Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHKE:scaffold_9860616609961275844e-69
PHRA:scaffold_561609221612481095192e-60
PHPA:scaffold_632448922452181095052e-58
PHIF:NW_003303697.13950443953701094999e-58
PHCA:scaffold_8495412957381094981e-57
PHSO:scaffold_1279379227941061054972e-57
PLHA:NW_020189861.1184671618470421094699e-54
PYVX:scaffold_275645267751084072e-45
HYAP:scaffold_591612071615301083597e-39
PYUU:scaffold_203712994961299786972865e-29
PYIR:scaffold_8107051107341972812e-28
PYIW:scaffold_7111079311077962433e-23
PYIR:scaffold_224916201910971993e-17
PHPA:scaffold_66162812163099971966e-17
PHPA:scaffold_4636733960971966e-17
PHCA:scaffold_7905654905941971966e-17
PHPA:scaffold_22685378685665971959e-17
PHPA:scaffold_20363593363880971941e-16
PHRA:scaffold_1061311713404971932e-16
PHSO:scaffold_3518319186361071913e-16
PHSO:scaffold_56821726824891071913e-16
PHIF:NW_003303730.1696926697213971904e-16
PHRA:scaffold_26793489635971879e-16
PHKE:scaffold_761574861971842e-15
PHSO:scaffold_14819003819290971833e-15
PHSO:scaffold_443740564374343971816e-15
PYIR:scaffold_5024160450981767e-15
PYIR:scaffold_4828123416981761e-14
PYAP:scaffold_56082668559981737e-14
PYAR:scaffold_345921462370751702e-13
PHRA:scaffold_792586026144971693e-13
PHKE:scaffold_62236603947971693e-13
PLHA:NW_020187034.194671949821051684e-13
PLHA:NW_020189073.134597349081051632e-12
PHSO:scaffold_643796538189761596e-12
PHSO:scaffold_12168603168827761517e-11
PHIF:NW_003303626.1267045267311901463e-10
PHPA:scaffold_39149937150161761454e-10
PHPA:scaffold_164887294890641131446e-10
PHIF:NW_003303741.1157547615757751001411e-09
PHCA:scaffold_67220545220769761393e-09
PHKE:scaffold_3541439814622761393e-09
PHRA:scaffold_289217001960901393e-09
PHRA:scaffold_49483368596901393e-09
PHRA:scaffold_33370657370881761393e-09
PHIF:NW_003303747.127485842748808761323e-08
PHIF:NW_003303754.1354503335453321001305e-08
PHIF:NW_003304531.1442666761296e-08
PHSO:scaffold_1120226582022897861218e-07
PYAP:scaffold_18215671740581201e-06
PHIF:NW_003303391.18025780418551146e-06
PHRA:scaffold_105154671154865661068e-05
PHSO:scaffold_1655133455148657890.014
PYIW:scaffold_15356729691464830.082
PHKE:scaffold_22374303759457810.18
PYVX:scaffold_305155771574460800.22
PYVX:scaffold_121198491995943800.22
PHCA:scaffold_2239926139944368780.46
PHPA:scaffold_952400352416757722.6
PHPA:scaffold_46051967158713.1
PHRA:scaffold_51385343869255713.8
PHPA:scaffold_76437654394768704.4
PHCA:scaffold_1164940164956557705.4
PHIF:NW_003303738.11105161110543394695.8
PYUU:scaffold_20391235900123607057687.8
PYVX:scaffold_50421384223940688.3
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYKE_8390

Length=130
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  229        4e-69
PHRA:scaffold_56                                                      204        2e-60
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  199        2e-58
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  196        9e-58
PHCA:scaffold_84 PHYCAscaffold_84                                     196        1e-57
PHSO:scaffold_1                                                       196        2e-57
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  185        9e-54
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  161        2e-45
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  142        7e-39
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  114        5e-29
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  112        2e-28
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  98.2       3e-23
PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:...  81.3       3e-17
PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 ...  80.1       6e-17
PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 ...  80.1       6e-17
PHCA:scaffold_7 PHYCAscaffold_7                                       80.1       6e-17
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  79.7       9e-17
PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 ...  79.3       1e-16
PHRA:scaffold_106                                                     79.0       2e-16
PHSO:scaffold_35                                                      78.2       3e-16
PHSO:scaffold_5                                                       78.2       3e-16
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  77.8       4e-16
PHRA:scaffold_267                                                     76.6       9e-16
PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig superc...  75.5       2e-15
PHSO:scaffold_14                                                      75.1       3e-15
PHSO:scaffold_4                                                       74.3       6e-15
PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:...  72.4       7e-15
PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:...  72.4       1e-14
PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:p...  71.2       7e-14
PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:...  70.1       2e-13
PHRA:scaffold_79                                                      69.7       3e-13
PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:Phy...  69.7       3e-13
PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig:...  69.3       4e-13
PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig:...  67.4       2e-12
PHSO:scaffold_64                                                      65.9       6e-12
PHSO:scaffold_12                                                      62.8       7e-11
PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 g...  60.8       3e-10
PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 ...  60.5       4e-10
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  60.1       6e-10
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  58.9       1e-09
PHCA:scaffold_67 PHYCAscaffold_67                                     58.2       3e-09
PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig superc...  58.2       3e-09
PHRA:scaffold_2892                                                    58.2       3e-09
PHRA:scaffold_494                                                     58.2       3e-09
PHRA:scaffold_33                                                      58.2       3e-09
PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 ge...  55.5       3e-08
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  54.7       5e-08
PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 ...  54.3       6e-08
PHSO:scaffold_11                                                      51.2       8e-07
PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:p...  50.8       1e-06
PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 g...  48.5       6e-06
PHRA:scaffold_105                                                     45.4       8e-05
PHSO:scaffold_16                                                      38.9       0.014
PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:...  36.6       0.082
PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKe...  35.8       0.18 
PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pv...  35.4       0.22 
PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pv...  35.4       0.22 
PHCA:scaffold_22 PHYCAscaffold_22                                     34.7       0.46 
PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 u...  32.3       2.6  
PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310...  32.0       3.1  
PHRA:scaffold_51                                                      32.0       3.8  
PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 ...  31.6       4.4  
PHCA:scaffold_11 PHYCAscaffold_11                                     31.6       5.4  
PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 ge...  31.2       5.8  
PYUU:scaffold_2039 scf1117875582039 dna:supercontig supercontig:p...  30.8       7.8  
PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_...  30.8       8.3  

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 127/127 (100%), Positives = 127/127 (100%), Gaps = 0/127 (0%)
 Frame = -2

Query  1      MKHtlplllltllpllttGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV  60
              MKHTLPLLLLTLLPLLTTGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV
Sbjct  60996  MKHTLPLLLLTLLPLLTTGQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGV  60817

Query  61     NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG  120
              NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG
Sbjct  60816  NTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSG  60637

Query  121    YTMDGPC  127
              YTMDGPC
Sbjct  60636  YTMDGPC  60616

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -3

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q+VL P P +  D  D +   LA+L+ QG  T  +   W  ++GY +LRA +D  A Y V
Sbjct  59177  QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV  59001

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              T+ A + CG T+     Q IP+ +  +++GYT DGPC
Sbjct  59000  TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPC  58890

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 57/97 (59%), Gaps = 1/97 (1%)
 Frame = +1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q+VL P P +  D    +   LA+L++QG +T  +   W + +GY SLRA  +D+A Y V
Sbjct  57502  QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRA-FNDDASYTV  57678

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              ++ A F CG T      Q IP ++  +++GYT DGPC
Sbjct  57679  SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPC  57789

>PHRA:scaffold_56
Length=334739

 Score = 204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/109 (87%), Positives = 102/109 (94%), Gaps = 0/109 (0%)
 Frame = +2

Query  19      GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
               GQRRL A LGEGQIVL PPPFFIVDGLDFQGMALAYLQEQGVNTSIE QGWM  HGY SL
Sbjct  160922  GQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASL  161101

Query  79      RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               R+MLDDE+LY+VTEEA+FDCGLTSPKTETQLIPTNS+FQ+SGYT+DGPC
Sbjct  161102  RSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPC  161248

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = -1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D    +   LA+L++QG +T  +   W   +GYDSLRA  DD A Y V
Sbjct  164075  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTV  163899

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               ++ A F CG T    + Q IP  +  +++GYT DGPC
Sbjct  163898  SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPC  163788

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D +   LA+L+ QG  T  +   W  S+GY +LRA +D  A Y V
Sbjct  162547  QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  162723

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                + A + CG T+     Q IP  +  +++GYT DGPC
Sbjct  162724  ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPC  162834

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = -1

Query  19      GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
               GQRRL A LGEGQ+VL PPPFF+VDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SL
Sbjct  245218  GQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSL  245039

Query  79      RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               RAMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  245038  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  244892

 Score = 74.3 bits (181),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = -2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  ++GY +LR  + D A Y V
Sbjct  243495  QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFM-DRAKYTV  243319

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T+ A + CG T+     Q IP + T +++GYT DGPC
Sbjct  243318  TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPC  243211

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL   P +  D  D +   LA+L++QG  T  +   W   +GYDSLRA  +D A Y V
Sbjct  241996  QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRA-FNDGASYTV  242172

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               ++ A   CG T+   + Q IP  +  +++GYT DGPC
Sbjct  242173  SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPC  242283

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 196 bits (499),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -1

Query  19      GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
               GQRRL A LGEGQIVL PPPFF+VDGLDFQGMALAYLQEQG+NTSIE Q WM   GY SL
Sbjct  395370  GQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSL  395191

Query  79      RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               RAMLDDE+LYKVTEEA+F+CGLTSP+TETQ IPTN++FQTSGYT+DGPC
Sbjct  395190  RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPC  395044

 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 5/97 (5%)
 Frame = -3

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D +   L +L+ QG  T  +  GW  ++GY +LR  ++    Y V
Sbjct  359149  QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  358982

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                + A + CG T+     Q  P +   +++GYT DGPC
Sbjct  358981  ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPC  358874

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -3

Query  19     GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
              GQRRL A LGEGQ+V  PPPFFIVDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SL
Sbjct  95738  GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  95559

Query  79     RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              RAMLDDE+LY+VTEEA+F+CGLTSPKTETQ IPTN++FQTSGYT+DGPC
Sbjct  95558  RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPC  95412

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = -1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  S+GY +LRA +D  A Y V
Sbjct  94216  QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  94040

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              T+ A + CG T+ K   Q IP + T +++GYT DGPC
Sbjct  94039  TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPC  93932

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q+VL P P +  D    +   LA+L++QG  T  +   W   +GYDSLRA  +D A Y V
Sbjct  92747  QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTV  92923

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              ++ A F CG T+   + Q IP  +  +++GYT DGPC
Sbjct  92924  SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPC  93034

>PHSO:scaffold_1
Length=13391543

 Score = 196 bits (497),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 89/105 (85%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -1

Query  23       LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
                L   LGEGQ+V  PPPFFIVDGLDFQGMALAYLQEQGVNTSIE Q WM  HGY SLRAML
Sbjct  2794106  LDPGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMQEHGYASLRAML  2793927

Query  83       DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                DDE+LYKVTEEALFDCGLTSPKTETQ IP+NS+FQTSGYT+DGPC
Sbjct  2793926  DDESLYKVTEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPC  2793792

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = +1

Query  28       GEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEAL  87
                G  Q+VL P P +  D    +   LA+L++QG  T  +   W   +GYDSLRA  +D A 
Sbjct  2790343  GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRA-FNDGAS  2790519

Query  88       YKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                Y V + A F CG T+   E Q IP ++  +++GYT DGPC
Sbjct  2790520  YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPC  2790639

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -1

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q+VL P P +  D    +   LA+L+ QG  T  +   W    GY +LRA +D  A Y V
Sbjct  2791874  QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYTV  2791698

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                 + A + CG T  K   Q IP + T +++GYT DGPC
Sbjct  2791697  ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPC  2791590

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 185 bits (469),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  19       GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78
                G RRL+A LGEGQ+VL P PF++VDGLDFQGMALAYL+EQG+NTSIE Q WM  H Y+SL
Sbjct  1847042  GYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSL  1846863

Query  79       RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                RAMLDD+ LYKVTEEA+F+CGLTSPKTETQ IPTN++F TSGYT+DGPC
Sbjct  1846862  RAMLDDDMLYKVTEEAIFECGLTSPKTETQPIPTNNSFVTSGYTLDGPC  1846716

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +2

Query  20    QRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLR  79
             QRRL + LGEGQ+VL PPPFF+VDG+D++G  +AYL++QGV+T+IE Q W+   GY +LR
Sbjct  6452  QRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLR  6631

Query  80    AMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             A++DD+ LY VTEE LFDCGLT P TETQ IPTN +F TSGYT+DGPC
Sbjct  6632  ALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  6775

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +2

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G+++++G+DSLRA +DD++LY V
Sbjct  7592  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  7771

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A F CG T P    Q IP +   +++GYT DGPC
Sbjct  7772  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPC  7879

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 3/97 (3%)
 Frame = +3

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q V+ P P +     D     LA+L++QG  T  +   W  S+GY +LRA + D+A Y V
Sbjct  13560  QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFM-DQASYTV  13736

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              T+ A   CG T      Q IP N  F+++GYT DGPC
Sbjct  13737  TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPC  13841

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = -1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q V+ P P +  D  D     LA+L++QG +T  +   W + +GYDSLRA + D A Y V
Sbjct  14919  QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFM-DGASYTV  14743

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              T+ A   CG T+     Q +P +   +++GYT  GPC
Sbjct  14742  TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPC  14635

 Score = 42.7 bits (99),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLD  83
             Q V+ P P +  +  D     LA+L++QG  T  +   W +++GYD+LRA +D
Sbjct  9298  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  9140

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (48%), Gaps = 1/69 (1%)
 Frame = +2

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q V+ P P +     D     LA+L+ QG  T  +   W  ++GY +LR+ + D   Y V
Sbjct  12440  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFM-DSGKYTV  12616

Query  91     TEEALFDCG  99
              T  A   CG
Sbjct  12617  TSGADQQCG  12643

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 142 bits (359),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 1/108 (1%)
 Frame = +2

Query  21      RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
               +RL ++L EGQ+VL P P FIVD    QG ALAYLQEQG++TSIE Q W   HGY SLRA
Sbjct  161207  QRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRA  161386

Query  81      MLDDEALYKVTEEALFDCGLTSPKTET-QLIPTNSTFQTSGYTMDGPC  127
               MLDD++LY V+++A+FDCG TS  +ET Q IPTN T ++SGYT+DGPC
Sbjct  161387  MLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPC  161530

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +1

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +  G+M   GY +LRA++DDE LY+V
Sbjct  1299496  QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  1299675

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  +ALF+CG T P  E+Q IPT  T +++GYT DGPC
Sbjct  1299676  NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPC  1299786

 Score = 101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -3

Query  33       VLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE  92
                VL P PF++VDG + Q   +A+L+EQG+ TS +   +M   GY +LRAMLDD+ LY V  
Sbjct  1303085  VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  1302906

Query  93       EALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                +AL +CG T P  E+Q IP  + F ++GY ++GPC
Sbjct  1302905  DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPC  1302801

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +1

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q+V+ P P F V   D +   LA+L+ QG  T+ +   +  S GY SLRA +DD+  YKV
Sbjct  1298032  QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  1298211

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                   A F+CG T+     Q IP N  F+T+GYT DGPC
Sbjct  1298212  NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPC  1298316

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = +3

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q V  P P + V         L++L++ GV TS    G+M   GY++LR ++DD+ LYKV
Sbjct  1301001  QAVEVPKPNWTVPKKATYWAPLSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQKLYKV  1301180

Query  91       TEEA-LFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                   A  F CG T P   +Q IP +ST +T+GYT  GPC
Sbjct  1301181  NSNADNFLCGYTDPTKGSQPIPKDSTMRTTGYTHVGPC  1301294

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY SLRA +DD+  YKV
Sbjct  1288637  QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  1288816

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                   A F CG T    + Q IP   T +++GYT DGPC
Sbjct  1288817  AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPC  1288924

 Score = 74.3 bits (181),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q V+ P P F V     Q   LA+L+ QG  T+++   +  + GY +LRA +DD   YKV
Sbjct  1294361  QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  1294540

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                   A F CG T    + Q IP   T +++GYT DGPC
Sbjct  1294541  AAGADFQCGWTKLDGKRQPIPAG-TIRSTGYTHDGPC  1294648

 Score = 71.6 bits (174),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = +3

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY +LRA +DD+  Y V
Sbjct  1295898  QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  1296077

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                   A F+CG T      Q IP   T +++GYT DGPC
Sbjct  1296078  ASGADFECGWTKLDGTRQSIPAG-TIRSTGYTHDGPC  1296185

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 112 bits (281),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q ++ P PFF+VDG D Q   LA+L+ Q +NTS +  G++   GY +LRAM+DDE LY+V
Sbjct  107051  QKLIYPEPFFLVDGQDMQWQPLAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKLYEV  107230

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                 +ALFDCG T P  E+Q IPTN   +++GYT DGPC
Sbjct  107231  NLDALFDCGYTDPTYESQPIPTNGQIRSTGYTHDGPC  107341

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = +2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +I++G   Q   LA+L++Q   T+ +   ++ ++ Y SLRA +++  LY V
Sbjct  110468  QLVLIPKPTYIIEGKQNQWNPLAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTLYTV  110647

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  A F CG T    E Q IPTN   + +GYT DGPC
Sbjct  110648  NASANFGCGFTKLDGERQPIPTNGQMRLTGYTHDGPC  110758

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 1/77 (1%)
 Frame = +2

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEA-LFDCGLTSPKTETQLI  110
               L++L++ GV TS    G+M   GY +LRA++DD  LYKV   A  F CG T P   +Q+I
Sbjct  108869  LSFLEKNGVKTSASVDGFMKEKGYSTLRALMDDSKLYKVNSNADNFLCGYTDPTKGSQVI  109048

Query  111     PTNSTFQTSGYTMDGPC  127
               P +ST +T+GYT  GPC
Sbjct  109049  PKDSTMRTTGYTHVGPC  109099

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 2/96 (2%)
 Frame = +2

Query  33     VLQPPPFFIVDGLDFQGMA-LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVT  91
              V  P PFF++DG D++  A +A L++Q V TS +  G++   GY SLRAMLDDE LY V 
Sbjct  10793  VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  10969

Query  92     EEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +++F+CG T P  E+Q IPTN   + +GY  DGPC
Sbjct  10970  IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPC  11077

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 1/98 (1%)
 Frame = +1

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q V  P P + V         L++L++ GV TS    G+M   GY +LRA++DD  LYK 
Sbjct  5182  QAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKT  5361

Query  91    TEEA-LFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A  F CG T P   +Q+IP +ST +T+GYT  GPC
Sbjct  5362  NSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPC  5475

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q V  P P + V     Q   LA+L+ QG   + +   +  S GY +LR  +DD+  YKV
Sbjct  3564  QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  3743

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGP  126
              +   F+CG +S K   Q IP     +++GYT DGP
Sbjct  3744  -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  3848

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 43/81 (53%), Gaps = 1/81 (1%)
 Frame = +1

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q VL P P + V     Q   LA+L+ QG  T+ + + +    GY +LR  +DD+  YKV
Sbjct  1057  QYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  1236

Query  91    TEEALFDCGLTSPKTETQLIP  111
              +   F+CG ++ K   Q IP
Sbjct  1237  -DGGDFECGWSTLKGTPQPIP  1296

>PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2249:1:3349:1 
REF
Length=3349

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 0/97 (0%)
 Frame = -3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q V+ P P F V     Q   LA+L+ QG  T+ +   +  + GY +LRA +DD++ YKV
Sbjct  1910  QYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKV  1731

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              + A F+CG T      Q IP+ ST +++GYT DGPC
Sbjct  1730  ADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPC  1620

>PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.66, whole genome shotgun 
sequence
Length=310063

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVLQP P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  A Y V
Sbjct  163099  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  162923

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               TE A + CG T PK   Q IP     +++GYT DGPC
Sbjct  162922  TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPC  162812

>PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.46, whole genome shotgun 
sequence
Length=493760

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             QIVLQP P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  +D  A Y V
Sbjct  3960  QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTV  3784

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             TE A + CG T PK   Q IP     +++GYT DGPC
Sbjct  3783  TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPC  3673

>PHCA:scaffold_7 PHYCAscaffold_7
Length=1368812

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ QG  T  +   W N +GY SLR  +D  A Y V
Sbjct  905941  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTV  905765

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  905764  TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  905654

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D Q   LA+L+ QG  T  +   W N +GY SLR  + D A Y V
Sbjct  901432  QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFM-DRAKYTV  901608

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  901609  RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPC  901719

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = +2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ QG  T  +   W   + Y SLR  +D+ A Y V
Sbjct  904325  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDN-AKYTV  904501

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T+ A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  904502  TDGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  904612

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +3

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ +G  T  +   W   +GY SLR  +D  A Y V
Sbjct  908754  QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPV  908930

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               TE A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  908931  TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPC  909041

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 52/97 (54%), Gaps = 1/97 (1%)
 Frame = -3

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D Q   L +L+  G  T  +   W   +GY SLR  +D+ A Y V
Sbjct  876699  QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYPV  876523

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +E A F CG T P    Q IP  +  +++GYT DGPC
Sbjct  876522  SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPC  876412

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 79.7 bits (195),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ QG  T  + + W + +GY SLR  +D  A Y+V
Sbjct  685378  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEV  685554

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  685555  TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  685665

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = -3

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ QG  T  +   W N + Y SLR  +D+ A Y+V
Sbjct  687112  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  686936

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  686935  TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  686825

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 57/105 (54%), Gaps = 1/105 (1%)
 Frame = -3

Query  23      LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
               L   +   QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR  L
Sbjct  682897  LALTVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFL  682718

Query  83      DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               D+ A Y VT+ A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  682717  DN-AKYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  682586

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  D +   LA+L+ QG     +   W   +GY SLR  +D  A Y+V
Sbjct  714187  QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEV  714363

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T+PK   Q IP     +++GYT DGPC
Sbjct  714364  TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPC  714474

>PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.20, whole genome shotgun 
sequence
Length=1049362

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (58%), Gaps = 1/97 (1%)
 Frame = +2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +I D  D Q   LA+L+ QG  T  + + W   +GY +LR  ++  A Y V
Sbjct  363593  QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFME-HAKYTV  363769

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               TE A F CG T+PK   Q IP     +++GYT +GPC
Sbjct  363770  TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPC  363880

>PHRA:scaffold_106
Length=147471

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = -1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              QIVL P P +  D  D +   LA+L+ +G  T  +   W   +GY SLR  +D+ A Y V
Sbjct  13404  QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  13228

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              T  A F CG T PK   Q IP ++  +++GYT DGPC
Sbjct  13227  TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPC  13117

>PHSO:scaffold_35
Length=32414

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = -3

Query  21     RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
              RR   ++   QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR 
Sbjct  18636  RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  18457

Query  81     MLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +D  A Y VT  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  18456  FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  18319

>PHSO:scaffold_5
Length=6830280

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 1/107 (1%)
 Frame = -3

Query  21      RRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRA  80
               RR   ++   QIVL P P +  +  + +   LA+L+ +G  T  +   W   +GY SLR 
Sbjct  682489  RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  682310

Query  81      MLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                +D  A Y VT  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  682309  FMD-RAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  682172

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = +2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +     D +   LA+L+ QG  T  + + W + +GY SLR  +D  A Y V
Sbjct  696926  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDV  697102

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP     +++GYT DGPC
Sbjct  697103  TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPC  697213

>PHRA:scaffold_267
Length=29552

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = +3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q+VL P P +  D  D +   LA+L+ +G  T  +   W + +GY SLR  +D+ A Y V
Sbjct  9348  QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  9524

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              + A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  9525  ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPC  9635

>PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_761.1_contig_1:1:9298:1 
REF
Length=9298

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -2

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            QIVL P P +  D  + +   LA+L+ QG  T  +   W   +GY +LRA +D  A Y+V
Sbjct  861  QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQV  685

Query  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
            TE A + CG T P    Q IP     +++GYT DGPC
Sbjct  684  TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPC  574

>PHSO:scaffold_14
Length=1806347

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +  + +   LA+L+ QG  T  +   W   +GY SLR  +D  A Y V
Sbjct  819290  QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDV  819114

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP  +  +++GYT DGPC
Sbjct  819113  TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPC  819003

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = +1

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL   P       D +   LA+L+ QG  T  +   W + +GY SLR  +D +A Y V
Sbjct  813964  QIVLLSEPQ*TTSDKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTV  814140

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               T  A F CG T PK   Q IP     +++GYT DGPC
Sbjct  814141  TSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPC  814251

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 1/95 (1%)
 Frame = -2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +  +    +   LA+L+ QG  T  +   W   +GY +LR  +D +A Y V
Sbjct  815809  QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDV  815633

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDG  125
               T  A F CG T PK   Q IP  +  +++GYT DG
Sbjct  815632  TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG  815528

>PHSO:scaffold_4
Length=7609242

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -3

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                QIVLQP P +  +  + +   LA+L+ QG  T  + + W   +GY +LR  +D    Y V
Sbjct  4374343  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  4374167

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                T+ A F CG T PK   Q IP     +++GYT DGPC
Sbjct  4374166  TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPC  4374056

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = +1

Query  31       QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
                QIVLQP P +  +  + +   LA+L+ QG  T  + + W   +GY +LR  +D    Y V
Sbjct  4364950  QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTV  4365126

Query  91       TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                T+ A F CG T PK   Q IP     +++GYT DGPC
Sbjct  4365127  TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPC  4365237

>PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5024:1:718:1 
REF
Length=718

 Score = 72.4 bits (176),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 56/98 (57%), Gaps = 2/98 (2%)
 Frame = +1

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
            Q V+ P P F     +     LA+L+ QG  T+ +  G++ S GY +LRA +DD+  YKV
Sbjct  160  QSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKV  339

Query  91   TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A F+CG T+   + Q IP   T +++GYT DGPC
Sbjct  340  DAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPC  450

>PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4828:1:781:1 
REF
Length=781

 Score = 72.4 bits (176),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 59/98 (60%), Gaps = 1/98 (1%)
 Frame = +3

Query  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQ-GVNTSIETQGWMNSHGYDSLRAMLDDEALYK  89
            Q+V+ P P + ++G   Q   +AYL+ Q G + + +  G+++S G+ ++R  +D++ LY+
Sbjct  123  QMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYR  302

Query  90   VTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +A F CG T    E Q IP N   +T+GYT +GPC
Sbjct  303  PVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPC  416

>PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_560:1:21458:1 
REF
Length=21458

 Score = 71.2 bits (173),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 54/98 (55%), Gaps = 1/98 (1%)
 Frame = -3

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             Q V  P P F  +  +     LA+L+ QGV    +  G++ S G  +LR  +D++A YK+
Sbjct  8559  QRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYKI  8380

Query  91    TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                 A F+CG T+P    Q IP N   +++GYT DGPC
Sbjct  8379  EARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPC  8266

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  53     AYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPT  112
              A L+ QG  T+ +   +++++GY +LR  +D    YK  + A  +CG T P    Q IPT
Sbjct  12650  AKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPT  12829

Query  113    NSTFQTSGYTMDGPC  127
              N  F+TSGYT +GPC
Sbjct  12830  NGEFRTSGYTHEGPC  12874

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = -1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q +  P P    D  +     LA+L+ QGV  + +  G++   G  +LR  +D++A YKV
Sbjct  11300  QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  11124

Query  91     TEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  A F+CG T P    Q IP+N   +++GYT DGPC
Sbjct  11123  EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPC  11010

>PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3459:1:3265:1 
REF
Length=3265

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  53    AYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPT  112
             A L++QG  T+ +   ++ ++ Y +LR  +D    YK    A F+CG T PK   Q IP 
Sbjct  2146  AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  2325

Query  113   NSTFQTSGYTMDGPC  127
             +  F+TSGYT +GPC
Sbjct  2326  DGAFRTSGYTHEGPC  2370

>PHRA:scaffold_79
Length=220511

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 2/97 (2%)
 Frame = -1

Query  31     QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
              Q+VL P P +  D  D +   LA+L+ QG  T  +   W   +GY +LR  + D A Y V
Sbjct  26144  QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFM-DRAKYTV  25968

Query  91     TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              TE A + CG T P    Q IP  +  +++GYT DGPC
Sbjct  25967  TEGADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPC  25860

>PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_622.1:1:14582:1 
REF
Length=14582

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = -1

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             QIVL P P +  D  D +   LA+L+ +G     +   W   +GY SLR  +D+ A Y V
Sbjct  3947  QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  3771

Query  91    TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             T  A   CG T P    Q IP  +  +++GYT DGPC
Sbjct  3770  TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPC  3660

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -2

Query  31    QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
             QIVL P P +  +  D +   LA+L+ +G     + + W   +GY SLR  +D+ A Y V
Sbjct  5476  QIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN-AKYPV  5300

Query  91    TEEALFDCG  99
             T  A F+CG
Sbjct  5299  TSGADFNCG  5273

>PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_113, whole genome shotgun sequence
Length=380982

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +3

Query  23     LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
              L  N+   QIVL P P +  +  D +   LA+L+ Q   T+ + Q +   + + +LR  +
Sbjct  94671  LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  94850

Query  83     DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              D+ A Y V + A   CG T P    Q IP N+  +++GYT DGPC
Sbjct  94851  DN-AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPC  94982

>PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2165, whole genome shotgun sequence
Length=94632

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +1

Query  23     LKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAML  82
              L  N+   QI+L P P +  +  D +   LA+L+ Q   TS +  G++  + Y+SLR  L
Sbjct  34597  LAPNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL  34776

Query  83     DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                 A Y VTE A  DCG T P    Q IP  +  + +GYT DG C
Sbjct  34777  K-RANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLC  34908

>PHSO:scaffold_64
Length=40116

 Score = 65.9 bits (159),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query  52     LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
              LA+L+ QG  T  + + W   +GY +LR  +D    Y VT+ A F CG T PK   Q IP
Sbjct  37965  LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  38141

Query  112    TNSTFQTSGYTMDGPC  127
                   +++GYT DGPC
Sbjct  38142  DGDAMRSTGYTHDGPC  38189

>PHSO:scaffold_12
Length=2105860

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -3

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               LA+L+ QG  T      +   +GY SLR  +D+ A Y VTE A   CG T PK   Q IP
Sbjct  168827  LAFLENQGFQTQ*NFTQYQVDNGYKSLRDFMDN-AKYTVTEGADQACGWTDPKGIAQQIP  168651

Query  112     TNSTFQTSGYTMDGPC  127
               ++ T +TSGYT DGPC
Sbjct  168650  SDGTMRTSGYTHDGPC  168603

 Score = 57.4 bits (137),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -2

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY SLR  ++  A YK+T+ A   CG T PK   Q IP
Sbjct  167526  LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  167350

Query  112     TNSTFQTSGYTMDGPC  127
                + T +TSGYT DGPC
Sbjct  167349  EDGTMRTSGYTHDGPC  167302

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               LA+L+ QG  T      +M  +GY SLR  +D+   Y VT+ A   CG T P    Q IP
Sbjct  162331  LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN-GNYSVTKGADQACGWTDPNGIPQQIP  162155

Query  112     TNSTFQTSGYTMDGPC  127
                + T +TSG+T D PC
Sbjct  162154  EDGTMRTSGFTHDDPC  162107

 Score = 37.4 bits (85),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 1/55 (2%)
 Frame = -1

Query  50      MALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPK  104
               M LAY ++QG NTS     W  ++G+ +LR  +D+   Y VT  A   CG T  K
Sbjct  210457  MPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDN-GNYSVTSGAD*ACGWTDLK  210296

 Score = 34.3 bits (77),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 17/28 (61%), Gaps = 0/28 (0%)
 Frame = -3

Query  100     LTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               L  PK   Q IP ++  +T GYT DGPC
Sbjct  210311  LDRPKRSPQQIPDDNIMRTYGYTRDGPC  210228

 Score = 32.3 bits (72),  Expect = 2.8, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (16%)
 Frame = +2

Query  72     SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
              ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  95219  ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SRAIVHVGPC  95371

 Score = 31.2 bits (69),  Expect = 5.7, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (16%)
 Frame = +2

Query  72     SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
              ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  97631  ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SRAIVHVGPC  97783

>PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 
genomic scaffold, whole genome shotgun sequence
Length=313873

 Score = 60.8 bits (146),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 44/90 (49%), Gaps = 1/90 (1%)
 Frame = +3

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               QIVL P P +     D +   LA+L+ QG     + + W + +GY SLR  + D A Y V
Sbjct  267045  QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFM-DRAKYDV  267221

Query  91      TEEALFDCGLTSPKTETQLIPTNSTFQTSG  120
               T  A F CG T PK   Q IP       SG
Sbjct  267222  TSGADFSCGFTDPKGTPQPIPAGDAAAYSG  267311

>PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.39, whole genome shotgun 
sequence
Length=634653

 Score = 60.5 bits (145),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY SLR  +D  A YKVTE A   CG T PK   Q IP
Sbjct  149937  LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  150113

Query  112     TNSTFQTSGYTMDGPC  127
                + T +T+GYT DGPC
Sbjct  150114  EDGTMRTTGYTHDGPC  150161

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY SLR  +D+ A Y VT+ A   CG T PK   Q IP
Sbjct  151119  LSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQIP  151295

Query  112     TNSTFQTSGYTMDGPC  127
                + T +TSGYT DGPC
Sbjct  151296  EDGTMRTSGYTHDGPC  151343

 Score = 32.3 bits (72),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)
 Frame = +2

Query  72     SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
              ++ +  L+ ++DD ++Y        DCG T+P    Q IPT+  +TF +      GPC
Sbjct  68807  ANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATF-SRALVHHGPC  68959

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 60.1 bits (144),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 56/113 (50%), Gaps = 5/113 (4%)
 Frame = +2

Query  19      GQRRLKANLGEGQIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYD  76
               G   L   +   Q++L+P P +   ++  D +   LA+L+ QG     +  GW    GY 
Sbjct  488729  GSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYK  488908

Query  77      SLRAMLDDEALY--KVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +LR  +D  A Y   VT  A   CGLT  K   + IP +   +++GYT DGPC
Sbjct  488909  NLRDFMD-RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPC  489064

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -2

Query  31       QIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDD-EAL  87
                Q++ QP P +   ++  D +   LA+L+ QG     +  GW   +GY  LR  +D  + +
Sbjct  1575775  QLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYV  1575596

Query  88       YKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  VT  A   CGLT  K   + IP +   +++GYT DGPC
Sbjct  1575595  TSVTPGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPC  1575476

 Score = 37.0 bits (84),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 2/46 (4%)
 Frame = -3

Query  84       DEALY--KVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                D A Y   VT  A   CGLT  K   + IP +    ++GYT DGPC
Sbjct  1594344  DRAKYVTSVTSGAHQTCGLTEVKGSPRPIPKDGMVTSTGYTHDGPC  1594207

 Score = 29.6 bits (65),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (4%)
 Frame = -2

Query  31       QIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAM  81
                Q++ QP P +   +   D +   LA+L+ QG     +  GW   +GY  LR +
Sbjct  1594507  QLIQQPEPIWKPGISDRDTRWNPLAFLESQGFPCQEDFNGWRAKNGYKDLREL  1594349

 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 2/57 (4%)
 Frame = -3

Query  31       QIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDE  85
                Q++L+P P +   +   D +   LA+L+ QG     +  GW   +GY  LR  +D +
Sbjct  1596471  QVMLKPEPIWKPGISDRDTRWRLLAFLESQGFPCQEDFDGWRAKNGYKDLRDFMDRD  1596301

 Score = 31.6 bits (70),  Expect(2) = 2e-04, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = -1

Query  90       VTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                VT  A   CGLT  K   + I  +    ++GYT DGPC
Sbjct  1596296  VTPGADQTCGLTEVKGPPRPISKDGMVTSTGYTHDGPC  1596183

>PHCA:scaffold_67 PHYCAscaffold_67
Length=292061

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY SLR  ++ +A YKV++ A   CG + PK   Q IP
Sbjct  220769  LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  220593

Query  112     TNSTFQTSGYTMDGPC  127
               ++ T +TSGYT DGPC
Sbjct  220592  SDGTMRTSGYTHDGPC  220545

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY +LR  +D+ A Y VT+ A   CG + P    Q IP
Sbjct  219761  LSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN-AKYAVTDGADQACGWSDPNGIPQQIP  219585

Query  112     TNSTFQTSGYTMDGPC  127
                + T +TSGYT DGPC
Sbjct  219584  EDGTMRTSGYTHDGPC  219537

 Score = 31.6 bits (70),  Expect = 4.7, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (16%)
 Frame = +1

Query  72      SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
               ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  112537  ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SRALVHVGPC  112689

>PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_354.1_contig_1:1:38044:1 
REF
Length=38044

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  52     LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
              L++L+++G+ T      +   + Y SLR  +D +A YKV++ A   CG T PK   Q IP
Sbjct  14398  LSFLEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIP  14574

Query  112    TNSTFQTSGYTMDGPC  127
               + T +TSGYT DGPC
Sbjct  14575  EDGTMRTSGYTHDGPC  14622

>PHRA:scaffold_2892
Length=2014

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = -1

Query  38    PFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFD  97
             P   VD +  Q + L++L+++G  T      +   +GY SLR  LD +A YKV++ A   
Sbjct  1960  PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQA  1790

Query  98    CGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             CG + PK   Q IP + T   SGYT DGPC
Sbjct  1789  CGWSDPKGIPQQIPEDGTMSPSGYTHDGPC  1700

>PHRA:scaffold_494
Length=11395

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = -1

Query  38    PFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFD  97
             P   VD +  Q + L++L+++G  T      +   +GY SLR  LD +A YKV++ A   
Sbjct  8596  PVTNVDAI--QLVILSFLEKEGFETQENFMQFQVDNGYTSLRDFLD-KAKYKVSDGADQA  8426

Query  98    CGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
             CG + PK   Q IP + T   SGYT DGPC
Sbjct  8425  CGWSDPKGIPQQIPEDGTMSPSGYTHDGPC  8336

>PHRA:scaffold_33
Length=496317

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
               L++L+++G  T      +   +GY SLR  LD +A YKV++ A   CG + PK   Q IP
Sbjct  370657  LSFLEKEGFETQENFTQFQVDNGYTSLRDFLD-KAKYKVSDGADQACGWSDPKGIPQQIP  370833

Query  112     TNSTFQTSGYTMDGPC  127
                + T +TSGYT DGPC
Sbjct  370834  EDGTMRTSGYTHDGPC  370881

 Score = 30.0 bits (66),  Expect(2) = 0.004, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 1/52 (2%)
 Frame = -1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSP  103
               L++L+++G  T      +   +GY SLR  L D+A YKV++ A   C  + P
Sbjct  175824  LSFLEKEGFETQENFTQFQVDNGYTSLRDFL-DKAKYKVSDGADQACWWSDP  175672

 Score = 30.0 bits (66),  Expect(2) = 0.004, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 15/28 (54%), Gaps = 0/28 (0%)
 Frame = -3

Query  100     LTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +  P    Q IP + T   SGYT DGPC
Sbjct  175684  VVGPNGIPQQIPEDGTMSPSGYTHDGPC  175601

 Score = 30.0 bits (66),  Expect(2) = 0.004, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 1/52 (2%)
 Frame = -1

Query  52      LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSP  103
               L++L+++G  T      +   +GY SLR  L D+A YKV++ A   C  + P
Sbjct  171465  LSFLEKEGFETQENFTQFQVDNGYTSLRDFL-DKAKYKVSDGADQACWWSDP  171313

 Score = 30.0 bits (66),  Expect(2) = 0.004, Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 15/28 (54%), Gaps = 0/28 (0%)
 Frame = -3

Query  100     LTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               +  P    Q IP + T   SGYT DGPC
Sbjct  171325  VVGPNGIPQQIPEDGTMSPSGYTHDGPC  171242

>PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 
genomic scaffold, whole genome shotgun sequence
Length=3552875

 Score = 55.5 bits (132),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  52       LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
                L++L+++G  T      +   +GY SL   +D  A YKV++ A   CG T PK   Q IP
Sbjct  2748808  LSFLEKEGFKTQENFTQFQVDNGYKSLLDFMD-RAKYKVSKGADQACGWTDPKGIPQQIP  2748632

Query  112      TNSTFQTSGYTMDGPC  127
                 + T +T+GYT DGPC
Sbjct  2748631  EDGTMRTTGYTHDGPC  2748584

 Score = 33.9 bits (76),  Expect = 0.77, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (52%), Gaps = 9/58 (16%)
 Frame = -2

Query  72       SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
                ++ +  LR ++DD ++Y        DCG T+P    Q IP++  +TF +      GPC
Sbjct  2827981  ANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATF-SRALVHHGPC  2827829

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 54.7 bits (130),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 3/100 (3%)
 Frame = -1

Query  31       QIVLQPPPFFI--VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDD-EAL  87
                Q++L+P P +   ++  D +   LA+L+ QG     +   W   +GY +LR  +D     
Sbjct  3545332  QLLLEPEPIWKAGINDRDTRWRPLAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRGNYT  3545153

Query  88       YKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                  VT  A   CGLT      + IP N   +++GY+ +GPC
Sbjct  3545152  TTVTPGAN*TCGLTKLNGPPRPIPKNGVIRSTGYSHEGPC  3545033

>PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 
genomic scaffold, whole genome shotgun sequence
Length=1472

 Score = 54.3 bits (129),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -3

Query  52   LAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIP  111
            L++L+++ V T      +   +GY SLR  +D    YKVTE A   CG + P    Q IP
Sbjct  666  LSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD-SPRYKVTEGADQACGWSDPNGIPQQIP  490

Query  112  TNSTFQTSGYTMDGPC  127
             + T +TS YT DGPC
Sbjct  489  EDGTMRTSNYTHDGPC  442

>PHSO:scaffold_11
Length=2192408

 Score = 51.2 bits (121),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 6/86 (7%)
 Frame = -3

Query  42       VDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLT  101
                V+  D +   LA+L+ QG  T          +GY +LR  +D    Y VT+ A + CG T
Sbjct  2022897  VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWT  2022721

Query  102      SPKTETQLIPTNSTFQTSGYTMDGPC  127
                +PK   Q IP     +++GYT DGPC
Sbjct  2022720  NPKGTPQPIP-----RSTGYTHDGPC  2022658

>PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_182:1:48098:1 
REF
Length=48098

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = +1

Query  69    WMNSHGYDSLRAMLDDEALYKVTEE-ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDG  125
             + NS G  +LR  +DD+A YKV    A F+CG T P    Q IP N   +++G+T DG
Sbjct  1567  YFNSKGIKTLRHFMDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG  1740

>PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 
genomic scaffold, whole genome shotgun sequence
Length=80461

 Score = 48.5 bits (114),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 1/55 (2%)
 Frame = -2

Query  73     HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              +GY SL   +D  A YKV++ A   CG T PK   Q  P + T +T+GYT DGPC
Sbjct  80418  NGYKSLLDFMD-RAKYKVSKGADQACGWTDPKGIPQQFPEDGTMRTTGYTHDGPC  80257

 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 25/44 (57%), Gaps = 0/44 (0%)
 Frame = -1

Query  84     DEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              +   YKVTE A   CG + P    Q IP + T +TS YT DGPC
Sbjct  40633  NPVTYKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPC  40502

>PHRA:scaffold_105
Length=157074

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/66 (38%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = -2

Query  31      QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90
               Q+VL P P +  D  D +   LA+L+ +G  T  +   W + +GY SLR  +D+ A Y V
Sbjct  154865  QVVLLPEPQWTTDDRDTKYNPLAFLESEGFTTQEDFASWRDENGYKSLRDFMDN-AKYSV  154689

Query  91      TEEALF  96
               T  A F
Sbjct  154688  TNGADF  154671

>PHSO:scaffold_16
Length=803425

 Score = 38.9 bits (89),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 28/57 (49%), Gaps = 7/57 (12%)
 Frame = -3

Query  72      SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
               SH Y  LR +LD+ A+Y        +CG T+P    Q IPTN     + G    GPC
Sbjct  551486  SHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPC  551334

 Score = 34.3 bits (77),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)
 Frame = -1

Query  72      SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
               ++ +  L+ MLDD +LY        DCG T P    Q IPT+     + G    GPC
Sbjct  554095  ANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPC  553943

 Score = 34.3 bits (77),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 7/57 (12%)
 Frame = +2

Query  72      SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
               ++ +  L+ MLDD +LY        DCG T P    Q IPT+     + G    GPC
Sbjct  557057  ANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPC  557209

 Score = 33.9 bits (76),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 26/57 (46%), Gaps = 7/57 (12%)
 Frame = -3

Query  72      SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN-STFQTSGYTMDGPC  127
               SH Y  LR +LDD + Y        +CG T+P      IPTN     + G    GPC
Sbjct  542999  SHNYKDLRTLLDDTSKYGP------NCGYTNPNGTP*PIPTNGKAIFSRGLIHTGPC  542847

 Score = 32.0 bits (71),  Expect = 3.4, Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 29/57 (51%), Gaps = 9/57 (16%)
 Frame = -1

Query  73      HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
               + +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF + G    GPC
Sbjct  524482  NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATF-SRGLIHVGPC  524333

>PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1535:1:8373:1 
REF
Length=8373

 Score = 36.6 bits (83),  Expect = 0.082, Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 8/64 (13%)
 Frame = -2

Query  70    MNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN----STFQTSGYT--M  123
             + +  Y S+RA++DD+A++   +EA  +CG+TSP    Q +P      S   + G+T   
Sbjct  6914  LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  6741

Query  124   DGPC  127
              GPC
Sbjct  6740  QGPC  6729

>PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_22.1:1:203587:1 
REF
Length=203587

 Score = 35.8 bits (81),  Expect = 0.18, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 3/57 (5%)
 Frame = -1

Query  72     SHGYDSLRAMLD-DEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              S GYDSL A +  ++ LY    +A  DCGLT  K   +     S    SG+T  GPC
Sbjct  37594  SKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKLTYSGFTHTGPC  37430

>PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_305:1:30708:1 
REF
Length=30708

 Score = 35.4 bits (80),  Expect = 0.22, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 7/60 (12%)
 Frame = -1

Query  71     NSHGYDSL-RAMLDDEALYKVTEEALFDCGLTSPK--TETQLIPTNSTFQTSGYTMDGPC  127
              NS GYDSL + ++ ++ LY  + +A  +CG+T  K    + L  TN T+  SG+T  GPC
Sbjct  15744  NSSGYDSLGQFIITNQVLYSSSVDA--ECGMTVYKDSARSALPATNLTY--SGFTHPGPC  15577

>PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_121:1:49194:1 
REF
Length=49194

 Score = 35.4 bits (80),  Expect = 0.22, Method: Composition-based stats.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 6/43 (14%)
 Frame = -1

Query  73     HGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNST  115
              +G  ++R++LDD ++Y        DCG T+P    Q IPT+ST
Sbjct  19959  NGLSNIRSLLDDTSIYGA------DCGYTNPDGTAQDIPTDST  19849

 Score = 34.7 bits (78),  Expect = 0.43, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 6/42 (14%)
 Frame = -3

Query  74     GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNST  115
              G   +R++LDD ++Y        DCG T P    Q IPT+ST
Sbjct  22321  GVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDST  22214

 Score = 33.1 bits (74),  Expect = 1.5, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 22/40 (55%), Gaps = 6/40 (15%)
 Frame = -1

Query  74     GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN  113
              G   +R++LDD ++Y        DCG T+P    Q IPT+
Sbjct  17835  GVSQIRSLLDDTSIYGA------DCGFTNPSGTAQPIPTD  17734

 Score = 31.6 bits (70),  Expect = 5.5, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 6/34 (18%)
 Frame = -2

Query  80     AMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN  113
              ++LDD ++Y        DCG T P  E Q IPT+
Sbjct  27416  SLLDDTSIYGA------DCGFTDPDGEAQPIPTD  27333

>PHCA:scaffold_22 PHYCAscaffold_22
Length=843021

 Score = 34.7 bits (78),  Expect = 0.46, Method: Composition-based stats.
 Identities = 21/68 (31%), Positives = 36/68 (53%), Gaps = 10/68 (15%)
 Frame = +3

Query  63      SIET-QGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTS  119
               S+ET +   +++ +  L+ ++DD ++Y        DCG T+P    Q IPT+  +TF + 
Sbjct  399261  SVETFKSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATF-SR  399419

Query  120     GYTMDGPC  127
                    GPC
Sbjct  399420  ALVHVGPC  399443

>PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.9, whole genome shotgun 
sequence
Length=1651025

 Score = 32.3 bits (72),  Expect = 2.6, Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 29/57 (51%), Gaps = 3/57 (5%)
 Frame = +2

Query  72      SHGYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               + GYDSL A +  ++ LY    +   DCGLT  K   +     S  + +G+T  GPC
Sbjct  524003  TKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASQLEYTGFTHTGPC  524167

>PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.460, whole genome 
shotgun sequence
Length=3430

 Score = 32.0 bits (71),  Expect = 3.1, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 9/58 (16%)
 Frame = -3

Query  72   SHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTSGYTMDGPC  127
            ++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF +      GPC
Sbjct  671  ANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SRAIVHVGPC  519

>PHRA:scaffold_51
Length=360848

 Score = 32.0 bits (71),  Expect = 3.8, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 3/55 (5%)
 Frame = -2

Query  74     GYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
              GYDSL A +  ++ LY    +   DCGLT  K   +     S    SG+T  GPC
Sbjct  38692  GYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKLTYSGFTHTGPC  38534

>PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.76, whole genome shotgun 
sequence
Length=282732

 Score = 31.6 bits (70),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 35/68 (51%), Gaps = 10/68 (15%)
 Frame = +1

Query  63     SIET-QGWMNSHGYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN--STFQTS  119
              S+ET +   +++ +  L+ ++DD ++Y        DCG T P    Q IPT+  +TF + 
Sbjct  43765  SVETFKSLKSANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATF-SR  43923

Query  120    GYTMDGPC  127
                   GPC
Sbjct  43924  ALVHVGPC  43947

>PHCA:scaffold_11 PHYCAscaffold_11
Length=1076090

 Score = 31.6 bits (70),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 29/57 (51%), Gaps = 3/57 (5%)
 Frame = -1

Query  72      SHGYDSLRAML-DDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
               + GYDSL A +  ++ LY    +   DCGLT  K   +     S  + SG+T  GPC
Sbjct  649565  TKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFTHTGPC  649401

>PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 
genomic scaffold, whole genome shotgun sequence
Length=2319577

 Score = 31.2 bits (69),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 41/94 (44%), Gaps = 10/94 (11%)
 Frame = +3

Query  41       IVDGLDF----QGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE---E  93
                ++DG D+    +GM+     E             N+  Y SL+ + D   + +      +
Sbjct  1105161  LIDGQDYLPVPKGMSYGGTPESNTEAYWTA---FNASKYTSLKDLADKTMVLQSLSPFGK  1105331

Query  94       ALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127
                A  +CG ++PK   + +P    ++  GY+  GPC
Sbjct  1105332  ATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPC  1105433

>PYUU:scaffold_2039 scf1117875582039 dna:supercontig supercontig:pug:scf1117875582039:1:1829366:1 
REF
Length=1829366

 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 26/57 (46%), Gaps = 3/57 (5%)
 Frame = +2

Query  72       SHGYDSLRAMLDDEALYKVTEEALFDCGLT---SPKTETQLIPTNSTFQTSGYTMDG  125
                SH   SLRA LDDE   ++T +   +  +    SP+ + Q   TN   +      +G
Sbjct  1235900  SHELQSLRAKLDDEEQLRITTQKQLEAAIAAAKSPQQQDQETQTNDLKEKDAVKKEG  1236070

>PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_50:1:72629:1 
REF
Length=72629

 Score = 30.8 bits (68),  Expect = 8.3, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 6/40 (15%)
 Frame = +3

Query  74     GYDSLRAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTN  113
              G   +R++LDD ++Y        DCG T P    Q IPT+
Sbjct  42138  GVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTD  42239

Lambda      K        H        a         alpha
   0.317    0.134    0.410    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10644360900

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40