI+TPR                   D   +++GV
Sbjct  1845900  RSNSSLQFLLRVSEFIQRAQSSLSYLKIITPRTESSRCFVALRYPAICR*LDSNHTDTGV  1845721

Query  80       QRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138
                QR+IYRNGQRVNAA+ E+KG ENAR+KTQDMEAG KRHHQL+RRQ+FMDRKSGPPRP+F
Sbjct  1845720  QRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRKSGPPRPIF  1845544

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 127/200 (64%), Gaps = 65/200 (33%)
 Frame = +1

Query  1       MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE-----------  49
               MA+A   +RPLYKKLLR+AQ+LPEPKR +SL QIRREFR HGDL+DPKE           
Sbjct  189976  MADA---MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKECVVVVIMNKSR  190146

Query  50      ------------------VskllqlaqsslsylkIVTPRDETE-----------------  74
                                 VS LLQ AQSS+ +LKIVTPR E+                  
Sbjct  190147  FLFVS*LPNELSICFRCRVSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCLTLSL  190326

Query  75      ----------------SNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHH  118
                               S++G+QR++YR+G+R++AAEL++KGEENARYKTQD+EAG+KRHH
Sbjct  190327  FSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHH  190506

Query  119     QLMRRQHFMDRKSGPPRPMF  138
               QL+RRQHFMDRKSGPPRP+F
Sbjct  190507  QLLRRQHFMDRKSGPPRPIF  190566

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 121 bits (304),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 17/90 (19%)
 Frame = +2

Query  66      IVTPRDETE-----------------SNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQ  108
               IVTPR E+                  +++GVQR+IYR+G+RVNA ELE KGEENAR+KTQ
Sbjct  99875   IVTPRAESSEFCLFICSCFLAESTAATDTGVQRFIYRDGKRVNAEELEGKGEENARWKTQ  100054

Query  109     DMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138
               DMEAGLKRHHQL+RRQ+FMDRKSGPPRP+F
Sbjct  100055  DMEAGLKRHHQLLRRQYFMDRKSGPPRPIF  100144

 Score = 80.5 bits (197),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  4      AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
              AARELRPLYKKLLR+AQ+LPEPKR  S+ QIRREFR+H DL+DPKE 
Sbjct  99627  AARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEC  99767

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 132 bits (331),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/63 (98%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +1

Query  76     NSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR  135
              +SGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR
Sbjct  66799  DSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR  66978

Query  136    PMF  138
              PMF
Sbjct  66979  PMF  66987

 Score = 100 bits (250),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/50 (98%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = +2

Query  1      MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
              MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE 
Sbjct  66365  MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEC  66514

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +1

Query  73      TESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSG  132
               T ++ GVQRYIYRNGQRVNA E EEKGEENAR+KTQDME GL+RHHQL+RRQ+F+DRKSG
Sbjct  250552  TNADMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRKSG  250731

Query  133     PPRPMF  138
               PPRP+F
Sbjct  250732  PPRPIF  250749

 Score = 86.7 bits (213),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  1       MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
               MAEA RELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FRNHGDL+DP+E 
Sbjct  250214  MAEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEC  250363

>PHRA:scaffold_56
Length=334739

 Score = 116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  76      NSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR  135
               + G+QRYIYRNGQRVNA E+E  GEENARYKTQD+E GLKRHHQL+RRQHFMDRKSGPPR
Sbjct  151591  DKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPR  151412

Query  136     PMF  138
               P+F
Sbjct  151411  PIF  151403

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  2       AEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
               A AARELRPLYKKLLR+AQ+LPEPKR QSL QIRREFR+H +L+DPKE 
Sbjct  151955  AMAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEC  151809

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  76      NSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR  135
               ++GVQRYIYRNGQRVNAAE EEKG ENAR+K QDME GLKRHHQL++RQ+FM+RKSGPPR
Sbjct  430597  DTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRKSGPPR  430776

Query  136     PMF  138
               P+F
Sbjct  430777  PIF  430785

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +3

Query  1       MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
               MAEA  ELRPLYKKLLR+AQ+LPEPKR  S+ QIRR+FR+HGD +DPKE 
Sbjct  430254  MAEAMSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEC  430403

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 104/174 (60%), Gaps = 40/174 (23%)
 Frame = +1

Query  4      AARELRPLYKKLLRMAQALP-EPKRHQSLSQIRREFRNHGDLSDPKE-------------  49
              A  ELRPLYK+LLR+A++LP E KR  ++ QIR EFR+  D  DPKE             
Sbjct  19066  ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKE*VTAHEMR***DD  19245

Query  50     ------VskllqlaqsslsylkIVTPRDET-------------------ESNSGVQRYIY  84
                    V+ L+Q AQ+ + YLKIVTPR                       +++GV+ ++Y
Sbjct  19246  *RVEDRVAALVQRAQAKIGYLKIVTPRSTAGRMRWRVERPELCVLMRRWSADAGVKSFVY  19425

Query  85     RNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPRPMF  138
               NG+RV++++++ + EE ARYKT D E  ++RH+QL+RRQHFMDR   PP+P+F
Sbjct  19426  VNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQHFMDRGVAPPKPIF  19584

>ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:1 
REF
Length=137019

 Score = 89.7 bits (221),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/165 (41%), Positives = 95/165 (58%), Gaps = 42/165 (25%)
 Frame = +2

Query  4       AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE--------------  49
               A  + R +YK+L+R+A++LP  K+  +L  IR EFR H D+SDP +              
Sbjct  101549  AMSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQCVRIY*TLLTASNF  101728

Query  50      -------VskllqlaqsslsylkIVTPRDET------------ESN------SGVQRYIY  84
                      +S+LL+ AQS++ YLKIVTP   +            ESN      SGV+R+++
Sbjct  101729  *LKPFRRLSQLLERAQSTIGYLKIVTPHKRSGPWLCVCLSH*SESNQMLCSDSGVKRFMF  101908

Query  85      RNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDR  129
               ++G+R+   E   K  E AR+K QD+  GLKRHHQL+RRQHFMDR
Sbjct  101909  KDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  102034

 Score = 32.7 bits (73),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -3

Query  11     LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLS  45
              LY+++LR+A+  P  KR   ++ IR EFR   D++
Sbjct  72679  LYRRILRLARRYPSIKRDAIINDIRMEFRESRDIT  72575

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 85.9 bits (211),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  75    SNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPP  134
             + SGV+RYIYRNGQRV+A   E  GE+ ARYKT DME  LKRHHQL+RRQHFMDR   PP
Sbjct  2888  TASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDRGVAPP  2709

Query  135   RPMF  138
             RP+F
Sbjct  2708  RPIF  2697

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -1

Query  7     ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
             ELRPLYKKLLR+AQ+LPEPKR  +++QIR EFR+H +++D  E 
Sbjct  3261  ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEC  3130

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 55/151 (36%), Positives = 87/151 (58%), Gaps = 31/151 (21%)
 Frame = -1

Query  8       LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE--------------Vskl  53
               +R  YKKLL++A+++P+ +R Q+L ++R EFR H   + P+E              + +L
Sbjct  205690  IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEE*VMRRRDRRSRVGRLDQL  205511

Query  54      lqlaqsslsylkIVTPRDETES--------------NSGVQRYIYRNGQRVNAAELEEKG  99
               L+ AQS +SYLKIVTP+  + +              ++    ++Y+NGQR++  EL    
Sbjct  205510  LRKAQSKISYLKIVTPKKSSSAYARGCVWNMTFLVGSTQGSHFVYKNGQRIDGRELSA--  205337

Query  100     EENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
                ++A  KT D  A + +H QL+RRQHFMDRK
Sbjct  205336  -DSATIKTHDYNAMMTKHVQLVRRQHFMDRK  205247

>ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_80_length_84930:1:84930:1 
REF
Length=84930

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 3/54 (6%)
 Frame = +3

Query  76     NSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDR  129
              +SGV+ ++Y++G+R+   E   +  E A++K QDME GLKRH+QL+RRQ+FMDR
Sbjct  18234  DSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  18386

 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +1

Query  1      MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDP  47
              +  A  E R ++KK++++A++LP  K+  +L  IR EFR H D+ DP
Sbjct  17896  IMTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDP  18036

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = -2

Query  76      NSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
               ++GV+ YIY+NGQRV A  + E G   A+Y   D  A ++RH +L+RRQHFMDRK
Sbjct  102890  DAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRRQHFMDRK  102735

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  2       AEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
               A A  +LRP+YKKLL++A+ LPE KR  +L+QIR EFR   D+SDPKE 
Sbjct  103338  AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKEC  103192

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  4        AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
                A+ +LRP+YKKLL++AQ LP  KR  ++ QIRREFR H    DPKE 
Sbjct  1306491  ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEC  1306631

 Score = 51.6 bits (122),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +1

Query  75       SNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
                +++GV+ Y+Y  G+RV AA   E   + ARYKT D  A ++RH QL+RRQHFMDRK
Sbjct  1306885  ADAGVKNYVYIKGKRVEAAGAAE---DGARYKTADYNAQMQRHVQLLRRQHFMDRK  1307043

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = +1

Query  75     SNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
              +++GV+ YIY+NGQRV AA + E G   A+Y+  D    + RH +L+RRQHFMDRK
Sbjct  10231  ADAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMDRK  10389

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  7      ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
              +LRP+YKKLL++A+ LPE KR  +  QIR EFR+  +LSDPKE 
Sbjct  9875   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKEC  10006

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 57.8 bits (138),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +3

Query  77      SGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
               SG QR+IY++G+R+++  L++ G  N   KT D+ A ++RH +L+RRQHFMDRK
Sbjct  707007  SGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDRK  707162

 Score = 42.0 bits (97),  Expect = 0.001, Method: Composition-based stats.
 Identities = 17/44 (39%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  6       RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE  49
               + +R  YKKL+++AQ+LP  ++  +L +IR +FR+ G +S  +E
Sbjct  706702  KSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEE  706833

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 54.3 bits (129),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = -2

Query  73      TESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
                ++ +  QRYIY++G+R++   +++    NA  KT D  A ++RH +L+RRQHFMDRK
Sbjct  401002  VDAETSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFMDRK  400835

 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  6       RELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
               + +R  YKKL+++AQ+LP  ++  +L ++R EFR+HG ++   + 
Sbjct  401292  KSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQC  401158

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +3

Query  82      YIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
               ++Y+NGQR++  EL     ++A  KT D  A + +H QL+RRQHFMDRK
Sbjct  393651  FVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMDRK  393788

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  8       LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKE  49
               +R  YKKLL++A+++P+ +R Q+L ++R EFR H   + P+E
Sbjct  393339  IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEE  393464

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 48.1 bits (113),  Expect(2) = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -1

Query  101    ENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
              E ARYKT D +A ++RH QL+RRQHFMDRK
Sbjct  17139  EGARYKTADYDAQMRRHTQLLRRQHFMDRK  17050

 Score = 25.4 bits (54),  Expect(2) = 6e-07, Method: Composition-based stats.
 Identities = 9/20 (45%), Positives = 16/20 (80%), Gaps = 0/20 (0%)
 Frame = -3

Query  75     SNSGVQRYIYRNGQRVNAAE  94
              +++G QR++Y NG+ VN A+
Sbjct  17278  ADTGAQRFVYVNGKAVNGAD  17219

 Score = 31.6 bits (70),  Expect = 6.2, Method: Composition-based stats.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = -1

Query  30     SLSQIRREFRNHGDLSDPK  48
              +L QIR EFR+ GDLSDPK
Sbjct  17538  TLQQIRSEFRSSGDLSDPK  17482

>HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_82:1:287376:1 
REF
Length=287376

 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = -2

Query  1      MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
              MAEA   LR +Y+++L++AQ  P  KR   +  I+ EFR + +LSD ++V
Sbjct  15845  MAEANEVLR-MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKV  15699

>PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_575:1:19158:1 
REF
Length=19158

 Score = 34.3 bits (77),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +1

Query  7     ELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
             E+  LY+++L++AQ  P  KR   +  I+ EF  +  LSD ++V
Sbjct  5743  EVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQV  5874

>APIN:scaffold_23 supercont1.23 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.23:1:920215:1 
REF
Length=920215

 Score = 32.3 bits (72),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = -1

Query  91      NAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130
               NAA    +G +++R+++  +   L R H  +RRQ  + R+
Sbjct  586984  NAASCHGRGSKSSRFRSHPLSPHLTRKHLPLRRQSLLSRR  586865

>ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_64_length_94369:1:94369:1 
REF
Length=94369

 Score = 32.3 bits (72),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = -2

Query  11     LYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEV  50
              LY+++LR+A+  P  KR   +  IR EFR   +++ P  +
Sbjct  76353  LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAI  76234

Lambda      K        H        a         alpha
   0.317    0.132    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11485502730

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40