Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PHCA:scaffold_8493689942251799859e-122
PHPA:scaffold_632429682435041798571e-104
PHSO:scaffold_1279134727918831798552e-104
PHKE:scaffold_9858647591861808384e-102
PHIF:NW_003303697.13586343591551777997e-97
PHRA:scaffold_561625381630681807777e-94
PYVX:scaffold_27514395149281786992e-83
PHRA:scaffold_7925659261531656983e-83
PHSO:scaffold_148187878192991716887e-82
PHCA:scaffold_79054569059501656887e-82
PHPA:scaffold_661625991631081706861e-81
PHPA:scaffold_46346039691706861e-81
PHPA:scaffold_226853696858811716816e-81
PHRA:scaffold_267933998781806817e-81
PHIF:NW_003303730.16969176974021626692e-79
PHRA:scaffold_10612901134131716692e-79
PHKE:scaffold_7613768701656693e-79
PHSO:scaffold_3518103186121706641e-78
PHSO:scaffold_56819566824651706641e-78
PHKE:scaffold_622346239561656604e-78
PYIR:scaffold_50241516541695933e-76
PHPA:scaffold_203635843640781656367e-75
PLHA:NW_020187034.194689951831656226e-73
PYUU:scaffold_2037129588912963981706051e-70
PYIR:scaffold_2249141319191706012e-70
PHIF:NW_003303626.1267289267555893787e-67
PLHA:NW_020189073.134615351091655591e-64
PHSO:scaffold_4437393343743521405451e-62
PHPA:scaffold_164887564892621695397e-62
PHIF:NW_003303741.1157527815757811685301e-60
PYIR:scaffold_81104591109501645212e-59
PHPA:scaffold_391498501503651725123e-58
PHCA:scaffold_672202932208561885114e-58
PHSO:scaffold_6437920383121314983e-56
PHSO:scaffold_121684051689141704931e-55
PYAP:scaffold_560805385681724931e-55
PHIF:NW_003303754.1354482635453351704894e-55
PHKE:scaffold_35414311148081664861e-54
PHRA:scaffold_333705703711091804799e-54
PYAR:scaffold_3459207125651654734e-53
PHSO:scaffold_11202259820228971043992e-52
PYIW:scaffold_711517356611644594e-51
PYIR:scaffold_48281176081644217e-50
PLHA:NW_020189861.1184651818470061633872e-41
HYAP:scaffold_591612371617161603741e-39
PHRA:scaffold_49483158560822443e-37
PHRA:scaffold_289216791924822441e-36
PHIF:NW_003303747.1274851527488951273441e-35
PYAP:scaffold_18217401955732311e-28
PHIF:NW_003304531.14307501072775e-27
PYAP:scaffold_1129364340591492717e-26
PHRA:scaffold_105154671154874682717e-26
PYIR:scaffold_155246429611792611e-24
PHRA:scaffold_42350142355591912575e-24
PYAP:scaffold_21625517259841662575e-24
PHIF:NW_003303753.1377397637745001802568e-24
PHCA:scaffold_931443791447621332559e-24
PHPA:scaffold_5101449110150151802541e-23
PHCA:scaffold_241675121680361802541e-23
PHSO:scaffold_2254623225466241362522e-23
PHIF:NW_003303391.18018880460912487e-23
PHRA:scaffold_92179752183611342471e-22
PYIW:scaffold_70031504971262362e-22
PYAR:scaffold_88241127911372452e-22
PYUU:scaffold_20386013726017821492417e-22
PHSO:scaffold_165511305515191352408e-22
SADI:scaffold_13458374589161892372e-21
PHKE:scaffold_949264530191292346e-21
PHIF:NW_003303738.1105849610590111762321e-20
PYIR:scaffold_1319560559701322311e-20
PHCA:scaffold_9881212815951332302e-20
PHPA:scaffold_45390505395681792283e-20
SAPA:scaffold_311350591356011902283e-20
PHKE:scaffold_221224126241322284e-20
PLHA:NW_020187210.15496945500861362241e-19
PHRA:scaffold_41812490128491242213e-19
PHCA:scaffold_23510193514771662204e-19
PHCA:scaffold_501509781513611322195e-19
PHRA:scaffold_1234449248511242196e-19
PYIW:scaffold_2639340339421872196e-19
PHPA:scaffold_123926993931481612188e-19
PHKE:scaffold_39930627310941662188e-19
PYIR:scaffold_1744163620251352179e-19
PYUU:scaffold_20367045317048841282171e-18
PYIR:scaffold_87112411129381812171e-18
PHSO:scaffold_104928584933821812161e-18
PYAP:scaffold_55819522198151022162e-18
PHKE:scaffold_15541075414581322152e-18
PYIW:scaffold_3542135718841842142e-18
PHRA:scaffold_294739874745111822143e-18
PYUU:scaffold_20295033715037211222143e-18
PLHA:NW_020187244.1202276420231411302125e-18
PHRA:scaffold_891241581245171242108e-18
PYUU:scaffold_14021533181538631942108e-18
PYUU:scaffold_17896981866986081512081e-17
PLHA:NW_020189511.14309604314751772082e-17
PHKE:scaffold_25012648131691792063e-17
PYAP:scaffold_583618567301942063e-17
PYIR:scaffold_349771212361802044e-17
PHCA:scaffold_223991413996531762055e-17
PYIR:scaffold_573542557751262038e-17
PLHA:NW_020186941.129751301251312039e-17
SADI:scaffold_911575381580201732021e-16
PYAP:scaffold_18710010104051452021e-16
PYIW:scaffold_360258231151902002e-16
PYUU:scaffold_20288212808218131922002e-16
PHCA:scaffold_88238518242071391993e-16
PHRA:scaffold_13195980963421311983e-16
PHSO:scaffold_3643097864314901911984e-16
PHKE:scaffold_7252621531481801984e-16
PYVX:scaffold_639200322901001975e-16
SAPA:scaffold_194483874488691741975e-16
PYAP:scaffold_28914391146781001966e-16
PHIF:NW_003303752.1206492120653131361967e-16
PYVX:scaffold_563761581001721959e-16
PHKE:scaffold_499909794351251941e-15
PYAR:scaffold_674727475821071932e-15
PYIW:scaffold_182137819682111932e-15
PHRA:scaffold_521024061029001711922e-15
HYAP:scaffold_85376715380091171922e-15
PHRA:scaffold_233883953888741791922e-15
PYVX:scaffold_894334537161301913e-15
PHRA:scaffold_37285308285592991913e-15
PHIF:NW_003303757.1532600253263731441913e-15
APIN:scaffold_11823089823307771853e-15
APIN:scaffold_99107799111231241913e-15
PYIW:scaffold_3644138618891731904e-15
PHRA:scaffold_31314449147481041905e-15
PHRA:scaffold_2877512778651221905e-15
PYAR:scaffold_37017550178731121895e-15
PYVX:scaffold_25103937461301876e-15
APAS:scaffold_331214961218641321888e-15
PYAP:scaffold_2310558109621401888e-15
PYAR:scaffold_44523538741811878e-15
PYIR:scaffold_81450850411821871e-14
PYAR:scaffold_48872816311241852e-14
ALCA:scaffold_16827529279061301852e-14
PHCA:scaffold_401126401129691141852e-14
PYAP:scaffold_63013445139751921842e-14
PYIR:scaffold_582135151761753e-14
PYAR:scaffold_1366127017311641843e-14
PYIW:scaffold_1535654970731801833e-14
PHCA:scaffold_146493781141834e-14
PYAP:scaffold_744450649041401834e-14
SADI:scaffold_272908412913231741824e-14
PHRA:scaffold_12324674250451371825e-14
PYVX:scaffold_38525727260801231816e-14
PHSO:scaffold_155731225736221761816e-14
PYIR:scaffold_973439248891721816e-14
SADI:scaffold_264140818871771808e-14
PYUU:scaffold_20326904406909431761801e-13
PYIR:scaffold_281288913891711791e-13
PYAP:scaffold_209224527721901791e-13
PHCA:scaffold_4924620251681961791e-13
PLHA:NW_020187410.1331436701251791e-13
PYAR:scaffold_3482173921041281791e-13
PYIW:scaffold_878515811821791e-13
PHPA:scaffold_1446233144626691251781e-13
ALLA:FR82407647601479781311782e-13
PHKE:scaffold_206313435021351782e-13
PYAR:scaffold_2122005720326941782e-13
PHRA:scaffold_5140105404761281772e-13
PHKE:scaffold_88436703858671462e-13
PHIF:NW_003303506.1183923721851772e-13
PHKE:scaffold_1151176622451701763e-13
HYAP:scaffold_463744277831231763e-13
PYAR:scaffold_1972467451201501753e-13
HYAP:scaffold_17636793373111801763e-13
SAPA:scaffold_321166041170831721754e-13
PHCA:scaffold_116511436515381361755e-13
PYAP:scaffold_9427007273811301745e-13
PHCA:scaffold_392000732003721041746e-13
PHSO:scaffold_8123809012384581271746e-13
PYIR:scaffold_2511147218371261737e-13
PHPA:scaffold_1949298498101841737e-13
PLHA:NW_020188562.19292149295461161738e-13
PYIW:scaffold_27016630170911561721e-12
PHKE:scaffold_2239024393621171711e-12
SAPA:scaffold_123062303067571881692e-12
PYAP:scaffold_74354138911251692e-12
PYUU:scaffold_20332772927929691693e-12
PHPA:scaffold_8187246877221711693e-12
PYVX:scaffold_107013611633951683e-12
PLHA:NW_020188258.1135621513566041341683e-12
PYAR:scaffold_48017192175961501674e-12
PYAR:scaffold_1918730939741674e-12
PYVX:scaffold_12119549199951541666e-12
PYAP:scaffold_793274832211631666e-12
PYAP:scaffold_12353515538441141666e-12
PYIR:scaffold_15247810481511191667e-12
PHPA:scaffold_95383335387011271658e-12
PYIR:scaffold_27768212121841659e-12
PYAR:scaffold_5931577415929521651e-11
PHIF:NW_003303743.1148096414813321271641e-11
PHIF:NW_003303637.11828401831811261641e-11
PHIF:NW_003303594.179011793521261641e-11
PYIR:scaffold_1361421745371111631e-11
APAS:scaffold_49302651302824621531e-11
PYAR:scaffold_463917501986831622e-11
PYVX:scaffold_6981312613323701622e-11
PYVX:scaffold_30515403157711271622e-11
PYUU:scaffold_20075495455499251331613e-11
SADI:scaffold_24440046440282871613e-11
PYIR:scaffold_45223843243311731613e-11
PHSO:scaffold_3111418117951311604e-11
PHRA:scaffold_532206624131221604e-11
PHKE:scaffold_27947755480511031595e-11
PYIR:scaffold_4627352908621586e-11
SADI:scaffold_22134614134868891579e-11
PHPA:scaffold_460474701811579e-11
PYUU:scaffold_20122070812074731411561e-10
PYAP:scaffold_1339132418601841552e-10
PYVX:scaffold_16402757031611552e-10
PYAR:scaffold_1613712074401131552e-10
PHPA:scaffold_8181629718168511961552e-10
PYIW:scaffold_1952440547371161542e-10
SADI:scaffold_390678860651532e-10
PYVX:scaffold_3412352223710671523e-10
PYIW:scaffold_7831133311509611534e-10
PYUU:scaffold_203183511840711961534e-10
PYIW:scaffold_50602496381381515e-10
PHKE:scaffold_37626532268521191516e-10
PYIR:scaffold_196617951968621491e-09
PYIR:scaffold_97651275279511491e-09
PYAR:scaffold_266856690331631481e-09
PYIR:scaffold_9989885102231181472e-09
PYIR:scaffold_2122193422931251472e-09
PHRA:scaffold_4471963724781821472e-09
PHCA:scaffold_34476464479931211462e-09
PYVX:scaffold_1989143017771211462e-09
PLHA:NW_020189786.11241141244461231463e-09
PHIF:NW_003303307.173911041261463e-09
PYAR:scaffold_5510142105491401453e-09
PYAP:scaffold_1054305547151491453e-09
PYIR:scaffold_133269847241901454e-09
PYIR:scaffold_4757906021771415e-09
PYVX:scaffold_62221192310681445e-09
PHRA:scaffold_14385072385278731436e-09
PYIR:scaffold_217622522497861436e-09
PYIR:scaffold_206699013521261437e-09
PHPA:scaffold_764376543974751437e-09
PYIR:scaffold_2435214824771151411e-08
PYAR:scaffold_68104609391681401e-08
PYVX:scaffold_663125717601721411e-08
PHRA:scaffold_55597869998711401e-08
PYAP:scaffold_983359939191131392e-08
PYAR:scaffold_4631102814591441392e-08
PHIF:NW_003303727.111339391134169811392e-08
PYVX:scaffold_504235042550671392e-08
PHCA:scaffold_55674215677141051392e-08
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHYCA_129425

Length=204
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PHCA:scaffold_84 PHYCAscaffold_84                                     384        9e-122
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  334        1e-104
PHSO:scaffold_1                                                       333        2e-104
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  327        4e-102
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  312        7e-97 
PHRA:scaffold_56                                                      303        7e-94 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  273        2e-83 
PHRA:scaffold_79                                                      273        3e-83 
PHSO:scaffold_14                                                      269        7e-82 
PHCA:scaffold_7 PHYCAscaffold_7                                       269        7e-82 
PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 ...  268        1e-81 
PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 ...  268        1e-81 
PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 ...  266        6e-81 
PHRA:scaffold_267                                                     266        7e-81 
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  262        2e-79 
PHRA:scaffold_106                                                     262        2e-79 
PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig superc...  262        3e-79 
PHSO:scaffold_35                                                      260        1e-78 
PHSO:scaffold_5                                                       260        1e-78 
PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:Phy...  258        4e-78 
PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:...  233        3e-76 
PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 ...  249        7e-75 
PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig:...  244        6e-73 
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  237        1e-70 
PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:...  236        2e-70 
PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 g...  150        7e-67 
PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig:...  219        1e-64 
PHSO:scaffold_4                                                       214        1e-62 
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  212        7e-62 
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  208        1e-60 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  205        2e-59 
PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 ...  201        3e-58 
PHCA:scaffold_67 PHYCAscaffold_67                                     201        4e-58 
PHSO:scaffold_64                                                      196        3e-56 
PHSO:scaffold_12                                                      194        1e-55 
PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:p...  194        1e-55 
PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 gen...  192        4e-55 
PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig superc...  191        1e-54 
PHRA:scaffold_33                                                      189        9e-54 
PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:...  186        4e-53 
PHSO:scaffold_11                                                      158        2e-52 
PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:pi...  181        4e-51 
PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:...  166        7e-50 
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  153        2e-41 
HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  148        1e-39 
PHRA:scaffold_494                                                     98.6       3e-37 
PHRA:scaffold_2892                                                    98.6       1e-36 
PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 ge...  137        1e-35 
PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:p...  93.6       1e-28 
PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 ...  111        5e-27 
PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig...  108        7e-26 
PHRA:scaffold_105                                                     108        7e-26 
PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pi...  105        1e-24 
PHRA:scaffold_4                                                       103        5e-24 
PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:p...  103        5e-24 
PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 gen...  103        8e-24 
PHCA:scaffold_93 PHYCAscaffold_93                                     102        9e-24 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  102        1e-23 
PHCA:scaffold_24 PHYCAscaffold_24                                     102        1e-23 
PHSO:scaffold_2                                                       101        2e-23 
PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 g...  100        7e-23 
PHRA:scaffold_9                                                       99.8       1e-22 
PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:...  95.5       2e-22 
PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_...  99.0       2e-22 
PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:p...  97.4       7e-22 
PHSO:scaffold_16                                                      97.1       8e-22 
SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_...  95.9       2e-21 
PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig superc...  94.7       6e-21 
PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 ge...  94.0       1e-20 
PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:...  93.6       1e-20 
PHCA:scaffold_98 PHYCAscaffold_98                                     93.2       2e-20 
PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 u...  92.4       3e-20 
SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM151...  92.4       3e-20 
PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:Phy...  92.4       4e-20 
PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig:...  90.9       1e-19 
PHRA:scaffold_418                                                     89.7       3e-19 
PHCA:scaffold_2 PHYCAscaffold_2                                       89.4       4e-19 
PHCA:scaffold_50 PHYCAscaffold_50                                     89.0       5e-19 
PHRA:scaffold_1234                                                    89.0       6e-19 
PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:...  89.0       6e-19 
PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 ...  88.6       8e-19 
PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:Phy...  88.6       8e-19 
PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:...  88.2       9e-19 
PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:p...  88.2       1e-18 
PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pi...  88.2       1e-18 
PHSO:scaffold_10                                                      87.8       1e-18 
PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:p...  87.8       2e-18 
PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:Phy...  87.4       2e-18 
PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:...  87.0       2e-18 
PHRA:scaffold_29                                                      87.0       3e-18 
PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:p...  87.0       3e-18 
PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig:...  86.3       5e-18 
PHRA:scaffold_89                                                      85.5       8e-18 
PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:p...  85.5       8e-18 
PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:p...  84.7       1e-17 
PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig:...  84.7       2e-17 
PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:Phy...  84.0       3e-17 
PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:p...  84.0       3e-17 
PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:...  83.2       4e-17 
PHCA:scaffold_22 PHYCAscaffold_22                                     83.6       5e-17 
PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pi...  82.8       8e-17 
PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig:...  82.8       9e-17 
SADI:scaffold_91 supercont1.91 dna:supercontig supercontig:Sap_di...  82.4       1e-16 
PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:p...  82.4       1e-16 
PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:pi...  81.6       2e-16 
PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:p...  81.6       2e-16 
PHCA:scaffold_8 PHYCAscaffold_8                                       81.3       3e-16 
PHRA:scaffold_131                                                     80.9       3e-16 
PHSO:scaffold_3                                                       80.9       4e-16 
PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKe...  80.9       4e-16 
PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pv...  80.5       5e-16 
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  80.5       5e-16 
PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:p...  80.1       6e-16 
PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 gen...  80.1       7e-16 
PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pv...  79.7       9e-16 
PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig superc...  79.3       1e-15 
PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:pa...  79.0       2e-15 
PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:pi...  79.0       2e-15 
PHRA:scaffold_52                                                      78.6       2e-15 
HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:...  78.6       2e-15 
PHRA:scaffold_23                                                      78.6       2e-15 
PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pv...  78.2       3e-15 
PHRA:scaffold_37                                                      78.2       3e-15 
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  78.2       3e-15 
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  75.9       3e-15 
APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inv...  78.2       3e-15 
PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:...  77.8       4e-15 
PHRA:scaffold_313                                                     77.8       5e-15 
PHRA:scaffold_28                                                      77.8       5e-15 
PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:pa...  77.4       5e-15 
PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:...  76.6       6e-15 
APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_a...  77.0       8e-15 
PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag...  77.0       8e-15 
PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:...  76.6       8e-15 
PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_...  76.6       1e-14 
PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:...  75.9       2e-14 
ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig s...  75.9       2e-14 
PHCA:scaffold_40 PHYCAscaffold_40                                     75.9       2e-14 
PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:p...  75.5       2e-14 
PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:...  72.0       3e-14 
PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:...  75.5       3e-14 
PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:...  75.1       3e-14 
PHCA:scaffold_146 PHYCAscaffold_146                                   75.1       4e-14 
PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:p...  75.1       4e-14 
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  74.7       4e-14 
PHRA:scaffold_123                                                     74.7       5e-14 
PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pv...  74.3       6e-14 
PHSO:scaffold_15                                                      74.3       6e-14 
PYIR:scaffold_973 pir_scaffold_973 dna:supercontig supercontig:pi...  74.3       6e-14 
SADI:scaffold_264 supercont1.264 dna:supercontig supercontig:Sap_...  73.9       8e-14 
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  73.9       1e-13 
PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:...  73.6       1e-13 
PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:p...  73.6       1e-13 
PHCA:scaffold_49 PHYCAscaffold_49                                     73.6       1e-13 
PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig:...  73.6       1e-13 
PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:...  73.6       1e-13 
PYIW:scaffold_878 piw_scaffold_878 dna:supercontig supercontig:pi...  73.6       1e-13 
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  73.2       1e-13 
ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:...  73.2       2e-13 
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  73.2       2e-13 
PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:pa...  73.2       2e-13 
PHRA:scaffold_51                                                      72.8       2e-13 
PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig superc...  60.8       2e-13 
PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 g...  72.8       2e-13 
PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig supe...  72.4       3e-13 
HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  72.4       3e-13 
PYAR:scaffold_1972 par_scaffold_1972 dna:supercontig supercontig:...  72.0       3e-13 
HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  72.4       3e-13 
SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM151...  72.0       4e-13 
PHCA:scaffold_11 PHYCAscaffold_11                                     72.0       5e-13 
PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag...  71.6       5e-13 
PHCA:scaffold_39 PHYCAscaffold_39                                     71.6       6e-13 
PHSO:scaffold_8                                                       71.6       6e-13 
PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:...  71.2       7e-13 
PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 ...  71.2       7e-13 
PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig:...  71.2       8e-13 
PYIW:scaffold_270 piw_scaffold_270 dna:supercontig supercontig:pi...  70.9       1e-12 
PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKe...  70.5       1e-12 
SAPA:scaffold_12 supercont2.12 dna:supercontig supercontig:ASM151...  69.7       2e-12 
PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag...  69.7       2e-12 
PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:p...  69.7       3e-12 
PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 ...  69.7       3e-12 
PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:...  69.3       3e-12 
PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig:...  69.3       3e-12 
PYAR:scaffold_480 par_scaffold_480 dna:supercontig supercontig:pa...  68.9       4e-12 
PYAR:scaffold_1918 par_scaffold_1918 dna:supercontig supercontig:...  68.9       4e-12 
PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pv...  68.6       6e-12 
PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:p...  68.6       6e-12 
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  68.6       6e-12 
PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pi...  68.6       7e-12 
PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 u...  68.2       8e-12 
PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pi...  68.2       9e-12 
PYAR:scaffold_593 par_scaffold_593 dna:supercontig supercontig:pa...  68.2       1e-11 
PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 ge...  67.8       1e-11 
PHIF:NW_003303637.1 Phytophthora infestans T30-4 supercont1.122 g...  67.8       1e-11 
PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 g...  67.8       1e-11 
PYIR:scaffold_1361 pir_scaffold_1361 dna:supercontig supercontig:...  67.4       1e-11 
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  63.5       1e-11 
PYAR:scaffold_4639 par_scaffold_4639 dna:supercontig supercontig:...  67.0       2e-11 
PYVX:scaffold_698 pve_scaffold_698 dna:supercontig supercontig:pv...  67.0       2e-11 
PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pv...  67.0       2e-11 
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  66.6       3e-11 
SADI:scaffold_24 supercont1.24 dna:supercontig supercontig:Sap_di...  66.6       3e-11 
PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pi...  66.6       3e-11 
PHSO:scaffold_31                                                      66.2       4e-11 
PHRA:scaffold_532                                                     66.2       4e-11 
PHKE:scaffold_279 scf_22126_279.1 dna:supercontig supercontig:Phy...  65.9       5e-11 
PYIR:scaffold_46 pir_scaffold_46 dna:supercontig supercontig:pir_...  65.5       6e-11 
SADI:scaffold_22 supercont1.22 dna:supercontig supercontig:Sap_di...  65.1       9e-11 
PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310...  65.1       9e-11 
PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:p...  64.7       1e-10 
PYAP:scaffold_1339 pag1_scaffold_1339 dna:supercontig supercontig...  64.3       2e-10 
PYVX:scaffold_1640 pve_scaffold_1640 dna:supercontig supercontig:...  64.3       2e-10 
PYAR:scaffold_1613 par_scaffold_1613 dna:supercontig supercontig:...  64.3       2e-10 
PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 u...  64.3       2e-10 
PYIW:scaffold_1952 piw_scaffold_1952 dna:supercontig supercontig:...  63.9       2e-10 
SADI:scaffold_390 supercont1.390 dna:supercontig supercontig:Sap_...  63.5       2e-10 
PYVX:scaffold_341 pve_scaffold_341 dna:supercontig supercontig:pv...  63.2       3e-10 
PYIW:scaffold_783 piw_scaffold_783 dna:supercontig supercontig:pi...  63.5       4e-10 
PYUU:scaffold_2031 scf1117875582031 dna:supercontig supercontig:p...  63.5       4e-10 
PYIW:scaffold_5060 piw_scaffold_5060 dna:supercontig supercontig:...  62.8       5e-10 
PHKE:scaffold_376 scf_22126_376.1_contig_1 dna:supercontig superc...  62.8       6e-10 
PYIR:scaffold_1966 pir_scaffold_1966 dna:supercontig supercontig:...  62.0       1e-09 
PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pi...  62.0       1e-09 
PYAR:scaffold_266 par_scaffold_266 dna:supercontig supercontig:pa...  61.6       1e-09 
PYIR:scaffold_998 pir_scaffold_998 dna:supercontig supercontig:pi...  61.2       2e-09 
PYIR:scaffold_2122 pir_scaffold_2122 dna:supercontig supercontig:...  61.2       2e-09 
PHRA:scaffold_44                                                      61.2       2e-09 
PHCA:scaffold_3 PHYCAscaffold_3                                       60.8       2e-09 
PYVX:scaffold_1989 pve_scaffold_1989 dna:supercontig supercontig:...  60.8       2e-09 
PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig:...  60.8       3e-09 
PHIF:NW_003303307.1 Phytophthora infestans T30-4 supercont1.454 g...  60.8       3e-09 
PYAR:scaffold_55 par_scaffold_55 dna:supercontig supercontig:par_...  60.5       3e-09 
PYAP:scaffold_10 pag1_scaffold_10 dna:supercontig supercontig:pag...  60.5       3e-09 
PYIR:scaffold_1332 pir_scaffold_1332 dna:supercontig supercontig:...  60.5       4e-09 
PYIR:scaffold_4757 pir_scaffold_4757 dna:supercontig supercontig:...  58.9       5e-09 
PYVX:scaffold_622 pve_scaffold_622 dna:supercontig supercontig:pv...  60.1       5e-09 
PHRA:scaffold_14                                                      59.7       6e-09 
PYIR:scaffold_2176 pir_scaffold_2176 dna:supercontig supercontig:...  59.7       6e-09 
PYIR:scaffold_2066 pir_scaffold_2066 dna:supercontig supercontig:...  59.7       7e-09 
PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 ...  59.7       7e-09 
PYIR:scaffold_2435 pir_scaffold_2435 dna:supercontig supercontig:...  58.9       1e-08 
PYAR:scaffold_6810 par_scaffold_6810 dna:supercontig supercontig:...  58.5       1e-08 
PYVX:scaffold_663 pve_scaffold_663 dna:supercontig supercontig:pv...  58.9       1e-08 
PHRA:scaffold_555                                                     58.5       1e-08 
PYAP:scaffold_983 pag1_scaffold_983 dna:supercontig supercontig:p...  58.2       2e-08 
PYAR:scaffold_4631 par_scaffold_4631 dna:supercontig supercontig:...  58.2       2e-08 
PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 ge...  58.2       2e-08 
PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_...  58.2       2e-08 
PHCA:scaffold_5 PHYCAscaffold_5                                       58.2       2e-08 
PYIR:scaffold_548 pir_scaffold_548 dna:supercontig supercontig:pi...  57.8       3e-08 
PHKE:scaffold_191 scf_22126_191.1 dna:supercontig supercontig:Phy...  57.4       4e-08 
PYIW:scaffold_50 piw_scaffold_50 dna:supercontig supercontig:piw_...  57.4       4e-08 
PYAR:scaffold_6624 par_scaffold_6624 dna:supercontig supercontig:...  56.6       4e-08 
PYIW:scaffold_712 piw_scaffold_712 dna:supercontig supercontig:pi...  57.0       5e-08 
PYAR:scaffold_3173 par_scaffold_3173 dna:supercontig supercontig:...  57.0       5e-08 
PLHA:NW_020188786.1 Plasmopara halstedii genome assembly, contig:...  57.0       5e-08 
SADI:scaffold_2 supercont1.2 dna:supercontig supercontig:Sap_dicl...  51.6       4e-06 
PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 ...  57.0       6e-08 
PHKE:scaffold_190 scf_22126_190.1 dna:supercontig supercontig:Phy...  56.6       8e-08 
PYAR:scaffold_3952 par_scaffold_3952 dna:supercontig supercontig:...  56.2       9e-08 
PYAP:scaffold_328 pag1_scaffold_328 dna:supercontig supercontig:p...  56.2       1e-07 
PYAP:scaffold_234 pag1_scaffold_234 dna:supercontig supercontig:p...  55.5       2e-07 
PYAP:scaffold_192 pag1_scaffold_192 dna:supercontig supercontig:p...  55.5       2e-07 
PYAR:scaffold_2617 par_scaffold_2617 dna:supercontig supercontig:...  55.5       2e-07 
PYAR:scaffold_2265 par_scaffold_2265 dna:supercontig supercontig:...  55.1       2e-07 
PYAR:scaffold_505 par_scaffold_505 dna:supercontig supercontig:pa...  55.1       2e-07 
PYIW:scaffold_532 piw_scaffold_532 dna:supercontig supercontig:pi...  55.1       2e-07 
PYAR:scaffold_8021 par_scaffold_8021 dna:supercontig supercontig:...  53.9       3e-07 
PHKE:scaffold_715 scf_22126_715.1 dna:supercontig supercontig:Phy...  50.1       4e-07 
PHCA:scaffold_47 PHYCAscaffold_47                                     54.3       4e-07 
PYVX:scaffold_155 pve_scaffold_155 dna:supercontig supercontig:pv...  53.5       9e-07 
PYIW:scaffold_1159 piw_scaffold_1159 dna:supercontig supercontig:...  52.4       2e-06 
PYAP:scaffold_321 pag1_scaffold_321 dna:supercontig supercontig:p...  52.4       2e-06 
PHKE:scaffold_787 scf_22126_787.1_contig_1 dna:supercontig superc...  52.0       2e-06 
PYVX:scaffold_2975 pve_scaffold_2975 dna:supercontig supercontig:...  51.2       3e-06 
PYVX:scaffold_496 pve_scaffold_496 dna:supercontig supercontig:pv...  52.0       3e-06 
PYAP:scaffold_356 pag1_scaffold_356 dna:supercontig supercontig:p...  52.0       3e-06 
PHIF:NW_003303565.1 Phytophthora infestans T30-4 supercont1.194 g...  50.4       9e-06 
PYIW:scaffold_5066 piw_scaffold_5066 dna:supercontig supercontig:...  49.7       1e-05 
PYIR:scaffold_630 pir_scaffold_630 dna:supercontig supercontig:pi...  49.3       2e-05 
PYIR:scaffold_4165 pir_scaffold_4165 dna:supercontig supercontig:...  48.9       2e-05 
PYAR:scaffold_2725 par_scaffold_2725 dna:supercontig supercontig:...  49.3       2e-05 
PYIW:scaffold_569 piw_scaffold_569 dna:supercontig supercontig:pi...  48.9       3e-05 
PYAR:scaffold_393 par_scaffold_393 dna:supercontig supercontig:pa...  48.5       4e-05 
PYIW:scaffold_3717 piw_scaffold_3717 dna:supercontig supercontig:...  48.1       5e-05 
SAPA:scaffold_44 supercont2.44 dna:supercontig supercontig:ASM151...  37.4       5e-05 
PYAP:scaffold_453 pag1_scaffold_453 dna:supercontig supercontig:p...  47.8       6e-05 
PYAR:scaffold_3827 par_scaffold_3827 dna:supercontig supercontig:...  47.4       8e-05 
PYAR:scaffold_9435 par_scaffold_9435 dna:supercontig supercontig:...  46.2       9e-05 
ALCA:scaffold_116 AcNc2_CONTIG_116_length_69695 dna:supercontig s...  47.4       1e-04 
PYIR:scaffold_883 pir_scaffold_883 dna:supercontig supercontig:pi...  46.2       3e-04 
PLHA:NW_020188473.1 Plasmopara halstedii genome assembly, contig:...  45.4       4e-04 
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  45.1       6e-04 
PYIW:scaffold_7 piw_scaffold_7 dna:supercontig supercontig:piw_sc...  44.3       0.001 
PHSO:scaffold_13                                                      43.9       0.001 
PYIR:scaffold_1443 pir_scaffold_1443 dna:supercontig supercontig:...  43.5       0.002 
PYAR:scaffold_5201 par_scaffold_5201 dna:supercontig supercontig:...  42.7       0.003 
ALLA:FR824149 dna:supercontig supercontig:ENA1:FR824149:1:77927:1...  42.4       0.005 
PHIF:NW_003303663.1 Phytophthora infestans T30-4 supercont1.96 ge...  40.4       0.022 
PYIW:scaffold_1943 piw_scaffold_1943 dna:supercontig supercontig:...  40.0       0.026 
PYIW:scaffold_9255 piw_scaffold_9255 dna:supercontig supercontig:...  37.7       0.036 
PHKE:scaffold_1259 scf_22126_1259.1 dna:supercontig supercontig:P...  35.8       0.049 
PYIR:scaffold_5474 pir_scaffold_5474 dna:supercontig supercontig:...  37.7       0.082 
PLHA:NW_020188793.1 Plasmopara halstedii genome assembly, contig:...  37.4       0.087 
PYAR:scaffold_4128 par_scaffold_4128 dna:supercontig supercontig:...  37.7       0.12  
PYAR:scaffold_356 par_scaffold_356 dna:supercontig supercontig:pa...  38.1       0.12  
PYVX:scaffold_1002 pve_scaffold_1002 dna:supercontig supercontig:...  37.7       0.15  
ALLA:FR824130 dna:supercontig supercontig:ENA1:FR824130:1:88159:1...  37.0       0.23  
PYAP:scaffold_566 pag1_scaffold_566 dna:supercontig supercontig:p...  37.0       0.26  
PYIR:scaffold_4543 pir_scaffold_4543 dna:supercontig supercontig:...  36.6       0.26  
PYIR:scaffold_922 pir_scaffold_922 dna:supercontig supercontig:pi...  36.2       0.40  
PHRA:scaffold_100                                                     36.2       0.44  
ALLA:FR824046 dna:supercontig supercontig:ENA1:FR824046:1:580768:...  35.4       0.80  
PHKE:scaffold_1486 scf_22126_1486.1_contig_1 dna:supercontig supe...  35.0       0.88  
ALCA:scaffold_349 AcNc2_CONTIG_349_length_26566 dna:supercontig s...  34.7       1.3   
PHIF:NW_003303719.1 Phytophthora infestans T30-4 supercont1.40 ge...  34.7       1.6   
PYAR:scaffold_4687 par_scaffold_4687 dna:supercontig supercontig:...  33.9       2.2   
PYAR:scaffold_1854 par_scaffold_1854 dna:supercontig supercontig:...  33.9       2.8   
SADI:scaffold_8 supercont1.8 dna:supercontig supercontig:Sap_dicl...  33.9       3.0   
PYAR:scaffold_3110 par_scaffold_3110 dna:supercontig supercontig:...  33.1       4.0   
PLHA:NW_020187390.1 Plasmopara halstedii genome assembly, contig:...  33.1       4.8   
PYIR:scaffold_954 pir_scaffold_954 dna:supercontig supercontig:pi...  32.7       5.4   
PYAR:scaffold_469 par_scaffold_469 dna:supercontig supercontig:pa...  32.3       9.3   

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 384 bits (985),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%), Gaps = 0/179 (0%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY
Sbjct  94225  DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  94046

Query  86     TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK
Sbjct  94045  TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  93866

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
              TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF
Sbjct  93865  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  93689

 Score = 281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR+ NGY +LRAF DGA Y
Sbjct  92738  DAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGASY  92917

Query  86     TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              TV+DGAD+ CGFTN     Q IPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  92918  TVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  93097

Query  145    KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
              K Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGAANESA  +F
Sbjct  93098  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIADF  93277

 Score = 150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query  29     QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
              QVV  P P +  D  D +   LA+L+ QG  T  +   W   +GY +LRA +D  + Y V
Sbjct  95702  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95523

Query  88     TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
              T+ A + CG T+ K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  95522  TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  95343

Query  147    YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              + +DYSSC  SC L WYWLG ++++  +SWQVYK C+
Sbjct  95342  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCV  95232

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 334 bits (857),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               +AHQVVLLPAPTYTTDNKDTKYAPLAFLE+QG++TVEDFNGWRR+NGYKTLR FMD AKY
Sbjct  243504  NAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKY  243325

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               TVTDGADYYCGFTN  AAPQPIPDGTMRSTGYTHDGPCEVWLD+ RVLQSDNCHET  GK
Sbjct  243324  TVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  243145

Query  146     TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
               TYNLDYSSC G+C LRWYWLG R+LKN +SWQ+YKACIPLS+SARRLE AANES A+E 
Sbjct  243144  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANESVALEV  242968

 Score = 286 bits (732),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               +AHQVVLL APTYTTD+KDTKYAPLAFLE QGF T EDF  WR+ NGY +LRAF DGA Y
Sbjct  241987  NAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGASY  242166

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TV+DGAD  CGFTN     QPIPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  242167  TVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  242346

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
               K Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGAANESA I+F
Sbjct  242347  KYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAIIDF  242526

 Score = 155 bits (393),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 2/162 (1%)
 Frame = -1

Query  29      QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
               QVVL P P +  D  D +   LA+L+ QG  T  +   W + +GY +LRA +D  + Y V
Sbjct  245182  QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  245003

Query  88      TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               T+ A + CG T+ +   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  245002  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  244823

Query  147     YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
               + +DYSSC  +C L WYWLG ++++  +SWQVYK C+ LS++
Sbjct  244822  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  244697

>PHSO:scaffold_1
Length=13391543

 Score = 333 bits (855),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
                DAHQVVLLPAPTYTTD+K TKYAPLAFLE+QG++TVEDFN WRR  GYKTLRAFMDGA Y
Sbjct  2791883  DAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASY  2791704

Query  86       TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
                TV DGADYYCGFT+ K   QPIPDGTMRSTGYTHDGPCEVWLD+TRVLQSDNCHETF GK
Sbjct  2791703  TVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  2791524

Query  146      TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
                TY+LDYSSCKGSC LRWYWLG RFLKNE+SWQVYKAC+PLS+SARRLE AANESAA+EF
Sbjct  2791523  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESAALEF  2791347

 Score = 282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = +1

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
                AHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF DGA YT
Sbjct  2790346  AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGASYT  2790525

Query  87       VTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
                V DGAD+ CGFTN     QPIPD   MRSTGYTHDGPCEVWLD T V+Q DNCHE+  GK
Sbjct  2790526  VADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGK  2790705

Query  146      TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
                 Y +DYSSC  +C L W+WLG R+LKNE+SWQ+YKAC+PLS+SARRLEGA NESA ++F
Sbjct  2790706  DYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESARLDF  2790882

 Score = 153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 2/160 (1%)
 Frame = -1

Query  29       QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
                QVV  P P +  D  D +   LA+L+ QG  T  +   W + +GY +LRA +D  + Y V
Sbjct  2794082  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKV  2793903

Query  88       TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
                T+ A + CG T+ K   QPIP + + +++GYT DGPCEVWLD T+V    NCH  FP   
Sbjct  2793902  TEEALFDCGLTSPKTETQPIPSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQ  2793723

Query  147      YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                + +DYS+C  SC L WYWLG ++++  +SWQVYK C+ LS
Sbjct  2793722  HEIDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALS  2793603

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 78/186 (42%), Gaps = 37/186 (20%)
 Frame = +2

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQ----GFK-------TVEDFNGWRRSNGYK  74
                DAH  +  PA  +    K T YA     +      G K           F       GY 
Sbjct  2592110  DAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAGYS  2592289

Query  75       TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-------TGY--THDGPCEV  125
                +LR  +D     VTD     C  T    +P  +   T  S        G+  +H GPCEV
Sbjct  2592290  SLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGPCEV  2592445

Query  126      WLDSTRVLQSDNC----HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
                W+D T V   D+C       +P K  N D+S C G C LR+YWL      +E +WQ+YK 
Sbjct  2592446  WIDDTMVEHQDDCVAKYGSGYPAKV-NADFSKCSGDCTLRFYWLAL----HEPNWQIYKQ  2592610

Query  182      CIPLSS  187
                C+P+ S
Sbjct  2592611  CVPVVS  2592628

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 78/186 (42%), Gaps = 37/186 (20%)
 Frame = -1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQ----GFK-------TVEDFNGWRRSNGYK  74
                DAH  +  PA  +    K T YA     +      G K           F       GY 
Sbjct  2595602  DAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAGYS  2595423

Query  75       TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-------TGY--THDGPCEV  125
                +LR  +D     VTD     C  T    +P  +   T  S        G+  +H GPCEV
Sbjct  2595422  SLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTTMSWQNDQEQKGFIDSHHGPCEV  2595267

Query  126      WLDSTRVLQSDNC----HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
                W+D T V   D+C       +P K  N D+S C G C LR+YWL      +E +WQ+YK 
Sbjct  2595266  WIDDTMVEHQDDCVAKYGSGYPAKV-NADFSKCSGDCTLRFYWLAL----HEPNWQIYKQ  2595102

Query  182      CIPLSS  187
                C+P+ S
Sbjct  2595101  CVPVVS  2595084

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 51/117 (44%), Gaps = 20/117 (17%)
 Frame = +2

Query  72       GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-----TGYTHDGPCEVW  126
                GY +LR  +D     VTD     C  T    +P  + D T  +        TH GPCEVW
Sbjct  2593706  GYSSLRDMLDQQ---VTD-----CANTRTDVSPVDVSDLTAMTWQNNPGVITHRGPCEVW  2593861

Query  127      LDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
                +D   +   DNC   +        + D+S C   C LR+YWL       E +WQ+ +
Sbjct  2593862  IDEIMMNHRDNCLAGNVAVYSMEISTDFSKCSDKCTLRFYWLALY----EPNWQIVR  2594020

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 50/107 (47%), Gaps = 15/107 (14%)
 Frame = -2

Query  65        NGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRSTGYTHDGP  122
                 N  RRS   K     +DG   ++ D A   C FTN    PQPIP     + S G  H G 
Sbjct  10439116  NAPRRSTSAKNPEPMLDG--MSLYDAA---CSFTNRNGTPQPIPTNANAIFSHGLIHTGS  10438952

Query  123       CEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLR  161
                 CE  L   ++L +D+C+  +     N      +DY SC+ G C M+R
Sbjct  10438951  CEF*LGDKKLLYADDCYSEYSHLNVNVKTESSIDYLSCENGGCKMMR  10438811

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 59/134 (44%), Gaps = 15/134 (11%)
 Frame = -2

Query  41       DNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY---CGF  97
                + + ++++P   L SQ  +        R SN  K  R     +   + DG   Y   C F
Sbjct  7957207  NEEASRFSPHLRLASQVARPATPRRALRCSNAPK--RPTSAKSPEPMLDGMSLYDAACSF  7957034

Query  98       TNAKAAPQPIPDGT--MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------L  149
                TN    PQPIP     + S G  H G CE  L   ++L +D+C+  +     N      +
Sbjct  7957033  TNRNGTPQPIPTNANAIFSHGLIHTGSCEF*LGDKKLLYADDCYSEYSHLNVNVKTESSI  7956854

Query  150      DYSSCK-GSC-MLR  161
                DY SC+ G C M+R
Sbjct  7956853  DYLSCENGGCKMMR  7956812

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 327 bits (838),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 164/180 (91%), Gaps = 1/180 (1%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+TV+DFN WRR+NGYKTLRAFMDGAKY
Sbjct  59186  DAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKY  59007

Query  86     TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              TVTDGADY+CGFTNA AAPQ IP G  MRSTGYTHDGPCEVWLD+TRVL  DNCHE   G
Sbjct  59006  TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  58827

Query  145    KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
              K Y +DYSSC G+C LRWYWLG RFLKNE+SWQVYKAC+PLS+SARRL+GAANESAAIEF
Sbjct  58826  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESAAIEF  58647

 Score = 275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              +AHQVVLLP+PTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF D A Y
Sbjct  57493  NAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDASY  57672

Query  86     TVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              TV+DGAD+ CGFT+   A QPIPD   MRSTGYTHDGPCEVWLD T V+Q +NCH++  G
Sbjct  57673  TVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISG  57852

Query  145    KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
              K Y +DYSSC  +C L W+W+G R+LKNE+SWQVYKAC+PLS+SARRLEGA NES   E
Sbjct  57853  KDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVIFE  58029

 Score = 156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 102/165 (62%), Gaps = 2/165 (1%)
 Frame = -2

Query  29     QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
              Q+VL P P +  D  D +   LA+L+ QG  T  +  GW  S+GY +LRA +D  A Y V
Sbjct  60906  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  60727

Query  88     TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
              T+ A + CG T+ K   Q IP + T +++GYT DGPCEVWLD  +V    NCH  FP   
Sbjct  60726  TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPCEVWLDDKKVAAGRNCHTEFPHGM  60547

Query  147    YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
              +++DYSSC  SC L WYWLG ++    +SWQVYK C+ LS +A +
Sbjct  60546  HSIDYSSCGNSCTLWWYWLGVKYTDEGYSWQVYKNCVGLSKTASQ  60412

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 312 bits (799),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 157/177 (89%), Gaps = 3/177 (2%)
 Frame = -3

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
               AHQVVLLP+PTYTTD+KDTKYAPL FLE QG++TVEDFNGWRR+NGYKTLR FM+   YT
Sbjct  359155  AHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME---YT  358985

Query  87      VTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               V DGADYYCGFTN  AAPQP PDG MRSTGYTHDGPCEVWLDSTRVLQSDNCHET  GKT
Sbjct  358984  VADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  358805

Query  147     YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
               YNLDYSSCKG+C LRWYWLG RFLKN +SWQ+YKACIPLS+SARRLE AAN+S   +
Sbjct  358804  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVVFD  358634

 Score = 158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 2/160 (1%)
 Frame = -1

Query  29      QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
               Q+VL P P +  D  D +   LA+L+ QG  T  +   W +  GY +LRA +D  + Y V
Sbjct  395334  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  395155

Query  88      TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               T+ A + CG T+ +   QPIP + + +++GYT DGPCE+WLD T+V    NCH  FP   
Sbjct  395154  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  394975

Query  147     YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               + +DYSSC GSC L WYWLG ++++  +SWQVYK C+ LS
Sbjct  394974  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  394855

>PHRA:scaffold_56
Length=334739

 Score = 303 bits (777),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 155/180 (86%), Gaps = 4/180 (2%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQVVLLPAPTYTTD+KDTKYAPLAFLE+QGF+TV DFN WRRSNGYKTLRAFMDGAKY
Sbjct  162538  DAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKY  162717

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TV DGADYYCGFTNA A PQ IPDG  MRSTGYTHDGPCEVWLD+TRVL  DNCHE   G
Sbjct  162718  TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  162897

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
               K Y +DYSSC G+C L WYW+G R+LKN +SWQVYKAC+PLS+SARRL    NESA I+F
Sbjct  162898  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAVIDF  163068

 Score = 279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQVVLLPAPTYTTD+K TKYAPLAFLE QGF T EDF  WR  NGY +LRAF DGA Y
Sbjct  164084  DAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGASY  163905

Query  86      TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TV+DGAD+ CGFT+     Q IPDG  MRSTGYTHDGPCEVWLD T V+Q DNCHE   G
Sbjct  163904  TVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISG  163725

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
               K Y +DYSSC  +C L W+W+G R+L N +SWQVYKAC+PLS+SARRLEGAANESA ++F
Sbjct  163724  KDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAILDF  163545

 Score = 158 bits (399),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 102/163 (63%), Gaps = 2/163 (1%)
 Frame = +2

Query  29      QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
               Q+VL P P +  D  D +   LA+L+ QG  T  +  GW + +GY +LR+ +D  + Y V
Sbjct  160958  QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  161137

Query  88      TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               T+ A + CG T+ K   Q IP + + +S+GYT DGPCEVWLD T+     NCH  FP   
Sbjct  161138  TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  161317

Query  147     YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               + +DYS+C  +CMLRWYWLG ++++  +SWQVYK CI L   A
Sbjct  161318  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  161446

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQ V+LPAPT+ TD+KD  YAPLAFLE QGF T EDF  WR  NGY +LRAFMDGA Y
Sbjct  14928  DAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGASY  14749

Query  86     TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              TVTDGAD  CG+TN     Q +PDG MRSTGYTH GPCEVWLD T VLQ DNCH++  GK
Sbjct  14748  TVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  14569

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
              TY+LDYSSC  +C L W+W+G R+L NE+SWQVYK C+PLS+SARRLEGAAN SA ++
Sbjct  14568  TYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVVD  14395

 Score = 259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 138/179 (77%), Gaps = 2/179 (1%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQ V+LP PT+TT ++D  YAPLAFLE QGF+TVEDFN WRRSNGYKTLRAFMD A Y
Sbjct  13551  DAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQASY  13730

Query  86     TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              TVTDGAD  CGFT     PQPIP    RSTGYTHDGPCE+WLDSTRV  +DNCHE   GK
Sbjct  13731  TVTDGADQTCGFTEIDGTPQPIP-ANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  13907

Query  146    TYNLDYS-SCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
                 +DYS    G+C L WYW+G R+L N +SWQVYK C+PLS+SAR LEGAAN SA IE
Sbjct  13908  DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAIIE  14084

 Score = 244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKY  85
             AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T +DF G+  +NG+ +LRAFMD  + Y
Sbjct  7586  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  7765

Query  86    TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
             +V   AD+ CGFT+  AAPQPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE   GK
Sbjct  7766  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  7945

Query  146   TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             TY+LDYS+C GSC L WYWLG R+LK  +SWQVYKAC+P+S
Sbjct  7946  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  8068

 Score = 128 bits (321),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  119   HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
             HDGPCE+WLD TR+ Q DNCHE+  GK   +DYSSC GSC L W+W+G R+LK  +SWQV
Sbjct  9063  HDGPCEIWLDDTRIFQGDNCHESVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQV  8884

Query  179   YKACIPLSSSARRLEGAANESA  200
             YK C+PLS+SAR LEGAAN SA
Sbjct  8883  YKNCVPLSTSARMLEGAANASA  8818

 Score = 92.0 bits (227),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ V+LP PT+T+++ D  Y+PLAFLE QGF T EDFN WR +NGY TLRAFMD A Y
Sbjct  9307  DAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQASY  9128

Query  86    T  86
             T
Sbjct  9127  T  9125

 Score = 112 bits (279),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQ V+LP P++TT ++D  Y+PLAFLE+QGFKT EDF+ WRR+NGYKTLR+FMD  KY
Sbjct  12431  DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY  12610

Query  86     TVTDGADYYCG  96
              TVT GAD  CG
Sbjct  12611  TVTSGADQQCG  12643

 Score = 106 bits (265),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +1

Query  129    STRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
              STRV  +DNCH    GK   +DYSSCKGSC L WYW+G R+LK  +SWQVYK C+PLS+S
Sbjct  12655  STRVYANDNCHAAISGKDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  12834

Query  189    ARRLEGAANESAAI  202
              AR LE A+NESA I
Sbjct  12835  ARMLEAASNESALI  12876

 Score = 153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 2/163 (1%)
 Frame = +2

Query  29    QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
             QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  6485  QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  6664

Query  88    TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
             T+   + CG T      QPIP +G+  ++GYT DGPCE+W+D+T  L   NCH  FP   
Sbjct  6665  TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  6844

Query  147   YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
             + +DYS C  SC + W+WLG ++    +SWQV+K CI LS+SA
Sbjct  6845  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  6973

>PHRA:scaffold_79
Length=220511

 Score = 273 bits (698),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 135/165 (82%), Gaps = 0/165 (0%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQVVLLP P +TTDNKDTKY PLAFLE QGF T  DFN WRR NGYKTLR FMD AKY
Sbjct  26153  DAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRAKY  25974

Query  86     TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              TVT+GADY+CG+T+    PQPIP G MRSTGYTHDGPCEVWLD+TRVLQ DNCHE FP K
Sbjct  25973  TVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDK  25794

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
               Y +DYSSCKG+C L WYW+G RFLKN +SWQVYK CI L+S  R
Sbjct  25793  DYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQR  25659

>PHSO:scaffold_14
Length=1806347

 Score = 269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++K+TKY PLAFLE+QGFKT EDF  WR+ NGYK+LR FMD AKY
Sbjct  819299  DAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRAKY  819120

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  819119  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  818940

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
               K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  818939  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  818787

 Score = 194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLL  P  TT +KDTKY PLAFLE+QGF+T EDF  WR  NGYK+LR FMD AKY
Sbjct  813955  DAHQIVLLSEPQ*TTSDKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDKAKY  814134

Query  86      TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TVT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T+VL+ DNCHE FPG
Sbjct  814135  TVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG  814314

Query  145     KTYNLDYSSCKGSCMLRWYW  164
               K Y +  +  +G   L   W
Sbjct  814315  KDYTVLVAGVQGVHPLVRIW  814374

 Score = 161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 109/180 (61%), Gaps = 22/180 (12%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++K TKY PLAFLE+QGFKT EDF  WR+ NGY+TLR FMD AKY
Sbjct  815818  DAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKAKY  815639

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEV-----WLDSTRVLQSDNCH  139
                VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDG         W    R +      
Sbjct  815638  DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGVARRHDGAGWRQLPREV------  815477

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
                  PG+  +       G         G   +KN +SW+VYKACIPLS S     G + ES
Sbjct  815476  ---PGQGLHGRLLVV*GLVHASLVLDG---MKNSYSWKVYKACIPLSGSG----GTSQES  815327

 Score = 52.4 bits (124),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 6/56 (11%)
 Frame = +2

Query  95       CGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                CG T     PQPIP DG ++       G+TH GPCEV+LD   VL  DNC + + G
Sbjct  1038110  CGNTVVTGTPQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVLHGDNCEDEYKG  1038277

 Score = 23.9 bits (50),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 14/26 (54%), Gaps = 4/26 (15%)
 Frame = +3

Query  154      CKGSCMLRWYWLGTRFLKNEHSWQVY  179
                C G C L +YWL     +NE  WQ Y
Sbjct  1038318  CNGKCTLSFYWLA---FQNEQ-WQAY  1038383

>PHCA:scaffold_7 PHYCAscaffold_7
Length=1368812

 Score = 269 bits (688),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT +DF  WR  NGYK+LR FMD AKY
Sbjct  905950  DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRAKY  905771

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TVT+GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  905770  TVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  905591

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               K Y +DYSSCKG+C LRWYWLG RFLKN +SWQVYKACIPL+ S 
Sbjct  905590  KDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  905456

 Score = 259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  908745  DAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRAKY  908924

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT+GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  908925  PVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  909104

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
               K Y +DYSSCKG+C L W+WLG RFLKN++SWQVYKACIPL++  R L
Sbjct  909105  KGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNL  909248

 Score = 256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 1/164 (1%)
 Frame = +1

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
               AHQVVLLPAP + TDN+DT++ PLAFLESQGFKT +DF  WR  NGYK+LR FMD AKYT
Sbjct  901426  AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRAKYT  901605

Query  87      VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               V +GAD+ CG+T+    PQPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE FPGK
Sbjct  901606  VRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  901785

Query  146     TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                Y +DYS CKG C L WYWLG RFLKN +SWQVYK CIPL+ S 
Sbjct  901786  GYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  901917

 Score = 252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 128/168 (76%), Gaps = 1/168 (1%)
 Frame = -3

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
               AHQVVLLP P + TDN+DT++ PL FLE  GFKT  DF  WR+ NGYK+LR FMD AKY 
Sbjct  876705  AHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAKYP  876526

Query  87      VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               V++GAD+ CGFT+    PQPIP G  MRSTGYTHDGPCEVW+D T V++ DNCHE FPGK
Sbjct  876525  VSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  876346

Query  146     TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
                Y +DYS CKG C L WYWLG RFLKN +SWQVYK CIPL+S  R L 
Sbjct  876345  DYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLR  876202

 Score = 187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 96/119 (81%), Gaps = 1/119 (1%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               +AHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT +DF  WR  N YK+LR FMD AKY
Sbjct  904316  EAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAKY  904495

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               TVTDGAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FP
Sbjct  904496  TVTDGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFP  904672

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 74/141 (52%), Gaps = 18/141 (13%)
 Frame = +3

Query  67      WR--RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQP-----IPDGTMRSTGYTH  119
               WR  R+   +  R  + G + T T+         N ++  +P     +P   +R + +  
Sbjct  904389  WRSSRTRALRRSRTLLRGVRKTTTNPFATSWTMPNTQSRTEPTSLAGLPTRRVRRSPFRR  904568

Query  120     DGPCEVWLDSTRV-----LQSDNC------HETFPGKTYNLDYSSCKGSCMLRWYWLGTR  168
               + PC   +  T V     L +  C         FPGK Y +DYSSCKG+C LRWYWLG R
Sbjct  904569  EMPCVPLVTRTTVRVKCGLTTRWCWMVTTATRNFPGKDYTVDYSSCKGTCTLRWYWLGIR  904748

Query  169     FLKNEHSWQVYKACIPLSSSA  189
               FLKN++SWQVYKACIPLS S 
Sbjct  904749  FLKNQYSWQVYKACIPLSGSG  904811

 Score = 46.2 bits (108),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = -1

Query  31      VLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR  68
               VLLP P  T + K  KY PLAFLE  GFKT EDF  W+
Sbjct  902648  VLLPEPQRTANGKGAKYNPLAFLE-HGFKTQEDFAPWK  902538

 Score = 43.5 bits (101),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  71      NGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ  105
               N  K+L  F+  AKYTVTDGAD+ CGFT+ K  P 
Sbjct  902538  NNCKSLCDFIGNAKYTVTDGADFSCGFTDPKGTPS  902434

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +2

Query  43      KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               K  +Y PLAFLE++GF   EDF  WR  NGYK+   FMD AKY
Sbjct  900362  KKFQYNPLAFLENEGFTAQEDFTAWRTENGYKSF-DFMDRAKY  900487

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  43      KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTL  76
               K  +Y PLAFLE++GF T EDF  WR  NGYK L
Sbjct  895372  KKFQYNPLAFLENEGFTTQEDFTAWRTENGYKLL  895271

>PHPA:scaffold_66 NW_008649052.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.66, whole genome shotgun 
sequence
Length=310063

 Score = 268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VL P P +TTDNKD KY PLAFLE QGF+T EDFN WRR NGYKTLR FMD AKY
Sbjct  163108  DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  162929

Query  86      TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TVT+GADY+CG+T+ K  PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ PG
Sbjct  162928  TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  162749

Query  145     KTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
               K Y +DYSSC  KG C+LRWYWLG RFLKN +SWQVYK CIPL+++ +RL
Sbjct  162748  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRL  162599

>PHPA:scaffold_46 NW_008649032.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.46, whole genome shotgun 
sequence
Length=493760

 Score = 268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 139/170 (82%), Gaps = 3/170 (2%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ+VL P P +TTDNKD KY PLAFLE QGF+T EDFN WRR NGYKTLR FMD AKY
Sbjct  3969  DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  3790

Query  86    TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             TVT+GADY+CG+T+ K  PQPIP  G MRSTGYTHDGPCEVWLD  RVL+  NCHE+ PG
Sbjct  3789  TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  3610

Query  145   KTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
             K Y +DYSSC  KG C+LRWYWLG RFLKN +SWQVYK CIPL+++ +RL
Sbjct  3609  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRL  3460

>PHPA:scaffold_22 NW_008649008.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.22, whole genome shotgun 
sequence
Length=998868

 Score = 266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 136/171 (80%), Gaps = 1/171 (1%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT EDF  WR  NGYK+LR FMD AKY
Sbjct  685369  DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAKY  685548

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  685549  EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  685728

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
               K Y +DYSSCKGSC LRWYWLG RFLKN +SWQVYKACIPL+  A    G+
Sbjct  685729  KDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAGAPAGS  685881

 Score = 265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFKT EDF  WR  N YK+LR FMD AKY
Sbjct  687121  DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAKY  686942

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT GAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  686941  EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  686762

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
               K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPLS S  
Sbjct  686761  KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  686624

 Score = 258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 133/161 (83%), Gaps = 1/161 (1%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR F+D AKY
Sbjct  682882  DAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAKY  682703

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VTDGAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  682702  PVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  682523

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               K Y +DYSSCKG+C L WYWLG RFLKN++SWQVYKACIPL
Sbjct  682522  KDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  682400

 Score = 258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 137/178 (77%), Gaps = 6/178 (3%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT++KDTKY PLAFLE+QGFK  EDF  W + NGYK+LR FMD AKY
Sbjct  714178  DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRAKY  714357

Query  86      TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT GAD+ CGFTN K  PQPIP  G MRSTGYTHDGPCEV+LD T VLQ DNCHE FPG
Sbjct  714358  EVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPG  714537

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
               K   +DYSSCKG+C LRWYWLG RFLKN +SWQVYK CIPL  S     G  +++A +
Sbjct  714538  KDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGS-----GGVSQTAPV  714696

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 68/161 (42%), Gaps = 24/161 (15%)
 Frame = -1

Query  55      SQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG---  110
               S G++ V  F    +  G +   A +D  K       D  CGFT     PQPIP DG   
Sbjct  454941  SDGYQ-VGKFKTMAKEKGMRVRDALLDMVK-------DKKCGFTRMDVDPQPIPSDGNAK  454786

Query  111     --TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCML  160
                 + R  G+ H GPCEV++D   V + DNC   FPG            +DY SC G C L
Sbjct  454785  WRSNRDGGFGHLGPCEVYIDDNMVARGDNCETDFPGGDDKSSKPSIIPVDY*SCNGKCTL  454606

Query  161     RWYWLG--TRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
                 YWL    R  +   +   YK        + RL+  A  +
Sbjct  454605  TLYWLAFEGRIGRRTSTVSHYKVAAQRRKLSHRLDQLAGRN  454483

>PHRA:scaffold_267
Length=29552

 Score = 266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 140/180 (78%), Gaps = 2/180 (1%)
 Frame = +3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQVVLLP P +TTD+KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  9339  DAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAKY  9518

Query  86    TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              V DGAD+ CGFT+ K  PQPIP G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPG
Sbjct  9519  NVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  9698

Query  145   KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA-ANESAAIE  203
             K Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYK CIPL+  +   E A A E+ + E
Sbjct  9699  KDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPATEAPSTE  9878

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT +KDTKY PLAFLE+QGFKT +DF  WR  NGYK+LR FMD AKY
Sbjct  696917  DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRAKY  697096

Query  86      TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                VT GAD+ CGFT+ K  PQPIP  G MRSTGYTHDGPCEVWLD   VL  DNCHE FPG
Sbjct  697097  DVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPG  697276

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               K Y +DYSSCKG+C LRWYWLG RFLKN +SWQVYKACIPL+
Sbjct  697277  KDYTVDYSSCKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  697402

 Score = 152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +1

Query  101     KAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCM  159
               +  PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE FPGK Y +DYSSCKG+C 
Sbjct  673435  RGTPQPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCT  673614

Query  160     LRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               LRWYWLG RFLKN++SWQVYKACIPL+ S 
Sbjct  673615  LRWYWLGIRFLKNKYSWQVYKACIPLAGSG  673704

>PHRA:scaffold_106
Length=147471

 Score = 262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 135/171 (79%), Gaps = 1/171 (1%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
              DAHQ+VLLP P +TTD+KDTKY PLAFLE++GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  13413  DAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNAKY  13234

Query  86     TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              +VT+GAD+ CGFT+ K  PQPIP D  MRSTGYTHDGPCEVWLD T VL  +NCHE FPG
Sbjct  13233  SVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  13054

Query  145    KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
              K Y +DYSSCKG+C LRWYW+G RFLK  +SWQVYK CIPL+  +   E A
Sbjct  13053  KDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESA  12901

>PHKE:scaffold_761 scf_22126_761.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_761.1_contig_1:1:9298:1 
REF
Length=9298

 Score = 262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -2

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ+VLLP P + TD+K+ KY PLAFLE+QGF T ED N WRR NGYKTLRAFMD AKY
Sbjct  870  DAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAKY  691

Query  86   TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             VT+GADY+CG+T+     QPIP+G  MRSTGYTHDGPCEVW+D+TRVL+S NCHET  G
Sbjct  690  QVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITG  511

Query  145  KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
            K Y +DYS+C+G+CMLRWYWLG RFLKN +SWQVYKACIPL+S +
Sbjct  510  KDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  376

>PHSO:scaffold_35
Length=32414

 Score = 260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -3

Query  27     AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
               HQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR FMD AKY 
Sbjct  18612  THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  18433

Query  87     VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPGK
Sbjct  18432  VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  18253

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
               Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  18252  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  18103

>PHSO:scaffold_5
Length=6830280

 Score = 260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 137/170 (81%), Gaps = 1/170 (1%)
 Frame = -3

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
                HQ+VLLP P +TT++K+TKY PLAFLE++GF T EDF  WR+ NGYK+LR FMD AKY 
Sbjct  682465  THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYD  682286

Query  87      VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               VT GAD+ CGFT+ K  PQPIP+G  MRSTGYTHDGPCEVWLD T VL  DNCHE FPGK
Sbjct  682285  VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  682106

Query  146     TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
                Y +DYSSCKG+C LRWYWLG RFLKN++SWQVYKACIPL+S +    G+
Sbjct  682105  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  681956

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 46/106 (43%), Gaps = 14/106 (13%)
 Frame = +3

Query  65       NGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRSTGYTHDGP  122
                N  RR    K     +DG   ++ D A   C FTN    PQPIP     + S G  H G 
Sbjct  3040278  NAPRRPTSAKNPEPMLDG--MSLYDAA---CSFTNRNGTPQPIPTNANAIFSHGLIHTGS  3040442

Query  123      CEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCKGSC-MLR  161
                CE  L   ++L +D+C+  +     N      +DY    G C M+R
Sbjct  3040443  CEF*LGDKKLLYADDCYSEYSHLNVNVKTESSIDYLCENGGCKMMR  3040580

 Score = 39.3 bits (90),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 48/104 (46%), Gaps = 15/104 (14%)
 Frame = -1

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRSTGYTHDGPCEV  125
                RR    K+    +DG   ++ D A     FTN    PQPIP     + S G  + G CE 
Sbjct  4992981  RRPTSAKSPEPMLDG--MSLYDAAY---SFTNRNGTPQPIPTNANAITSHGLIYTGSCEF  4992817

Query  126      WLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLR  161
                 L   ++L +D+C+  +     N      +DY SC+ G C M+R
Sbjct  4992816  *LGDKKLLYADDCYSEYSHLNVNVKTESSIDYLSCENGGCKMMR  4992685

>PHKE:scaffold_622 scf_22126_622.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_622.1:1:14582:1 
REF
Length=14582

 Score = 258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = -1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ+VLLP PT+TTD+KDTKY PLAFLE +GF   EDF  WR  NGYK+LR FMD AKY
Sbjct  3956  DAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAKY  3777

Query  86    TVTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             +VT GAD  CGFT+    PQPIP+G  MRSTGYTHDGPCEVW+D T  + +DNCHE FPG
Sbjct  3776  SVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPG  3597

Query  145   KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
             K Y +DYS+CKG+C LRWYWLG RFLKN +SWQVYKACIPL+ S 
Sbjct  3596  KDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSG  3462

 Score = 109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ+VLLP PT+TT++KDTKY PLAFLE +GF   EDF  WR  NGYK+LR FMD AKY
Sbjct  5485  DAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDNAKY  5306

Query  86    TVTDGADYYCG  96
              VT GAD+ CG
Sbjct  5305  PVTSGADFNCG  5273

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  142  FPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
            FPGK Y +DYS+CKG+C LRWYWLG RFLKN +SWQVYKACIPL+
Sbjct  4    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  138

>PYIR:scaffold_5024 pir_scaffold_5024 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5024:1:718:1 
REF
Length=718

 Score = 233 bits (593),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +1

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
            DAHQ V+LPAPT+T  +K+  + PLAFLE+QG+KT  DFNG+ +S GYKTLRAFMD  K 
Sbjct  151  DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  330

Query  86   TVTD--GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               D  GA++ CG+TN     QPIP GT+RSTGYTHDGPCEVWLD+T+V+   NC++ FP
Sbjct  331  YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  510

Query  144  GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
            GKT+++ Y+SCKGSC LRWYW+G RFLKN+ SWQVYK C+P+  S RRL
Sbjct  511  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRRL  654

>PHPA:scaffold_20 NW_008649006.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.20, whole genome shotgun 
sequence
Length=1049362

 Score = 249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               +AHQVVL PAP + TDN+DT++ PLAFLESQGFKT EDF  WR  NGYKTLR FM+ AKY
Sbjct  363584  EAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAKY  363763

Query  86      TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               TVT+GAD+ CG+TN K  PQPIP  G MRSTGYTH+GPCE+W+  T+V Q+DNCH + PG
Sbjct  363764  TVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPG  363943

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               K Y +DYS CKG+C+L WYWLG RFLKN +SWQVYK CIPL++++
Sbjct  363944  KEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  364078

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 67/145 (46%), Gaps = 27/145 (19%)
 Frame = +3

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAK---YTVTDGA-----DYYCGFTNAKAAPQPIP  108
               G+ T+ D N W   +G   + AF   AK    +V D       D  CG T     PQPIP
Sbjct  581022  GWVTLID-NYWDIGSGGDQVGAFKTMAKEKGMSVKDVVLDMVKDQKCGNTLENGDPQPIP  581198

Query  109     -DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSC  154
                DG ++       G+TH GPCE++LD   VL  D+C + F G            +D+SSC
Sbjct  581199  ADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSC  581378

Query  155     KGSCMLRWYWLGTRFLKNEHSWQVY  179
                G C+L  YWL  +       WQ Y
Sbjct  581379  NGKCLLTIYWLAFQ----NAQWQTY  581441

 Score = 32.3 bits (72),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 25/48 (52%), Gaps = 6/48 (13%)
 Frame = +1

Query  158     CMLRWYWLGTRFLKNEHSWQVYKACIPL--SSSARRLEGAANESAAIE  203
               C L  YWL     +NE  WQ Y  CIPL  S SA + + +A  SA  E
Sbjct  509740  CTLSLYWL---AFQNEQ-WQAYVNCIPLQGSGSATQAKPSAGGSAGGE  509871

>PLHA:NW_020187034.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_113, whole genome shotgun sequence
Length=380982

 Score = 244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  27     AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
              AHQ+VLLP P + T++KDT+Y PLAFLE+Q FKT  D   + + N +KTLR FMD AKYT
Sbjct  94689  AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAKYT  94868

Query  87     VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              V  GAD  CGFT+    PQPIP +  MRSTGYTHDGPCEVWL++TRVL + NCHE FPGK
Sbjct  94869  VVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGK  95048

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
               Y +DYSSCK +C+LRWYWLG RFLK ++SWQVYKACIPLS SA+
Sbjct  95049  DYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  95183

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
                DAHQ V+LPAPT+T   +  ++ PLAFLE+QGF+T  DFN + ++ GYKTLRAFMD  K 
Sbjct  1295889  DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKA  1296068

Query  85       YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                YTV  GAD+ CG+T      Q IP GT+RSTGYTHDGPCEVWLDSTRV++ +NCH  F G
Sbjct  1296069  YTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTG  1296248

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEG  194
                 T+ +DYSSCKGSC LRWYW+G RFLK E+SWQVYK C+P+ SS R  +G
Sbjct  1296249  TTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSSRRLGDG  1296398

 Score = 235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 132/180 (73%), Gaps = 2/180 (1%)
 Frame = +2

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
                DAHQ V+LPAPT+T   +  ++ PLAFLE+QG+KT  DFN + ++ GYKTLRAFMD  K 
Sbjct  1294352  DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKA  1294531

Query  85       YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                Y V  GAD+ CG+T      QPIP GT+RSTGYTHDGPCEVWLDSTRV++ +NCH  FPG
Sbjct  1294532  YKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPG  1294711

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
                 T+ +DYSSCKGSC LRWYW+G RFLK ++SWQVYK C+P+    R LE    E  + E 
Sbjct  1294712  TTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNSTEL  1294888

 Score = 227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 130/180 (72%), Gaps = 2/180 (1%)
 Frame = +2

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
                DAHQ V+LPAPT+T   +  ++ PLAFLE+QGFKT  DFN + ++ GYK+LRAFMD  K 
Sbjct  1288628  DAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKA  1288807

Query  85       YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                Y V  GAD+ CG+T      QPIP GT+RSTGYTHDGPCEVWLD+T V++ +NCH  FPG
Sbjct  1288808  YKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPG  1288987

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIEF  204
                 T+ + Y+SCKGSC LRWYW+G RFLK ++SWQVYK C+P+    R LE    E  + E 
Sbjct  1288988  TTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK-RLLEEQFAEGNSTEL  1289164

 Score = 226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
                DAHQ+V+LP PT+T   KD +++PLAFLE+QG+KT  DFN + +S GYK+LRAFMD  K 
Sbjct  1298023  DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  1298202

Query  85       YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                Y V   AD+ CG+TN   A QPIP    R+TGYTHDGPCEVWLD+T+VL   NCH+ FPG
Sbjct  1298203  YKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  1298379

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                KT+ + Y++CKGSC LRWYW+G RFLK +HSWQVYK C+PL
Sbjct  1298380  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  1298502

 Score = 209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
                DAHQ+++ P P +  D KD ++ PLAFLE+QG  T  D  G+ +  GY  LRA MD  K 
Sbjct  1299487  DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  1299666

Query  85       YTVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
                Y V   A + CG+T+     QPIP  GT+RSTGYTHDGPCEVWLD  +V+  DNCH+ FP
Sbjct  1299667  YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  1299846

Query  144      GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                GKT+ LDYSSCKGSC LRWYWLG R+LK  +SWQ+YK C+ LS +A
Sbjct  1299847  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  1299984

 Score = 180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = +3

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
                AHQ V +P P +T   K T +APL+FLE  G KT    NG+ +  GY TLR  MD  K Y
Sbjct  1300995  AHQAVEVPKPNWTVPKKATYWAPLSFLEKNGVKTSASVNGFMKEKGYNTLRDLMDDQKLY  1301174

Query  86       TVTDGAD-YYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
                 V   AD + CG+T+     QPIP D TMR+TGYTH GPCEVW+D  +V+  DNCHE   
Sbjct  1301175  KVNSNADNFLCGYTDPTKGSQPIPKDSTMRTTGYTHVGPCEVWIDDVKVIAGDNCHEQV-  1301351

Query  144      GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                  T  +DYS+CKG C + WYWLG RFLK + SWQVYK CI L+
Sbjct  1301352  SNTTKVDYSNCKGKCTMHWYWLGLRFLKKKWSWQVYKNCIALT  1301480

 Score = 161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 96/161 (60%), Gaps = 2/161 (1%)
 Frame = -3

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
                A   VL P P Y  D  + + AP+A LE QG KT  D + + +  GY  LRA +D  K Y
Sbjct  1303097  AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  1302918

Query  86       TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                 V   A   CG+T+     QPIP      STGY  +GPCEVWLD  +V+   NCH  +PG
Sbjct  1302917  NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  1302738

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                  + LDYSSCKGSCMLRWYWLG + +   +SWQVYK C+ L
Sbjct  1302737  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  1302615

>PYIR:scaffold_2249 pir_scaffold_2249 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2249:1:3349:1 
REF
Length=3349

 Score = 236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 3/170 (2%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD-GAK  84
             DAHQ V+LPAPT+T   +  ++ PLAFLE+QGFKT  DF+ + ++ GYKTLRAFMD  + 
Sbjct  1919  DAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSA  1740

Query  85    YTVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
             Y V DGAD+ CG+T     PQPIP   T+RSTGYTHDGPCEVWLD TRVL+  NCH  FP
Sbjct  1739  YKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFP  1560

Query  144   GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
             G T+ +DYSSCKGSC+LRWYW+G RFLK ++SWQVYK C+P++ S R L+
Sbjct  1559  GTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS-RSLD  1413

>PHIF:NW_003303626.1 Phytophthora infestans T30-4 supercont1.133 
genomic scaffold, whole genome shotgun sequence
Length=313873

 Score = 150 bits (378),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 72/89 (81%), Gaps = 1/89 (1%)
 Frame = +1

Query  102     AAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCML  160
                 PQPIP G  MRSTGYTHDGPCEVWLD   VL  DNCHE FPGK Y +DYSSCKG+C L
Sbjct  267289  GTPQPIPAGDAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCKGTCTL  267468

Query  161     RWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               RWYWLG RFLKN++SWQVYKACIPL+ S 
Sbjct  267469  RWYWLGIRFLKNKYSWQVYKACIPLAGSG  267555

 Score = 127 bits (318),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQ+VLLP P +TT +KDTKY PLAFLE+QGFK  +DF  WR  NGYK+LR FMD AKY
Sbjct  267036  DAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRAKY  267215

Query  86      TVTDGADYYCGFTNAKAAPQPIPDG  110
                VT GAD+ CGFT+ K  PQPIP G
Sbjct  267216  DVTSGADFSCGFTDPKGTPQPIPAG  267290

>PLHA:NW_020189073.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2165, whole genome shotgun sequence
Length=94632

 Score = 219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 121/165 (73%), Gaps = 1/165 (1%)
 Frame = +1

Query  27     AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
              AHQ++LLP P + T++KDTKY PLAFLE+Q F T  DF G+ + N Y +LR F+  A YT
Sbjct  34615  AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRANYT  34794

Query  87     VTDGADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
              VT+GAD  CGFT+    PQPIP G  MR TGYTHDG CE+WLD T+VL   NCH  FPGK
Sbjct  34795  VTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGK  34974

Query  146    TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
                 +DYSSCK +C++ WYWL  R LKNE+SWQVYKACIPL+ S +
Sbjct  34975  DCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  35109

>PHSO:scaffold_4
Length=7609242

 Score = 214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = -3

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
                DAHQ+VL P P +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KY
Sbjct  4374352  DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKY  4374173

Query  86       TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                TVT GAD+ CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    
Sbjct  4374172  TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  4373993

Query  145      KTYNLDYSSCKGSCMLRWYW  164
                K Y +DYS+CKG+C LRWYW
Sbjct  4373992  KGYTIDYSACKGTCTLRWYW  4373933

 Score = 214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
                DAHQ+VL P P +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KY
Sbjct  4364941  DAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKY  4365120

Query  86       TVTDGADYYCGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                TVT GAD+ CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    
Sbjct  4365121  TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  4365300

Query  145      KTYNLDYSSCKGSCMLRWYW  164
                K Y +DYS+CKG+C LRWYW
Sbjct  4365301  KGYTIDYSACKGTCTLRWYW  4365360

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 15/107 (14%)
 Frame = -3

Query  65       NGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRSTGYTHDGP  122
                N  RR    K     +DG   ++ D A   C FTN    PQPIP     + S G  H G 
Sbjct  2631799  NAPRRPTSAKNPEPMLDG--MSLYDAA---CSFTNRNGTPQPIPTNANAIFSHGLIHTGS  2631635

Query  123      CEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLR  161
                CE  L   ++L +D+C+  +     N      +DY SC+ G C M+R
Sbjct  2631634  CEF*LGDKKLLYADDCYSEYSHMNVNVKTESSIDYLSCENGGCKMMR  2631494

>PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.16, whole genome shotgun 
sequence
Length=1156373

 Score = 212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 7/169 (4%)
 Frame = +2

Query  26      DAHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83
               DAHQ++L P P +    +++DT++ PLAFLESQGF    DFNGWR  +GYK LR FMD A
Sbjct  488756  DAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRA  488935

Query  84      KYT--VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
               KYT  VT GAD  CG T  K  P+PIP DG M+STGYTHDGPC V+LD   VL+ DNCHE
Sbjct  488936  KYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHE  489115

Query  141     TFPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                 PGK+Y +DYSSC  KG C L W+WLG RF+K+  SWQVYK C+PL++
Sbjct  489116  KLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  489262

>PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 
genomic scaffold, whole genome shotgun sequence
Length=2518706

 Score = 208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 122/168 (73%), Gaps = 7/168 (4%)
 Frame = -2

Query  27       AHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK  84
                AHQ++  P P +    +++DT++ PLAFLESQGF   EDFNGWR  NGYK LR FMD AK
Sbjct  1575781  AHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAK  1575602

Query  85       Y--TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  141
                Y  +VT GAD  CG T  K  P+PIP DG MRSTGYTHDGPC ++LD   V++ DNCHE+
Sbjct  1575601  YVTSVTPGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHES  1575422

Query  142      FPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                 PG+TY +D+SSC  KG C L W+WLG RF+K+  SWQVYK CI L++
Sbjct  1575421  IPGRTYKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLTA  1575278

 Score = 135 bits (340),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 5/119 (4%)
 Frame = -3

Query  74       KTLRAFMDGAKY--TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDST  130
                +T   FMD AKY  +VT GA   CG T  K +P+PIP DG + STGYTHDGPC  +LD  
Sbjct  1594365  RTCVNFMDRAKYVTSVTSGAHQTCGLTEVKGSPRPIPKDGMVTSTGYTHDGPCAFYLDDV  1594186

Query  131      RVLQSDNCHETFPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                 VL+  NCHE+   +T+ +D+SSC  KG C L W+WLG RF+K+  SWQVYK CIPL++
Sbjct  1594185  LVLEYPNCHESITSRTHKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECIPLTA  1594009

 Score = 65.5 bits (158),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -2

Query  27       AHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAF  79
                AHQ++  P P +     ++DT++ PLAFLESQGF   EDFNGWR  NGYK LR  
Sbjct  1594513  AHQLIQQPEPIWKPGISDRDTRWNPLAFLESQGFPCQEDFNGWRAKNGYKDLREL  1594349

 Score = 118 bits (296),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = -1

Query  86       TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                +VT GAD  CG T  K  P+PI  DG + STGYTHDGPC  +LD   V++ DNCHE+   
Sbjct  1596299  SVTPGADQTCGLTEVKGPPRPISKDGMVTSTGYTHDGPCAFYLDDVLVMEYDNCHESITS  1596120

Query  145      KTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                +T+ +D+SSC  KG   L W+WLG RF+K+  S Q YK CIPL++
Sbjct  1596119  RTHKIDFSSCQKKGGGTLYWFWLGIRFVKSRWSRQAYKECIPLTA  1595985

 Score = 71.2 bits (173),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -3

Query  26       DAHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
                DAHQV+L P P +     ++DT++  LAFLESQGF   EDF+GWR  NGYK LR FMD
Sbjct  1596480  DAHQVMLKPEPIWKPGISDRDTRWRLLAFLESQGFPCQEDFDGWRAKNGYKDLRDFMD  1596307

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
               +AHQ+VL+P PTY  + K  ++ PLAFLE Q F T  DFN +  +N Y +LRAFM+ +  
Sbjct  110459  EAHQLVLIPKPTYIIEGKQNQWNPLAFLEDQSFPTTADFNAYLTANKYTSLRAFMNNSTL  110638

Query  85      YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               YTV   A++ CGFT      QPIP +G MR TGYTHDGPCE W++ T+V   +NCH   P
Sbjct  110639  YTVNASANFGCGFTKLDGERQPIPTNGQMRLTGYTHDGPCETWMNDTKVFAGENCHTELP  110818

Query  144     GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                 +Y++DYS+CKGSC+LR YW+G R++KNE+SWQVYKAC PL S
Sbjct  110819  SISYSMDYSACKGSCILRRYWMGIRYVKNEYSWQVYKACTPLDS  110950

 Score = 197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 2/162 (1%)
 Frame = +2

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
               AHQ ++ P P +  D +D ++ PLAFLE+Q   T  DF G+ +  GY  LRA MD  K Y
Sbjct  107045  AHQKLIYPEPFFLVDGQDMQWQPLAFLENQKINTSADFAGFLKQKGYANLRAMMDDEKLY  107224

Query  86      TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
                V   A + CG+T+     QPIP +G +RSTGYTHDGPCEVWLD  +V+  +NCH  FPG
Sbjct  107225  EVNLDALFDCGYTDPTYESQPIPTNGQIRSTGYTHDGPCEVWLDDVKVMSGENCHTEFPG  107404

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               KT+ +DYS+CKGSC LRWYW+G RFLKN+ SWQVYK C+ LS
Sbjct  107405  KTFKIDYSTCKGSCTLRWYWMGLRFLKNKWSWQVYKECVALS  107530

 Score = 179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 109/163 (67%), Gaps = 4/163 (2%)
 Frame = +2

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
               AHQ V +P P +T   K T +APL+FLE  G KT    +G+ +  GY TLRA MD +K Y
Sbjct  108800  AHQAVEVPKPNWTLPKKATYWAPLSFLEKNGVKTSASVDGFMKEKGYSTLRALMDDSKLY  108979

Query  86      TVTDGAD-YYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
                V   AD + CG+T+     Q IP D TMR+TGYTH GPCEVW+D+ RV+  DNCHE   
Sbjct  108980  KVNSNADNFLCGYTDPTKGSQVIPKDSTMRTTGYTHVGPCEVWIDNVRVIAGDNCHEQV-  109156

Query  144     GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                 T  +DYS+CKGSC +RWYWLG R+LK + SWQVYK CI L+
Sbjct  109157  SNTTKVDYSNCKGSCTMRWYWLGLRYLKKKWSWQVYKNCIALT  109285

>PHPA:scaffold_39 NW_008649025.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.39, whole genome shotgun 
sequence
Length=634653

 Score = 201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 122/172 (71%), Gaps = 6/172 (3%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +PAPT+T  N  +K     + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  149850  EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFM  150029

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               D AKY VT+GAD  CG+T+ K  PQ IP DGTMR+TGYTHDGPCE+++     L   NCH
Sbjct  150030  DRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  150209

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
               E+ P +T+ LDYS C  SC+L WYWLG R LK ++SWQVYK CIP+   A R
Sbjct  150210  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPIYK*ATR  150365

 Score = 199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = +3

Query  27      AHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
               AHQVV +P+PT+T  N  +      + PL+FLE +G+ T E+F  ++  NGYK+LR FMD
Sbjct  151035  AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  151214

Query  82      GAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
                AKY+VTDGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++  T  L   NCHE
Sbjct  151215  NAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  151394

Query  141     TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               +   +T+ LDYS+C  SC+L WYWLG R+LK ++SWQVYK CIPL S +
Sbjct  151395  SITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPLYSGS  151541

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 67/131 (51%), Gaps = 15/131 (11%)
 Frame = +2

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              K+V+ F   + +N +K L+  MD    T   GAD  CGFTN    PQPIP DG    S  
Sbjct  68774  KSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTNPNGTPQPIPTDGKATFSRA  68938

Query  117    YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSC-MLRWYWLGTR  168
                H GPC +WLD   VL  D+C   +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  68939  LVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQ  69118

Query  169    FLKNEHSWQVY  179
               L  +  WQ Y
Sbjct  69119  GLNKKTVWQSY  69151

>PHCA:scaffold_67 PHYCAscaffold_67
Length=292061

 Score = 201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 130/188 (69%), Gaps = 9/188 (5%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N  +K     + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  220856  EAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFM  220677

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               + AKY V+DGAD  CG+++ K  PQ IP DGTMR++GYTHDGPCE+W+     L   NCH
Sbjct  220676  EKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  220497

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL---SSSARRLEGAA  196
               E+ P +T+ LDYS C  SC+L WYWLG R LK ++SWQVYK CIPL   S+S   ++   
Sbjct  220496  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPLYK*STSD*TMQEVV  220317

Query  197     NESAAIEF  204
               +++ A+  
Sbjct  220316  HQAVALRL  220293

 Score = 196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDN-----KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N     +   + PL+FLE +G+ T E+F  ++  NGYK LR FM
Sbjct  219848  EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  219669

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               D AKY VTDGAD  CG+++    PQ IP DGTMR++GYTHDGPCE+W+     L   NCH
Sbjct  219668  DNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  219489

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               E+   +T+ LDYS C  SC+L WYWLG R+LK ++SWQVYK CIPL
Sbjct  219488  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  219351

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 69/131 (53%), Gaps = 15/131 (11%)
 Frame = +1

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
               ++V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  112504  QSVDTFKSLKAANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRA  112668

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSC-MLRWYWLGTR  168
                 H GPCE+WLD  +VL  D+C   +  K       + +DYSSC  G C  +R+YWL  +
Sbjct  112669  LVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQ  112848

Query  169     FLKNEHSWQVY  179
                L  +  WQ Y
Sbjct  112849  GLSKKTVWQSY  112881

>PHSO:scaffold_64
Length=40116

 Score = 196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = +3

Query  35     APTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY  94
              A  +TT++K+TKY PLAFLE+QGF T +DF  WR  NGYKTLR FMD  KYTVT GAD+ 
Sbjct  37920  AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  38099

Query  95     CGFTNAKAAPQPIPDG-TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSS  153
              CG+T+ K  PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE    K Y +DYS+
Sbjct  38100  CGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSA  38279

Query  154    CKGSCMLRWYW  164
              CKG+C LRWYW
Sbjct  38280  CKGTCTLRWYW  38312

>PHSO:scaffold_12
Length=2105860

 Score = 194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDN-----KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N     +   + PLAFLE+QGF+T  +F  ++  NGYK+LR FM
Sbjct  168914  EAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTQ*NFTQYQVDNGYKSLRDFM  168735

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               D AKYTVT+GAD  CG+T+ K   Q IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  168734  DNAKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  168555

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               E+   +T+ LDYS C  SC L WYWLG RFL N++SWQVYK CIP+ S +
Sbjct  168554  ESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPIYSGS  168405

 Score = 192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N         + PL+FLE +GFKT E+F  ++  NGYK+LR FM
Sbjct  167613  EAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFM  167434

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               + AKY +TDGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  167433  ERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  167254

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               E+   +T+ LDYS C  SC+L WYWLG R LK + SWQVYK CIPL
Sbjct  167253  ESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  167116

 Score = 175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 108/166 (65%), Gaps = 7/166 (4%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               DAHQVV +P PT+T  N  +      + PLAFLE QGF T  +F  +   NGYK+LR FM
Sbjct  162418  DAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFM  162239

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               D   Y+VT GAD  CG+T+    PQ IP DGTMR++G+THD PCE+++     L   NCH
Sbjct  162238  DNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCH  162059

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               E+   + + LDYS+C  SC+L WYWLG RF+K   S QVYK CIP+
Sbjct  162058  ESITSQPFKLDYSACGDSCVLYWYWLGVRFIKG-IS*QVYKECIPI  161924

 Score = 96.7 bits (239),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = -3

Query  101     KAAPQPIPD-GTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCM  159
               K +PQ IPD   MR+ GYT DGPCE+WLD+T    S +C  + P  TY LDYS C  SC+
Sbjct  210299  KRSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCV  210120

Query  160     LRWYWLGTRFLKNEHSWQVYKACIPL  185
               + WY LG       +SW+VYK CIPL
Sbjct  210119  MYWYTLGVAKPDRVYSWEVYKECIPL  210042

 Score = 80.1 bits (196),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = -1

Query  27      AHQVVLLPAPTYT-----TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
               A+QVV +PAPT+T     TD +   + PLA+ E QGF T  +F  W+ +NG+KTLR FMD
Sbjct  210535  ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  210356

Query  82      GAKYTVTDGADYYCGFTNAK  101
                  Y+VT GAD  CG+T+ K
Sbjct  210355  NGNYSVTSGAD*ACGWTDLK  210296

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 73/143 (51%), Gaps = 15/143 (10%)
 Frame = +2

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
              +V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  95189  SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  95353

Query  118    THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
               H GPCE+WLD  +VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  95354  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  95533

Query  170    LKNEHSWQVYKACIPLSSSARRL  192
              +  +  WQ Y   +   +S  RL
Sbjct  95534  VDGKTVWQSYSKFVVARNSMSRL  95602

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 68/130 (52%), Gaps = 15/130 (12%)
 Frame = +2

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
              +V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  97601  SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  97765

Query  118    THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
               H GPCE+WLD  +VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  97766  VHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  97945

Query  170    LKNEHSWQVY  179
              +  +  WQ Y
Sbjct  97946  VDGKTVWQSY  97975

>PYAP:scaffold_560 pag1_scaffold_560 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_560:1:21458:1 
REF
Length=21458

 Score = 194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 120/172 (70%), Gaps = 8/172 (5%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
             DAHQ V +PAPT+T ++++  + PLAFLE+QG K  +D  G+ RS G KTLR +MD  A 
Sbjct  8568  DAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKAN  8389

Query  85    YTV-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQS--DNCHE  140
             Y +   GA + CG+TN   A QPIP +G MRSTGYTHDGPCEVWLD+TRVL S   NCH 
Sbjct  8388  YKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHR  8209

Query  141   TFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEH-SWQVYKACIPLSSSA  189
                 K  +Y +D+S CKG+CMLRWYWLG R +  +  SWQ+YKAC+PL  S 
Sbjct  8208  DVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  8053

 Score = 183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 117/171 (68%), Gaps = 8/171 (5%)
 Frame = -1

Query  28     HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYT  86
              HQ + +PAPT TTD ++T   PLAFLE+QG K  +D  G+ R  G KTLR FMD  A Y 
Sbjct  11303  HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  11127

Query  87     V-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVL--QSDNCHETF  142
              V   GA + CG+T+   A QPIP +G MRSTGYTHDGPCEVWLD+TRVL   S +CH+  
Sbjct  11126  VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  10947

Query  143    PGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
                   +Y +D+S CKG+CMLRWYWL  R + ++ SWQVYK C+PL  SA R
Sbjct  10946  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAAR  10794

 Score = 180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 4/165 (2%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
              +AHQ V  P   YT  ++ T + P A LE+QG+KT +DFN +  +NGYKTLR FMD    
Sbjct  12575  EAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGA  12754

Query  85     YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
              Y    GA   CG+T+  A PQPIP +G  R++GYTH+GPCE+W+D   V    NCH    
Sbjct  12755  YKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDIS  12934

Query  144    GKTY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               K +   +DYS+CKG CML+WYWLG R +  ++SWQ+YKACIPL+
Sbjct  12935  EKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  13069

>PHIF:NW_003303754.1 Phytophthora infestans T30-4 supercont1.5 
genomic scaffold, whole genome shotgun sequence
Length=4768765

 Score = 192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 7/170 (4%)
 Frame = -1

Query  28       HQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
                HQ++L P P +    +++DT++ PLAFLESQGF    DFN WR  NGYK LR FMD   Y
Sbjct  3545335  HQLLLEPEPIWKAGINDRDTRWRPLAFLESQGFPCQADFNSWRAQNGYKNLRDFMDRGNY  3545156

Query  86       T--VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142
                T  VT GA+  CG T     P+PIP +G +RSTGY+H+GPC  +LD   V++ DNCHE  
Sbjct  3545155  TTTVTPGAN*TCGLTKLNGPPRPIPKNGVIRSTGYSHEGPCAAYLDDVLVMEFDNCHEKI  3544976

Query  143      PGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
                PGKT+ +DYSSC  KGSC L W+WLG RF+K+  SWQVYK C+PL++  +
Sbjct  3544975  PGKTHKIDYSSCEKKGSCTLYWFWLGIRFVKSRWSWQVYKECVPLTAQLQ  3544826

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 61/120 (51%), Gaps = 21/120 (18%)
 Frame = +3

Query  92       DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
                D  CG+T A   PQPIP DG ++       G+TH GPCE+++D   VL  D+C E FPG 
Sbjct  3740892  DKKCGYTRADVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEEEFPGG  3741071

Query  145      -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                           +D+SSC G C L  YWLG  FLK     +   +   L SS R+    AN
Sbjct  3741072  PNGSNKMSEMPVDFSSCNGKCTLTIYWLG--FLK-----RAVASVRQLRSSTRKWLSDAN  3741230

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 51/102 (50%), Gaps = 18/102 (18%)
 Frame = -2

Query  92       DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
                D  CG+T     PQPIP DG ++       G+TH GPCE+++D   VL  D+C   FPG 
Sbjct  3973404  DKKCGYTRTDVDPQPIPSDGKVKWWGNGGGGFTHTGPCELYIDDKMVLHGDDCEAEFPGG  3973225

Query  145      -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
                           +D+SSC G C L  YWL  +  +    WQ Y
Sbjct  3973224  PDGSNKMSEMPVDFSSCNGKCTLTIYWLAFQNTQ----WQSY  3973111

 Score = 52.0 bits (123),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 8/56 (14%)
 Frame = +2

Query  121      GPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRWYWLGTR  168
                GPCE+++D   VL SD+C   +PG            +DYSSC  SC+   YWLG +
Sbjct  3744944  GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNASCIFSIYWLGFQ  3745111

 Score = 30.8 bits (68),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (53%), Gaps = 6/36 (17%)
 Frame = +3

Query  90       GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTH  119
                G D  CGFT  +  PQPIP DG  +       G+TH
Sbjct  3744774  GPDKKCGFTTTEVEPQPIPTDGKAKWLGNDGGGFTH  3744881

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 40/83 (48%), Gaps = 14/83 (17%)
 Frame = +2

Query  95       CGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
                CG T      QP+P D T++       G+TH GPCE++LD   VL  D+C + + G    
Sbjct  3872540  CGNTLENGDAQPVPSDATVKWLGNGGGGFTHTGPCEIYLDDKMVLHGDDCEDEYKGGAVG  3872719

Query  149      --------LDYSSCKGSCMLRWY  163
                        +D+SSC G C   W 
Sbjct  3872720  STQTSDMPVDFSSCNGKCDAPWL  3872788

>PHKE:scaffold_354 scf_22126_354.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_354.1_contig_1:1:38044:1 
REF
Length=38044

 Score = 191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 116/166 (70%), Gaps = 6/166 (4%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
              +AHQVV +P+PT+T  N  +K     + PL+FLE +G KT E+F  ++  N Y +LR FM
Sbjct  14311  EAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFM  14490

Query  81     DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
              D AKY V+DGAD  CG+T+ K  PQ IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  14491  DKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  14670

Query  140    ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              E+   +T+ LDYS+C  SC+L WYWLG R LK  +SWQ+YK CIPL
Sbjct  14671  ESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  14808

>PHRA:scaffold_33
Length=496317

 Score = 189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 121/180 (67%), Gaps = 6/180 (3%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N  +      + PL+FLE +GF+T E+F  ++  NGY +LR F+
Sbjct  370570  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  370749

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
               D AKY V+DGAD  CG+++ K  PQ IP DGTMR++GYTHDGPCE+++     L   NCH
Sbjct  370750  DKAKYKVSDGADQACGWSDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  370929

Query  140     ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
               E+   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CIPL S +        ES
Sbjct  370930  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKGSYSWQVYKECIPLYSGSGGASTPTTES  371109

 Score = 73.6 bits (179),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  137     NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               NCHE+   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L S +
Sbjct  175562  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGS  175404

 Score = 73.6 bits (179),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  137     NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               NCHE+   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L S +
Sbjct  171203  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYSGS  171045

 Score = 72.8 bits (177),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N  +      + PL+FLE +GF+T E+F  ++  NGY +LR F+
Sbjct  175911  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  175732

Query  81      DGAKYTVTDGADYYCGFTN  99
               D AKY V+DGAD  C +++
Sbjct  175731  DKAKYKVSDGADQACWWSD  175675

 Score = 72.8 bits (177),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 5/79 (6%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               +AHQVV +P+PT+T  N  +      + PL+FLE +GF+T E+F  ++  NGY +LR F+
Sbjct  171552  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  171373

Query  81      DGAKYTVTDGADYYCGFTN  99
               D AKY V+DGAD  C +++
Sbjct  171372  DKAKYKVSDGADQACWWSD  171316

 Score = 40.8 bits (94),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 1/25 (4%)
 Frame = -3

Query  104     PQPIP-DGTMRSTGYTHDGPCEVWL  127
               PQ IP DGTM  +GYTHDGPCE+++
Sbjct  175663  PQQIPEDGTMSPSGYTHDGPCEIYM  175589

 Score = 40.8 bits (94),  Expect(3) = 5e-34, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 1/25 (4%)
 Frame = -3

Query  104     PQPIP-DGTMRSTGYTHDGPCEVWL  127
               PQ IP DGTM  +GYTHDGPCE+++
Sbjct  171304  PQQIPEDGTMSPSGYTHDGPCEIYM  171230

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 15/144 (10%)
 Frame = -2

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
               ++V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  430850  QSVDTFKSLKTANNFKDLKTLMDD---TSVYGAD--CGFTDPDGTPQPIPTDGKATFSRA  430686

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSCK-GSC-MLRWYWLGTR  168
                 H GPCE+WLD T+VL  D+C   +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  430685  LVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQ  430506

Query  169     FLKNEHSWQVYKACIPLSSSARRL  192
                L ++  WQ Y     L   A R 
Sbjct  430505  GLDSKTVWQSYSKLFGLGMPAFRF  430434

>PYAR:scaffold_3459 par_scaffold_3459 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3459:1:3265:1 
REF
Length=3265

 Score = 186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 4/165 (2%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AK  84
             +AHQ V LP   YT  N++T + P A LE QG+KT  DFN + ++N YKTLR FMD    
Sbjct  2071  EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  2250

Query  85    YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
             Y    GA + CGFT+ KA  QPIP DG  R++GYTH+GPCE+W+D  RV   DNCH    
Sbjct  2251  YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  2430

Query  144   GKTY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                +   +DYS+CKG+CML+WYWLG R     +SWQ+YKACIPLS
Sbjct  2431  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  2565

>PHSO:scaffold_11
Length=2192408

 Score = 158 bits (399),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 80/104 (77%), Gaps = 4/104 (4%)
 Frame = -3

Query  40       TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN  99
                 ++KDTKY PLAFLE QGF T E F+  RR NGYKTLR FMD  KYTVT GADY+CG+TN
Sbjct  2022897  VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTN  2022718

Query  100      AKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
                 K  PQPIP    RSTGYTHDGPCE+WLD  RVL+S NCHET P
Sbjct  2022717  PKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLESGNCHETIP  2022598

 Score = 70.5 bits (171),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -1

Query  148      NLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLE  193
                 +DYSSC  KG C + WYWLG RFLKN +SWQVYK CIPL+++ +RL 
Sbjct  2022596  TIDYSSCEKKGGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAAPKRLR  2022453

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 49/92 (53%), Gaps = 13/92 (14%)
 Frame = -2

Query  82      GAKYTVTD-GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQ  134
               G K  V D   D  CG T A A+PQP+P DG ++       G+TH GPCEV++D   V+ 
Sbjct  645133  GVKDVVLDMTKDKKCGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVH  644954

Query  135     SDNCHETFPGKTYN------LDYSSCKGSCML  160
                DNC + F G          +DYSSC G C L
Sbjct  644953  GDNCEDEFQGGGVGSTLDNPVDYSSCNGKCTL  644858

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 63/134 (47%), Gaps = 22/134 (16%)
 Frame = +1

Query  72      GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM----RSTGYT-HDGPCEVW  126
               GY +LR  +D     V D     C  T    +P  +   T+       G T H GPCEVW
Sbjct  989584  GYSSLRDMLD---QQVAD-----CANTRIDVSPVDVAGLTVVTWENGNGITSHRGPCEVW  989739

Query  127     LDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               +D   V   D+C  T+   T      ++S C G C LR+YWL      +E  WQ+YK C+
Sbjct  989740  VDDIVVNHQDDCVATYGAGTQIKVPANFSKCLGDCTLRFYWLAL----HEPKWQIYKQCV  989907

Query  184     PL--SSSARRLEGA  195
               P+  +S AR L  A
Sbjct  989908  PIVNNSGARALRTA  989949

 Score = 55.8 bits (133),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 37/70 (53%), Gaps = 7/70 (10%)
 Frame = -1

Query  82      GAKYTVTDGA-DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQ  134
               G K  V D   D  CG T    A QPIP DG ++       G+TH GPCE++LD   VL 
Sbjct  471062  GVKDVVLDMVKDQKCGNTLDNGAAQPIPSDGKVKWLGNGGGGFTHVGPCEIYLDDKMVLH  470883

Query  135     SDNCHETFPG  144
                DNC + F G
Sbjct  470882  GDNCEDEFKG  470853

 Score = 30.4 bits (67),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 19/38 (50%), Gaps = 4/38 (11%)
 Frame = -2

Query  151     YSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
               YSSC G C L  YWL     +N   WQ Y   +P S S
Sbjct  470821  YSSCNGDCTLTIYWLA---FQNAQ-WQAYGKFVPTSIS  470720

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 8/58 (14%)
 Frame = -1

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPG------KTYNL--DYSSCKGSCMLRWYWL  165
               G+TH GPCEV++D   V   DNC + F G      +T ++  DYSSC G C L  YWL
Sbjct  498995  GFTHVGPCEVYIDDKMVAHGDNCEDEFKGGDVGSKETSDIPADYSSCNGKCTLTMYWL  498822

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 39/80 (49%), Gaps = 10/80 (13%)
 Frame = -1

Query  100     AKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSS  153
                   PQ IP DG  +     S G+TH GPCE+++D+T VL  DNC + +PG     D   
Sbjct  500504  GDGTPQAIPTDGMAKWLGNGSGGFTHVGPCEIYIDNTMVLHGDNCEDEYPGG----DVGD  500337

Query  154     CKGSCMLRWYWLGTRFLKNE  173
               C      R + +  R   ++
Sbjct  500336  CHVGHAHRLFVVQRRLHADD  500277

 Score = 32.0 bits (71),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 24/55 (44%), Gaps = 9/55 (16%)
 Frame = -2

Query  129     STRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               S RV  S       P     +DYSSC G C L  YWL     +NE   QVY  C 
Sbjct  500362  SIRVATSATVTSDMP-----IDYSSCNGDCTLTIYWLA---FQNEQ-*QVYSKCF  500225

>PYIW:scaffold_711 piw_scaffold_711 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_711:1:15030:1 
REF
Length=15030

 Score = 181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 4/164 (2%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
             DAHQ V +P P +T   K T +APL+FLE  G KT E  +G+ +  GY TLRA MD +K 
Sbjct  5173  DAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKL  5352

Query  85    YTVTDGAD-YYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142
             Y     AD + CG+T+     Q IP D TMR+TGYTH GPCEVW+D  RV+  DNCHE  
Sbjct  5353  YKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQV  5532

Query  143   PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                T  +DYS+CKG C +RWYWLG R+LK + SWQVYK CI L+
Sbjct  5533  SNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  5661

 Score = 135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 93/163 (57%), Gaps = 3/163 (2%)
 Frame = +2

Query  27     AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-Y  85
              A+  V  P P +  D      A +A LE Q   T  D  G+ +  GY +LRA +D    Y
Sbjct  10781  ANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLY  10960

Query  86     TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               V   + + CG+T+     QPIP +G +R TGY  DGPCE+W+D  ++L S NC + FPG
Sbjct  10961  DVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  11140

Query  145    KTYNLDYSSCKGSCMLRWYWLG-TRFLKNEHSWQVYKACIPLS  186
               +  LDYSSCKG C LRWY L  ++     +SW+VYK C+ LS
Sbjct  11141  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  11269

 Score = 113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ V LPAPT+T   +  ++ PLAFLE QG+K   DF  + +S GYK LR FMD  K 
Sbjct  3555  DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKA  3734

Query  86    TVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGP  122
                DG ++ CG+++ K  PQPIP  G +RSTGYTHDGP
Sbjct  3735  YKVDGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  3848

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
             DAHQ VLLP PT+T   +  ++ PLAFLE+QGFKT  DF  + R  GYKTLR FMD    
Sbjct  1048  DAHQYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTA  1227

Query  86    TVTDGADYYCGFTNAKAAPQPIP  108
                DG D+ CG++  K  PQPIP
Sbjct  1228  YKVDGGDFECGWSTLKGTPQPIP  1296

>PYIR:scaffold_4828 pir_scaffold_4828 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4828:1:781:1 
REF
Length=781

 Score = 166 bits (421),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 105/164 (64%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQ-GFKTVEDFNGWRRSNGYKTLRAFMDGAK-  84
            AHQ+V+LP PT+T + K  ++ P+A+LE Q GF    DFNG+  S G+KT+R FMD  K 
Sbjct  117  AHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKL  296

Query  85   YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH-ETF  142
            Y     AD+ CG+T     PQPIP +  +R+TGYTH+GPCE+WLD  +V    NCH +  
Sbjct  297  YRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVA  476

Query  143  PGKTYN-LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             G  +  LD+SSC G C + WYW+G R      SWQ+YK CIPL
Sbjct  477  SGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  608

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 2/163 (1%)
 Frame = -2

Query  29       QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
                QVVL PAP Y  D  D +   LA+LE QG  T  +   W + + Y +LRA +D    Y V
Sbjct  1847006  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYKV  1846827

Query  88       TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
                T+ A + CG T+ K   QPIP + +  ++GYT DGPCEVWL++T V+   NC+  FP   
Sbjct  1846826  TEEAIFECGLTSPKTETQPIPTNNSFVTSGYTLDGPCEVWLNNTMVITGRNCYTEFPNGH  1846647

Query  147      YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                + +DYS C  SC L WYWLG ++++  +SWQVYK CI L + +
Sbjct  1846646  HQVDYSLCGNSCKLVWYWLGIKYVEGIYSWQVYKNCINLGNKS  1846518

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 100/160 (63%), Gaps = 3/160 (2%)
 Frame = +2

Query  29      QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87
               QVVL P+P +  D+   +   LA+L+ QG  T  +   W++ +GY +LRA +D  + Y V
Sbjct  161237  QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  161416

Query  88      TDGADYYCGFTNAKAAP-QPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               +  A + CGFT+  +   Q IP +GT+ S+GYT DGPCEVW D T+V    NC   FP  
Sbjct  161417  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  161596

Query  146     TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                + +DYSSC  SC LRWYWLG +++   +SWQVYK CI L
Sbjct  161597  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  161716

 Score = 30.0 bits (66),  Expect(2) = 1.4, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 3/24 (13%)
 Frame = -3

Query  166     GTRFLKNEHSWQVYKACIPLSSSA  189
               G+RF   E +WQVYK C+P+S+++
Sbjct  365176  GSRF---EVNWQVYKQCVPISNNS  365114

 Score = 23.1 bits (48),  Expect(2) = 1.4, Method: Compositional matrix adjust.
 Identities = 8/17 (47%), Positives = 10/17 (59%), Gaps = 0/17 (0%)
 Frame = -2

Query  150     DYSSCKGSCMLRWYWLG  166
               D+  C G C+L  YWL 
Sbjct  365219  DHFRCSGVCILHIYWLA  365169

>PHRA:scaffold_494
Length=11395

 Score = 98.6 bits (244),  Expect(3) = 3e-37, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -1

Query  50    LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-  108
             L+FLE +GF+T E+F  ++  NGY +LR F+D AKY V+DGAD  CG+++ K  PQ IP 
Sbjct  8560  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  8381

Query  109   DGTMRSTGYTHDGPCEVWLDST  130
             DGTM  +GYTHDGPCE+++ ++
Sbjct  8380  DGTMSPSGYTHDGPCEIYMGTS  8315

 Score = 73.2 bits (178),  Expect(3) = 3e-37, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  137   NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             NCHE+   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L
Sbjct  8297  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  8151

 Score = 26.6 bits (57),  Expect(3) = 3e-37, Method: Compositional matrix adjust.
 Identities = 9/14 (64%), Positives = 13/14 (93%), Gaps = 0/14 (0%)
 Frame = -2

Query  26    DAHQVVLLPAPTYT  39
             +AHQVV +P+PT+T
Sbjct  8619  EAHQVVCIPSPTWT  8578

>PHRA:scaffold_2892
Length=2014

 Score = 98.6 bits (244),  Expect(3) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -1

Query  50    LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-  108
             L+FLE +GF+T E+F  ++  NGY +LR F+D AKY V+DGAD  CG+++ K  PQ IP 
Sbjct  1924  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKGIPQQIPE  1745

Query  109   DGTMRSTGYTHDGPCEVWLDST  130
             DGTM  +GYTHDGPCE+++ ++
Sbjct  1744  DGTMSPSGYTHDGPCEIYMGTS  1679

 Score = 73.6 bits (179),  Expect(3) = 1e-36, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  137   NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             NCHE+   +T+ LDYS C  SC+L WYWLG R+LK  +SWQVYK CI L
Sbjct  1661  NCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  1515

 Score = 24.6 bits (52),  Expect(3) = 1e-36, Method: Compositional matrix adjust.
 Identities = 8/14 (57%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  26    DAHQVVLLPAPTYT  39
             + HQVV +P+PT+T
Sbjct  1983  EVHQVVCIPSPTWT  1942

>PHIF:NW_003303747.1 Phytophthora infestans T30-4 supercont1.12 
genomic scaffold, whole genome shotgun sequence
Length=3552875

 Score = 137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 6/127 (5%)
 Frame = -2

Query  26       DAHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
                +AHQVV +P+PT+T  N  +K     + PL+FLE +GFKT E+F  ++  NGYK+L  FM
Sbjct  2748895  EAHQVVNVPSPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLLDFM  2748716

Query  81       DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
                D AKY V+ GAD  CG+T+ K  PQ IP DGTMR+TGYTHDGPCE+++     L   NCH
Sbjct  2748715  DRAKYKVSKGADQACGWTDPKGIPQQIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  2748536

Query  140      ETFPGKT  146
                E+ P +T
Sbjct  2748535  ESIPEQT  2748515

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  130      TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                T  L S NCHE+   +T+ LDYS+C  +C+L WYWLG R+LK ++SWQVYK CI
Sbjct  2704658  TLALSSLNCHESITDQTFKLDYSACGDTCVLYWYWLGVRYLKKKYSWQVYKECI  2704497

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 7/86 (8%)
 Frame = -2

Query  59       KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
                K+V+ F   + +N +K LR  MD    T   GAD  CGFTN    PQPIP DG    S  
Sbjct  2828014  KSVDTFKSLKAANNFKDLRTLMDD---TSVYGAD--CGFTNPNDTPQPIPSDGKATFSRA  2827850

Query  117      YTHDGPCEVWLDSTRVLQSDNCHETF  142
                  H GPC +WLD   VL  D+C   +
Sbjct  2827849  LVHHGPCGIWLDDKMVLYEDDCFAKY  2827772

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -1

Query  145      KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                +T+ LDYS C  SC++ WYWLG R LK ++SWQVYK CIP+
Sbjct  2743298  QTFKLDYSGCGDSCIIYWYWLGVRKLKGKYSWQVYKECIPV  2743176

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 5/65 (8%)
 Frame = -1

Query  27       AHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
                AHQVV +P+PT+T  N  +K     + PL+FLE +   T E+F  ++  NGYK+LR FMD
Sbjct  2722874  AHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD  2722695

Query  82       GAKYT  86
                  +Y+
Sbjct  2722694  SPRYS  2722680

>PYAP:scaffold_182 pag1_scaffold_182 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_182:1:48098:1 
REF
Length=48098

 Score = 93.6 bits (231),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 6/73 (8%)
 Frame = +3

Query  122   PCEVWLDSTRVLQSD--NCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
             PCEVW+D+TRVL S   NCH++  G+   +Y +D+S CKG CM+RWYWLG R L  + SW
Sbjct  1740  PCEVWIDNTRVLGSKLGNCHKSI-GQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSW  1916

Query  177   QVYKACIPLSSSA  189
             QVYKACIP+ +S 
Sbjct  1917  QVYKACIPIRASG  1955

 Score = 55.1 bits (131),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = +1

Query  63    DFNGWRRSNGYKTLRAFMDG-AKYTV-TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTH  119
             D   +  S G KTLR FMD  A Y V   GA + CG T+     QPIP +G MRSTG+TH
Sbjct  1555  DLTSYFNSKGIKTLRHFMDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTH  1734

Query  120   DG  121
             DG
Sbjct  1735  DG  1740

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 66/115 (57%), Gaps = 16/115 (14%)
 Frame = +1

Query  69    RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP--DGTMRSTGYTHDGPCEVW  126
             + +G K LR+++D AK T        CG +    +P+PIP  +        TH GPCE W
Sbjct  4855  KQHGVKDLRSYID-AKIT-------ECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFW  5010

Query  127   LDSTRVLQSDNCHETFPGK-TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVY  179
             +D TRV Q+++C   F  K T  LDYS C G +C+LR+YWLG   L+N   WQVY
Sbjct  5011  IDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLG---LQNS-DWQVY  5163

>PHIF:NW_003304531.1 Phytophthora infestans T30-4 supercont1.4149 
genomic scaffold, whole genome shotgun sequence
Length=1472

 Score = 111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 6/107 (6%)
 Frame = -3

Query  27   AHQVVLLPAPTYTTDNKDTK-----YAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
            AHQVV +P+PT+T  N  +K     + PL+FLE +   T E+F  ++  NGYK+LR FMD
Sbjct  750  AHQVVYVPSPTWTRVNATSKERRVLWNPLSFLEKKEVTTQENFTQFQVDNGYKSLRDFMD  571

Query  82   GAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWL  127
              +Y VT+GAD  CG+++    PQ IP DGTMR++ YTHDGPCE+++
Sbjct  570  SPRYKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  430

>PYAP:scaffold_1129 pag1_scaffold_1129 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_1129:1:6613:1 
REF
Length=6613

 Score = 108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 85/149 (57%), Gaps = 13/149 (9%)
 Frame = +1

Query  58    FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
              +T   ++  R+ +G KTLRAF++ +K  V       CG TN  A  +PIP DG ++  +
Sbjct  3643  IRTGAQYDAVRKKHGVKTLRAFLE-SKGPV-------CGSTNPNAKRKPIPRDGLIKFGS  3798

Query  116   GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                H GPCE+W D+TRV    +C++ F   T + +DYS C+G C+LR+YWLG +      
Sbjct  3799  SMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGK  3972

Query  175   SWQVYKACIPLSSSARRLEGAANESAAIE  203
              WQ YK C+PL +  R LE   +E A  E
Sbjct  3973  RWQSYKNCVPLGNDKRMLEEGGDEVAETE  4059

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = -2

Query  109  DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLG  166
            DG ++  +   H GPCE+W D+TRV    +C + F   T + +DYS CKG+C+LR+YWLG
Sbjct  651  DGLIKFGSSMEHPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLG  472

Query  167  TRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
             +       WQ YK C+P+ +  R L    +E+
Sbjct  471  LQ--DGGKRWQSYKNCVPIGNGKRMLAEGDDEA  379

>PHRA:scaffold_105
Length=157074

 Score = 108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKY  85
               DAHQVVLLP P +TTD++DTKY PLAFLES+GF T EDF  WR  NGYK+LR FMD AKY
Sbjct  154874  DAHQVVLLPEPQWTTDDRDTKYNPLAFLESEGFTTQEDFASWRDENGYKSLRDFMDNAKY  154695

Query  86      TVTDGADY  93
               +VT+GAD+
Sbjct  154694  SVTNGADF  154671

>PYIR:scaffold_155 pir_scaffold_155 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_155:1:48358:1 
REF
Length=48358

 Score = 105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 30/179 (17%)
 Frame = -2

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----SQGFKTVEDFNGWRRSNGYKTLRAFM  80
             +AH  + +P   +    K TKY     +E        +K  ++F    +  G++TLR+++
Sbjct  2961  NAHGFIEVPKSEFV---KGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLRSYI  2791

Query  81    DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR--STGYTHDGPCEVWLDSTRVLQSDNC  138
             +        GA   CG TN  A+P+ IP  ++   S    H GPCE+WLD  RV+Q DNC
Sbjct  2790  EDK------GA--LCGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQDDNC  2635

Query  139   HETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY-KAC-------IPLSS  187
               TF  K  T+ +D+SSCKGSCMLRW+WLG +   +   WQVY K+C       IP++S
Sbjct  2634  EGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSCDSSPLCIIPIAS  2464

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 4/65 (6%)
 Frame = +2

Query  121   GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
             GPCE+WLD  RV+Q DNC  TF  K  T+ +D+SSCKGSCMLRW+WLG +   +   WQV
Sbjct  5909  GPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERWQV  6082

Query  179   YKACI  183
             Y   I
Sbjct  6083  YSKWI  6097

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 42/61 (69%), Gaps = 4/61 (7%)
 Frame = -1

Query  121  GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
            GPCE+WLD+ RV Q+DNC   F  K   + +D+SSCKG+CMLR++WLG +       WQV
Sbjct  535  GPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQGKRWQV  362

Query  179  Y  179
            Y
Sbjct  361  Y  359

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 71/173 (41%), Gaps = 27/173 (16%)
 Frame = -2

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKT-----LRAFMD  81
             AH  + LP P ++  +K    +PL  ++  G   +   +G   + G  T     ++AF  
Sbjct  7980  AHSQMTLPNPKFSDVSKAN--SPLGTVD--GPTVLPPPSGQSYAMGTDTNIKAYVQAFKA  7813

Query  82    GAKYT-----VTDG-------ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
               KYT     + D         D  CG T+   A QP+P       G  H GPCEVW D 
Sbjct  7812  QTKYTSLKQLIMDNYVEAGTIPDRACGLTDKTYA-QPLPAEVEWQAG-QHPGPCEVWCDD  7639

Query  130   TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
             T     D+C   +PG     D S C G  +L   +L     +    WQVY  C
Sbjct  7638  TLAFHDDDCATNYPGIKLPYDRSKCVGKKVLWSMFLAMHVPQ----WQVYMGC  7492

 Score = 35.8 bits (81),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 43/91 (47%), Gaps = 11/91 (12%)
 Frame = -3

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLE--SQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83
            DAH  V +P   +     +     + F    S  +K  ++F    +  G+ TLR++++  
Sbjct  917  DAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYIEN-  741

Query  84   KYTVTDGADYYCGFTNAKAAPQPIP-DGTMR  113
                  GA   CG TNAKA P+PIP DG + 
Sbjct  740  -----KGA--ICGKTNAKATPKPIPSDGKVH  669

>PHRA:scaffold_4
Length=963095

 Score = 103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 97/191 (51%), Gaps = 26/191 (14%)
 Frame = +3

Query  27      AHQVVLLPAPTYTTDNKD---TKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
               AH  +  PAPT+  +  +    + APL    + ES+G   +   F     +N YK L+  
Sbjct  235014  AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  235193

Query  80      MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
               MDG ++    G D  CGFT+    P  P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  235194  MDGPEF----GED--CGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  235355

Query  138     CHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               C   +   T         +DYS C  G C+LR+YWL  + L  +  WQ YK CIPL+  A
Sbjct  235356  CQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLTGPA  235535

Query  190     RRLEGAANESA  200
                   G A+++A
Sbjct  235536  G---GGASQTA  235559

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 76/137 (55%), Gaps = 16/137 (12%)
 Frame = +3

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
               ++  + SNGY  +R  +D    T   GAD  CGFTN  A  +  P   D T  S G  H 
Sbjct  333120  YSSLKSSNGYSDIRTLLDSD--TSLYGAD--CGFTNPDATAKDPPTTGDATF-SRGMVHV  333284

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
               GPCE+WLD T+VL +DNC   +   T +       +DYSSC  S CMLR+YWL  + + +
Sbjct  333285  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  333464

Query  173     EHSWQVYKACIPLSSSA  189
                  WQVYK C+PL+  A
Sbjct  333465  SMVWQVYKNCVPLTGPA  333515

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 73/133 (55%), Gaps = 14/133 (11%)
 Frame = +3

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDG  121
               + G + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H G
Sbjct  331365  YTGLKSSNGYSDIRTLLDSD--TSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVG  331532

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNE  173
               PCE+WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +E
Sbjct  331533  PCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSE  331712

Query  174     HSWQVYKACIPLS  186
                 WQVYK C+PL+
Sbjct  331713  IVWQVYKDCVPLT  331751

 Score = 94.4 bits (233),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 76/137 (55%), Gaps = 16/137 (12%)
 Frame = +2

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
               ++  ++SNGY  +R  +D    T   GA+  CGFTN  A  +  P   D T  S G  H 
Sbjct  239771  YSSLKKSNGYSDIRTLLDSD--TTLYGAN--CGFTNPDATAKDPPTTGDATF-SRGMVHA  239935

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
               GPCE+WLD T VL +D+C   +   +         +DYSSC  S CMLR+YWL  + + +
Sbjct  239936  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  240115

Query  173     EHSWQVYKACIPLSSSA  189
               +  WQVYK C+PL+  A
Sbjct  240116  KTVWQVYKDCVPLTGPA  240166

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 16/133 (12%)
 Frame = +2

Query  68      RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
               + SN  K +R  +D    T   GA+  CG+TN  A+P+  P   D T  S G  H GPCE
Sbjct  236621  KASNNAKDIRTLLDSD--TTLYGAN--CGYTNPDASPKDPPSTGDATF-SRGIVHAGPCE  236785

Query  125     VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSW  176
               +WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  W
Sbjct  236786  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  236965

Query  177     QVYKACIPLSSSA  189
               QVYK CIPLS  A
Sbjct  236966  QVYKNCIPLSGPA  237004

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 16/133 (12%)
 Frame = +2

Query  68      RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
               + SN  K +R  +D    T   GAD  CGFT+ KA P+  P   D T  S G  H GPCE
Sbjct  238238  KASNNIKDIRTMIDSD--TKLYGAD--CGFTDPKATPKDPPSTGDATF-SRGMVHAGPCE  238402

Query  125     VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSW  176
               VWLD   VLQ+D+C   +   T         +DYSSC  G CM R++WL  +   ++  W
Sbjct  238403  VWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWW  238582

Query  177     QVYKACIPLSSSA  189
               QVYK C+PLS  A
Sbjct  238583  QVYKNCVPLSGPA  238621

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 49/102 (48%), Gaps = 20/102 (20%)
 Frame = -3

Query  87      VTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               V +    YCG +N   A             +   GPCE+WLD T VL  D+C +TF    
Sbjct  230478  VMEHGTKYCGESNVIVA-----------FFFCRQGPCEIWLDDTMVLHDDDCAKTFGTAD  230332

Query  147     YN--------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
               Y         +DYSSC  S CMLR+YWL  +   + + WQ+Y
Sbjct  230331  YATMKSVLKPIDYSSCSASGCMLRFYWLAFQGSNDGYVWQIY  230206

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 10/71 (14%)
 Frame = -2

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTR-FL  170
               GPCE+WLD T VL +D+C + F  + Y         +DYSSC  S CM R+YWL  +   
Sbjct  228487  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGST  228308

Query  171     KNEHSWQVYKA  181
                 ++ WQ+Y A
Sbjct  228307  SGKYVWQIYSA  228275

>PYAP:scaffold_216 pag1_scaffold_216 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_216:1:44217:1 
REF
Length=44217

 Score = 103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 89/166 (54%), Gaps = 16/166 (10%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLE---SQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
              D H  V L  P        +K + +A  +   S  FKT   +       G+K LR+F++ 
Sbjct  25517  DVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFLED  25696

Query  83     AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHE  140
                 T        CG +   A+P+PIP DGT++ ++   H GPCEVWLD+TR   +D+C +
Sbjct  25697  KGPT--------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDDCEK  25852

Query  141    TFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               F   T + +D+ +CKGSCMLR+YWLG +       WQ YK CIPL
Sbjct  25853  AFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  25984

 Score = 102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 79/151 (52%), Gaps = 13/151 (9%)
 Frame = -3

Query  57    GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-S  114
             GFKT   +    +  G K LR+F++             CG TN  A  +PIP DG ++  
Sbjct  2104  GFKTGAQYAAEAKKRGIKDLRSFLEDK--------GPLCGNTNPNAKAKPIPKDGLIKFK  1949

Query  115   TGYTHDGPCEVWLDSTRVLQSDNCHETF-PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
             +   H GPCE W+D+TRV Q+D+C +   P K   ++ S+CKG CMLR+YWLG +     
Sbjct  1948  STLEHAGPCEFWVDNTRVFQNDDCEKLLGPAKQVKVNLSACKGKCMLRFYWLGLQ--DGG  1775

Query  174   HSWQVYKACIPLSSSARRLEGAANESAAIEF  204
               WQ YK C+P+ SS  +      E    E+
Sbjct  1774  KRWQSYKNCVPMGSSGTKSRSIDAEDDGFEY  1682

 Score = 101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 91/181 (50%), Gaps = 21/181 (12%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLE-----SQGFKTVEDFNGWRRSNGYKTLRAFM  80
              DAH  V  P   +      TKY      E     S  F+T   ++  R+  G K LRAF+
Sbjct  34275  DAHTYVKSPLAEFKAG---TKYPSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLRAFL  34445

Query  81     DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNC  138
              +      + G +  CG TN  A  +PIP DG ++  +   H GPCEVW D+T V    +C
Sbjct  34446  E------SKGPE--CGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVFSEVDC  34601

Query  139    HETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
               + F   T + +DYS CKG+CMLR+YWLG +       WQ YK C+P+ S+ +     A 
Sbjct  34602  EKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGSATKSRSIDAE  34775

Query  198    E  198
              E
Sbjct  34776  E  34778

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 16/147 (11%)
 Frame = -1

Query  58    FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
             +KT   +    +  G K LR+F++ +K  V       CG TN  A  + IP DG ++  +
Sbjct  3693  YKTGAQYAAEAKKRGIKDLRSFLE-SKGPV-------CGNTNPNARAKAIPGDGMVKFQS  3538

Query  116   GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                H GPCE+WLD+TRV Q+D+C ++    T   +++S+CKG CM+R+YWLG +   +  
Sbjct  3537  TLEHPGPCEIWLDNTRVYQNDDCEKSLGQSTSVKVNFSACKGKCMMRFYWLGLQ--DSGT  3364

Query  175   SWQVYKACIPLSSS---ARRLEGAANE  198
              WQ YK CIPL  S   AR ++   +E
Sbjct  3363  RWQSYKNCIPLGGSGTKARSIDAEDDE  3283

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 80/138 (58%), Gaps = 14/138 (10%)
 Frame = -3

Query  58   FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
            FKT   +    +  G K LR+F++ +K  V       CG +   A  + IP DGT++ ++
Sbjct  763  FKTGAQYAAEAKKRGIKDLRSFLE-SKGPV-------CGNSLINAKAKAIPGDGTIKFAS  608

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTY-NLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               H GPCE+WLD+TRV Q+D+C + F   T   +++S+CKG C LR+YWLG +      
Sbjct  607  TLEHPGPCEIWLDNTRVFQNDDCEKKFGSATSTKINFSACKGKCTLRFYWLGLQ--DGGK  434

Query  175  SWQVYKACIPLSSSARRL  192
             WQ YK CIPL  S R+L
Sbjct  433  RWQSYKNCIPLGGS-RKL  383

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 69/134 (51%), Gaps = 14/134 (10%)
 Frame = +1

Query  58     FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRST  115
              FKT   +    +  G+K LR+F++             CG TN  A P+ +P  +  + S 
Sbjct  38176  FKTGAQYAVVAKDKGFKDLRSFLEDKGPA--------CGKTNPNAKPRNVPSDSKVVFSR  38331

Query  116    GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT--YNLDYSSCKGSCMLRWYWLGTRFLKNE  173
                 H GPCE+W+D T V  +D+C   F  K   + +D+SSCKG CMLR+YWLG +   + 
Sbjct  38332  PMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DSG  38505

Query  174    HSWQVYKACIPLSS  187
                WQ Y   I  SS
Sbjct  38506  KRWQSYSTYIAESS  38547

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 4/61 (7%)
 Frame = +2

Query  132    VLQSDNCHETFPGKT--YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
              V  +D+C   F   T  + +++S+CK  CMLR+YWLG +        Q YK CIPL+S  
Sbjct  23084  VYHNDDCKVAFGSSTPGFKVNFSACKNKCMLRFYWLGLQ--DKGQRMQSYKNCIPLASGT  23257

Query  190    R  190
              +
Sbjct  23258  K  23260

>PHIF:NW_003303753.1 Phytophthora infestans T30-4 supercont1.6 
genomic scaffold, whole genome shotgun sequence
Length=4722445

 Score = 103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 92/180 (51%), Gaps = 22/180 (12%)
 Frame = -3

Query  27       AHQVVLLPAPTYT---TDNKDTKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
                AH  +  PAP++    T+N   +  P     + ES+G + +   F      N +K +R+ 
Sbjct  3774500  AHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVRSL  3774321

Query  80       MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
                MDG      +     CGFT+ K  P +P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  3774320  MDGNPVFGEE-----CGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  3774156

Query  138      CHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                C   +   T         +DYSSC  G CMLR+YWL  + LK +  WQ YK CIPL+  A
Sbjct  3774155  CQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  3773976

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 73/132 (55%), Gaps = 14/132 (11%)
 Frame = -3

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
                + SN  K +R  +D    T   GAD  CG+TN   +P+ P  DGT   S G  H GPCE+
Sbjct  3772802  KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  3772635

Query  126      WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
                WLD   VLQ+D+C   +   T         +DYSSC  G CMLR+YWL  + L  +  WQ
Sbjct  3772634  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  3772455

Query  178      VYKACIPLSSSA  189
                VYK CIPLS  A
Sbjct  3772454  VYKNCIPLSGPA  3772419

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 18/130 (14%)
 Frame = -3

Query  68       RRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPC  123
                ++SN  K +R  +DG AK    D     CG T+ KA P+  P   D T  S G  H GPC
Sbjct  3770615  KKSNNIKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPTTGDATF-SRGIVHAGPC  3770454

Query  124      EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
                E+WLD   VLQ+D+C   +   T         +DYSSCK G CM R+YWL  +    +  
Sbjct  3770453  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTL  3770274

Query  176      WQVYKACIPL  185
                WQVYK CIPL
Sbjct  3770273  WQVYKNCIPL  3770244

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 53/112 (47%), Gaps = 10/112 (9%)
 Frame = -2

Query  95       CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT---YN  148
                CG T     PQP+P DG ++  S G +H GPCEVW D  RV    NC   F G+      
Sbjct  2171403  CGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDIRVFHDMNCAGKFAGEVPTKVP  2171224

Query  149      LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESA  200
                +D  +CK S  L +YWL          WQVY  C+ L  +      + N ++
Sbjct  2171223  IDMKTCKSSSELVFYWLALHV----QPWQVYINCVTLDGAGSPGSSSKNSTS  2171080

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = -1

Query  27       AHQVVLLPAPTYT--TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNG  72
                AHQ++  P P +    +++DT++ PLAFLESQGF   EDFNGWR  NG
Sbjct  2838211  AHQLIQQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNG  2838068

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query  95       CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
                CG T     PQP+P DG ++  S G +H GPCEVW D TRV    NC   F G+ 
Sbjct  2170712  CGNTKKNGTPQPLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDINCAGKFAGEV  2170876

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 36/68 (53%), Gaps = 9/68 (13%)
 Frame = +1

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTRFLK  171
                GPCE+WLD   VL  D+C + F    +         +DYSSC  S C+ R+YW+  +   
Sbjct  3795985  GPCEIWLDDKMVLHDDDCEKIFGTADHMTQKSILKPIDYSSCSASGCVYRFYWIAFQGSN  3796164

Query  172      NEHSWQVY  179
                N +  Q+Y
Sbjct  3796165  NGYVRQIY  3796188

 Score = 43.1 bits (100),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = -1

Query  149      LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                +DYS C  S CMLR+YWL  + + ++  WQVYK C+ L+
Sbjct  3570697  VDYSLCSTSGCMLRFYWLAFQGVDSDMVWQVYKDCVSLT  3570581

 Score = 26.2 bits (56),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 12/17 (71%), Gaps = 0/17 (0%)
 Frame = -3

Query  122      PCEVWLDSTRVLQSDNC  138
                P E+WLD T VL  D+C
Sbjct  3570791  PFEIWLDDTMVLSHDDC  3570741

 Score = 38.9 bits (89),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 0/27 (0%)
 Frame = +3

Query  160      LRWYWLGTRFLKNEHSWQVYKACIPLS  186
                LR+YWL  + L  +  WQVYK CIPLS
Sbjct  3736431  LRFYWLALQRLDGKTYWQVYKICIPLS  3736511

>PHCA:scaffold_93 PHYCAscaffold_93
Length=150113

 Score = 102 bits (255),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 71/133 (53%), Gaps = 15/133 (11%)
 Frame = -3

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDG  121
               F     SN YK +R+ MDG      D     CGFT+    P  P  DGT   S G  H G
Sbjct  144762  FKELAASNNYKDVRSMMDGNSVYGED-----CGFTDPNGTPVDPPTDGTATFSRGIVHAG  144598

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNE  173
               PCE+WLD   VLQ+D+C   +   T +       +DYSSC  G CMLR+YWLG + L  +
Sbjct  144597  PCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGK  144418

Query  174     HSWQVYKACIPLS  186
                 WQ YK CIPL+
Sbjct  144417  TVWQAYKNCIPLT  144379

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 91/180 (51%), Gaps = 22/180 (12%)
 Frame = +2

Query  27       AHQVVLLPAPTYT---TDNKDTKYAPL---AFLESQGFKTV-EDFNGWRRSNGYKTLRAF  79
                AH  +  PAP++    T++   +  P     + ES+G + +   F      N YK +R+ 
Sbjct  1014491  AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDVRSL  1014670

Query  80       MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
                MDG      D     CGFT+ K  P +P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  1014671  MDGNPVYGED-----CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  1014835

Query  138      CHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                C   +   T         +DYSSC  G CMLR+YWL  + L  +  WQ YK CIPL+  A
Sbjct  1014836  CQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  1015015

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 75/138 (54%), Gaps = 16/138 (12%)
 Frame = +2

Query  64       FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
                +   + SNGY  +RA +D      TD     CGFT+  A P+  P   D T  S G  H 
Sbjct  1020590  YTSLKESNGYSDIRALLDSD----TDLYGANCGFTDPDATPKDPPTTGDATF-SRGMVHA  1020754

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKN  172
                GPCE+WLD T VL +D+C   +   T +       +DYSSC  G CMLR+YWL  + + +
Sbjct  1020755  GPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDS  1020934

Query  173      EHSWQVYKACIPLSSSAR  190
                +  WQVYK C+PL+  A 
Sbjct  1020935  KMVWQVYKDCVPLTGPAE  1020988

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 71/132 (54%), Gaps = 14/132 (11%)
 Frame = +1

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
                + SN  K +R  +D    T   GAD  CG+TN    P+ P  DGT   S G  H GPCE+
Sbjct  1016170  KASNNAKDIRTLLDSD--TSLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  1016337

Query  126      WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
                WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  1016338  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  1016517

Query  178      VYKACIPLSSSA  189
                VYK CIPLS  A
Sbjct  1016518  VYKNCIPLSGPA  1016553

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 72/131 (55%), Gaps = 18/131 (14%)
 Frame = +3

Query  68       RRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPC  123
                ++SN  K +R  +DG AK    D     CG T+ KA P+  P   D T  S G  H GPC
Sbjct  1018410  KKSNNVKDIRTMIDGDAKLYGED-----CGNTDPKATPKDPPSTGDATF-SRGIVHAGPC  1018571

Query  124      EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
                E+WLD   VLQ+D+C   +   T         +DYSSCK G CM R+YWL  +   ++  
Sbjct  1018572  EIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  1018751

Query  176      WQVYKACIPLS  186
                WQVYK CIPLS
Sbjct  1018752  WQVYKNCIPLS  1018784

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +3

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDGPCEV  125
                + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H GPCE+
Sbjct  1068756  KSSNGYSDIRTLLDSD--TDLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  1068923

Query  126      WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQ  177
                WLD T VL +DNC   +   T +       +DYSSC  S CMLR+YWL  + + ++  WQ
Sbjct  1068924  WLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  1069103

Query  178      VYKACIPLSSSA  189
                VYK C+PL+  A
Sbjct  1069104  VYKDCVPLTGPA  1069139

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 20/135 (15%)
 Frame = -3

Query  58       FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY-CGFTNAKAAPQPIP-DGTMR--  113
                ++ V+D   W   N   +L+ F+       T G D   CG T  K   QP+P DG  +  
Sbjct  1529250  YQAVDD---WFTKNNVASLKEFI------TTYGTDISECGNTEKKGTAQPVPSDGYAQHD  1529098

Query  114      STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFL  170
                + G +H GPCE+W D TRV    NC  TF G++     +D S+CK S    +YWL     
Sbjct  1529097  TLGNSHPGPCEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVSTCKSSSEFVFYWLAL---  1528927

Query  171      KNEHSWQVYKACIPL  185
                 +   WQVY  C+ L
Sbjct  1528926  -HAQPWQVYINCVAL  1528885

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 49/101 (49%), Gaps = 10/101 (10%)
 Frame = -2

Query  95       CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT---YN  148
                CG T     P+ +P DG ++  S G +H GPCEVW D TRV    NC   F G+      
Sbjct  1507411  CGNTKKNGTPRQLPSDGYVKHDSLGNSHPGPCEVWCDDTRVFHDTNCAGKFAGQVPTKIP  1507232

Query  149      LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                +D  +CK S  L +YWL          WQVY  C+ L  + 
Sbjct  1507231  IDLKTCKSSSELVFYWLALHV----QPWQVYINCVTLDGAG  1507121

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (13%)
 Frame = -1

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTRFLK  171
                GPCE+WLD   VL  D+C +TF    Y         +DYSSC  S CM R+YW+  +   
Sbjct  1010297  GPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSD  1010118

Query  172      NEHSWQVYKA  181
                N +  Q+Y A
Sbjct  1010117  NGYVRQIYSA  1010088

>PHCA:scaffold_24 PHYCAscaffold_24
Length=787421

 Score = 102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 89/180 (49%), Gaps = 22/180 (12%)
 Frame = +1

Query  27      AHQVVLLPAPTYT---TDNKDTKYAPL---AFLESQGFK-TVEDFNGWRRSNGYKTLRAF  79
               AH  +  PAP++    T++   +  P     + ES+G    +  F      N YK +R  
Sbjct  167512  AHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKDVRTL  167691

Query  80      MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
               MDG      D     CGFT+ K  P  P  DGT   S G  H GPCE+WLD   VLQ+D+
Sbjct  167692  MDGNPVYGED-----CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDD  167856

Query  138     CHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               C   +   T         +DYSSC  G CMLR+YWL  + LK +  WQ YK CIPL+  A
Sbjct  167857  CQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  168036

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 70/132 (53%), Gaps = 14/132 (11%)
 Frame = +3

Query  68      RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
               + SN  K +R  +D    T   GAD  CG+TN    P+ P  DGT   S G  H GPCE+
Sbjct  169092  KASNNAKDIRTLLD--SDTKLYGAD--CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  169259

Query  126     WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
               WLD   VL +D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  169260  WLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  169439

Query  178     VYKACIPLSSSA  189
               VYK CIPLS  A
Sbjct  169440  VYKNCIPLSGPA  169475

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 72/137 (53%), Gaps = 16/137 (12%)
 Frame = +3

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
               +   + SNGY  +R  +D      TD     CGFT+     +  P   D T  S G  H 
Sbjct  171978  YASLKESNGYSDIRTLLDSD----TDLYGANCGFTDPDVTAKDPPTTGDATF-SRGMVHA  172142

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKN  172
               GPCE+WLD T+VL +D+C   +   T         +DYSSC  S CMLR+YWL  + + +
Sbjct  172143  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  172322

Query  173     EHSWQVYKACIPLSSSA  189
               +  WQVYK C+PL+  A
Sbjct  172323  KIVWQVYKDCVPLTGPA  172373

 Score = 89.4 bits (220),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 71/137 (52%), Gaps = 16/137 (12%)
 Frame = +1

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGY  117
               V  +   ++SN  K +R  +D        G D  CG T+ KA P+  P   D T  S G 
Sbjct  170569  VAMYKQLKKSNNVKDIRTMIDADPKLY--GED--CGNTDPKAKPKDPPSTGDATF-SRGI  170733

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRF  169
                H GPCE+WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + 
Sbjct  170734  VHAGPCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQR  170913

Query  170     LKNEHSWQVYKACIPLS  186
                 ++  WQVYK CIPL+
Sbjct  170914  RDSKTLWQVYKNCIPLT  170964

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 53/123 (43%), Gaps = 34/123 (28%)
 Frame = -1

Query  95      CGFTNAKA-APQPIPDGTMR-STGYTH----------------------DGPCEVWLDST  130
               CGF+N  A A  P  DGT     G  H                       GPCE+WLD  
Sbjct  161084  CGFSNPDAKAKDPPSDGTATFERGLAHHVSIGVLSGVLSGFFLNRHVRFQGPCEIWLDDA  160905

Query  131     RVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTR-FLKNEHSWQVYK  180
                VL +D+C + F    Y         +DYSSC  S CM R+YWL  +     ++ WQ+Y 
Sbjct  160904  MVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYS  160725

Query  181     ACI  183
               A I
Sbjct  160724  A*I  160716

 Score = 41.2 bits (95),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 23/100 (23%)
 Frame = -2

Query  69      RSNGY-KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTH------  119
               + NGY K +R  +D    T   GAD  CG+++  A P+ P  DGT   S G  H      
Sbjct  162688  KENGYDKDIRKLLDSD--TNLYGAD--CGYSDPNATPKTPPSDGTATFSRGIAHHVRGLS  162521

Query  120     ----------DGPCEVWLDSTRVLQSDNCHETFPGKTYNL  149
                          GPCE+W+     L  D+C +TF  + Y +
Sbjct  162520  PLCNLTYYLPQGPCEIWVGDKMALHDDDCAKTFGAEDYMI  162401

 Score = 30.4 bits (67),  Expect(2) = 7e-06, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = -1

Query  149     LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
               +DYSSC  S CM R+YWL  +   N +  Q+Y
Sbjct  162365  IDYSSCPSSGCMFRFYWLAFQGSDNGYV*QIY  162270

 Score = 36.6 bits (83),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 30/57 (53%), Gaps = 12/57 (21%)
 Frame = -3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTY--------NLDYSSC-KGSCMLRWYWLGTR  168
               GPC   LD T VL      ETF  + Y         +DYSSC  G CMLR+YWL ++
Sbjct  164190  GPC---LDDTMVLVR*RL*ETFGTEDYLKQKSVFKPVDYSSCASGGCMLRFYWLASQ  164029

>PHSO:scaffold_2
Length=11587142

 Score = 101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 71/136 (52%), Gaps = 15/136 (11%)
 Frame = +3

Query  64       FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDG  121
                F     +N YK +R+ MDG      D     CGFT+ K  P  P  DGT   S G  H G
Sbjct  2546232  FKELSAANNYKDVRSLMDGNPVYGED-----CGFTDPKGKPVAPPTDGTATFSRGIVHAG  2546396

Query  122      PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNE  173
                PCE+WLD   VLQ+D+C   +   T         +DYSSC  G CMLR+YWL  + L  +
Sbjct  2546397  PCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGK  2546576

Query  174      HSWQVYKACIPLSSSA  189
                  WQ YK CIPL+  A
Sbjct  2546577  TVWQAYKNCIPLTGPA  2546624

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +1

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
                + SN  K +R  +D    T   GA+  CG+TN  A P+ P  DGT   S G  H GPCE+
Sbjct  2550682  KDSNNAKDIRTLLDSD--TKLYGAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEI  2550849

Query  126      WLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQ  177
                WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  2550850  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  2551029

Query  178      VYKACIPLSSSA  189
                VYK CIPLS  A
Sbjct  2551030  VYKNCIPLSGPA  2551065

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 73/134 (54%), Gaps = 16/134 (12%)
 Frame = +3

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
                + SNGY  +R  +D    T   GAD  CGFTN  A+P+  P   D T  S    H  PCE
Sbjct  2559768  KESNGYSDIRTLLDSD--TSLYGAD--CGFTNPDASPKDPPTTGDPTF-SRCMVHASPCE  2559932

Query  125      VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
                +WLD T VL +D+C   +   T         +DYSSC  S CMLR+YWL  + + ++  W
Sbjct  2559933  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  2560112

Query  177      QVYKACIPLSSSAR  190
                QVYK C+PL+  A 
Sbjct  2560113  QVYKDCVPLTGPAE  2560154

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 71/133 (53%), Gaps = 16/133 (12%)
 Frame = +2

Query  68       RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
                +++N  K +R  +D    T   G D  CGFT+ K  PQ  P   D T  S G  H GPCE
Sbjct  2558297  KKANNVKDIRTMIDSD--TKLYGED--CGFTDPKGKPQDPPTTGDATF-SRGIVHAGPCE  2558461

Query  125      VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSW  176
                +WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  +   ++  W
Sbjct  2558462  IWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYW  2558641

Query  177      QVYKACIPLSSSA  189
                QVYK CIPL+  A
Sbjct  2558642  QVYKNCIPLTGPA  2558680

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 50/84 (60%), Gaps = 8/84 (10%)
 Frame = -3

Query  114      STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWL  165
                S G  H GPCE+WLD T VL +D+C   +   T         +DYSSC  S CMLR+YWL
Sbjct  2680080  SRGMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWL  2679901

Query  166      GTRFLKNEHSWQVYKACIPLSSSA  189
                  + + +E  WQVYK C+PL+  A
Sbjct  2679900  AFQGVDSEIVWQVYKDCVPLTGPA  2679829

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 74/165 (45%), Gaps = 44/165 (27%)
 Frame = -2

Query  69       RSNGYKT-LRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTH------  119
                ++ GY+  +R  +DG   T   GAD  CG+++  A+P+ P  DGT   S G  H      
Sbjct  2543572  KAEGYENNIRKLLDGD--TKLYGAD--CGYSDPNASPKDPSTDGTATFSRGIAHHVRMKM  2543405

Query  120      -------------------DGPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYS  152
                                    GPCE+WLD   +L  D+C ETF    Y         +DYS
Sbjct  2543404  N*P*ST*PGLPNLYMFISGQGPCEIWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYS  2543225

Query  153      SCKGS-CMLRWYWL---GTRFLKNEHSWQVYKACIPLSSSARRLE  193
                SC  + CML +YWL   G     +++ WQ+Y A   L     RL+
Sbjct  2543224  SCSANGCMLHFYWLAFQGRTTGNSKYVWQIYSAYPLLYPQRFRLK  2543090

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 49/107 (46%), Gaps = 15/107 (14%)
 Frame = +2

Query  65       NGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT--MRSTGYTHDGP  122
                N  RR    K     +DG   ++ D A   C FTN    PQPIP     + S G  H G 
Sbjct  1607564  NAPRRPTSAKNPEPMLDG--MSLYDAA---CSFTNRNGTPQPIPTNANAIFSHGLIHTGS  1607728

Query  123      CEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLR  161
                CE  L   ++L +D+C+  +     N      +DY SC+ G C M+R
Sbjct  1607729  CEF*LGDKKLLYADDCYSEYSHLNVNVKTESFIDYLSCENGGCKMMR  1607869

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (51%), Gaps = 10/69 (14%)
 Frame = +2

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCK---------GSCMLRWYWLGTR-FL  170
                GPCE+WLD T VL +D+C + F  + Y    S  K           CM R+YWL  +   
Sbjct  2541395  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPID*SSCSSSGCMFRFYWLAFQGST  2541574

Query  171      KNEHSWQVY  179
                  ++ WQ+Y
Sbjct  2541575  SGKYVWQIY  2541601

>PHIF:NW_003303391.1 Phytophthora infestans T30-4 supercont1.368 
genomic scaffold, whole genome shotgun sequence
Length=80461

 Score = 100 bits (248),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 61/91 (67%), Gaps = 1/91 (1%)
 Frame = -2

Query  57     GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRST  115
              G  T E+F  ++  NGYK+L  FMD AKY V+ GAD  CG+T+ K  PQ  P DGTMR+T
Sbjct  80460  GL*TQENFTQFQVDNGYKSLLDFMDRAKYKVSKGADQACGWTDPKGIPQQFPEDGTMRTT  80281

Query  116    GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
              GYTHDGPCE+++     L   NCHE+ P +T
Sbjct  80280  GYTHDGPCEIYMGEKLALSYLNCHESIPEQT  80188

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = -1

Query  85     YTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWL  127
              Y VT+GAD  CG+++    PQ IP DGTMR++ YTHDGPCE+++
Sbjct  40621  YKVTEGADQACGWSDPNGIPQQIPEDGTMRTSNYTHDGPCEIYM  40490

>PHRA:scaffold_9
Length=727265

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 73/134 (54%), Gaps = 16/134 (12%)
 Frame = +1

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHD  120
               +   + SNGY  +R  +D    T   GAD  CGFT+  A P+  P   D T  S G  H 
Sbjct  217975  YTSLKESNGYSDIRTLLDSD--TSLYGAD--CGFTDPNATPKDPPSTGDATF-SRGMVHA  218139

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKN  172
               GPCE+WLD T+VL +DNC   +   T         +DYSSC  G C LR+YWL  + L +
Sbjct  218140  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  218319

Query  173     EHSWQVYKACIPLS  186
                  WQVYK C+PL+
Sbjct  218320  STVWQVYKNCVPLT  218361

>PYIW:scaffold_7003 piw_scaffold_7003 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_7003:1:774:1 
REF
Length=774

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 14/126 (11%)
 Frame = +3

Query  58   FKTVEDFNGWRRSNGYKTLRAFMD--GAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST  115
            +K   +F    +  G++TLR++++  GAK   TD         NAKA   P  +    S 
Sbjct  150  WKDPANFAKVSKEKGFETLRSYIEDKGAKCGKTD--------PNAKAKAIPSDNVVKFSR  305

Query  116  GYTHDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
               H GPCE+W+D TRV+Q DNC +TF  K  T+ +D+S+CKG CMLRW+WLG +   + 
Sbjct  306  AIVHPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSG  479

Query  174  HSWQVY  179
              WQVY
Sbjct  480  KRWQVY  497

>PYAR:scaffold_88 par_scaffold_88 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_88:1:34485:1 
REF
Length=34485

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 76/137 (55%), Gaps = 13/137 (9%)
 Frame = +2

Query  58    FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
             FKT   +       G+K LR+F++    T        CG + + A P+PIP DG ++ ++
Sbjct  2411  FKTGAQYAAVAPGKGFKNLRSFLESKGPT--------CGNSLSSAKPKPIPSDGMVKFAS  2566

Query  116   GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                H GPCE+WLD T    SD+C + F   T   +++S+CKGSCMLR+YWLG +   +  
Sbjct  2567  TLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGT  2740

Query  175   SWQVYKACIPLSSSARR  191
              WQ YK C+PL     R
Sbjct  2741  RWQSYKNCVPLGGGKSR  2791

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 12/136 (9%)
 Frame = +2

Query  58    FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-STG  116
             F+T   +       G+K LRAF++    T        CG T   A P+P     ++ ++ 
Sbjct  3686  FRTGAQYAAVAPDKGFKNLRAFLEDKGPT--------CGNTLPNAKPKPXXXXLIKLAST  3841

Query  117   YTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
               H GPCE+WLD +     D+C + F   T + +D+S+CKGSCMLR+YWLG +   +   
Sbjct  3842  IEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKR  4015

Query  176   WQVYKACIPLSSSARR  191
             WQ YK CIPL  +  R
Sbjct  4016  WQSYKNCIPLGGAQSR  4063

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +2

Query  119  HDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
            H GPCE+WLD T V  +D+C + F   T   +++S+CKGSCMLR+YWLG     +   WQ
Sbjct  455  HPGPCEMWLDETMVFHNDDCKKEFGSSTSVKINFSACKGSCMLRFYWLG--LQDSGTRWQ  628

Query  178  VYKACIPL  185
             YK C+PL
Sbjct  629  SYKNCVPL  652

>PYUU:scaffold_2038 scf1117875582038 dna:supercontig supercontig:pug:scf1117875582038:1:913258:1 
REF
Length=913258

 Score = 97.4 bits (241),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 79/149 (53%), Gaps = 46/149 (31%)
 Frame = +1

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGYTHD---  120
               + +GYKTLR+F+D    T        CG+TN+KA P+ IP DG +     + G+TH    
Sbjct  601372  KKHGYKTLRSFLDNKGQT--------CGWTNSKATPKAIPADGKVVFQHVNAGFTHQVH*  601527

Query  121     ---------------------GPCEVWLDSTRVLQSDNCHETFPGKTYN-----LDYSSC  154
                                    GPCE+WLD+  VL +DNC + F GK        +D+SSC
Sbjct  601528  VVCCVSLKNIEVCTHTLNASQGPCEIWLDNKMVLHNDNCEKAFAGKGITESKMPVDFSSC  601707

Query  155     KGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               KGSCMLR+YWLG    +NE  WQVY A +
Sbjct  601708  KGSCMLRFYWLG---FQNEQ-WQVYSASL  601782

 Score = 40.0 bits (92),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 39/81 (48%), Gaps = 12/81 (15%)
 Frame = -3

Query  63      DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDG  121
                F    + +GYKTLR+F+D    T        CG+TN+KA P+ IP DG +    + H  
Sbjct  598382  QFAKLSKKHGYKTLRSFLDNKGQT--------CGWTNSKATPKAIPADGKVV---FQHVN  598236

Query  122     PCEVWLDSTRVLQSDNCHETF  142
                         +LQ++  H++ 
Sbjct  598235  AXXXXXXXFNILQTNAAHDSM  598173

 Score = 39.7 bits (91),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 13/57 (23%)
 Frame = -1

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM----RSTGYTHD  120
               + +GYKTLR+F+D    T        CG+TN+KA P+ IP DG +     + G+TH 
Sbjct  596008  KKHGYKTLRSFLDNKGQT--------CGWTNSKATPKAIPADGKVVFQHVNAGFTHQ  595862

 Score = 39.7 bits (91),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 13/57 (23%)
 Frame = +3

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM----RSTGYTHD  120
               + +GYKTLR+F+D    T        CG+TN+KA P+ IP DG +     + G+TH 
Sbjct  598023  KKHGYKTLRSFLDNKGQT--------CGWTNSKATPKAIPADGKVVFQHVNAGFTHQ  598169

>PHSO:scaffold_16
Length=803425

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 73/135 (54%), Gaps = 15/135 (11%)
 Frame = -3

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDG--TMRSTG  116
               K+V+ FN  + S+ YK LR  +D    T   G +  CG+TN    PQPIP     + S G
Sbjct  551519  KSVQVFNSLKTSHNYKDLRTLLDN---TAVYGPN--CGYTNPNGTPQPIPTNGKAIFSRG  551355

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSC--KGSCMLRWYWLGTR  168
                 H GPCE+WLD  +V+ +D+C+  +     N      +DYS C  KG CM+R+YWLG +
Sbjct  551354  LIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQ  551175

Query  169     FLKNEHSWQVYKACI  183
                L  +  WQ Y   +
Sbjct  551174  ALGKKTVWQTYSTLL  551130

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 16/136 (12%)
 Frame = -1

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG-TMRSTG  116
               K+VE F   + +N +K L+  +D       D     CGFT+    PQPIP DG  + S G
Sbjct  554128  KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  553964

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLRWYWLGTR  168
                 H GPCE WLD  +VL +D+C+  +     N      +DYSSC+ G C M+R+YWLG +
Sbjct  553963  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  553784

Query  169     FLKNEHS-WQVYKACI  183
                L ++ + WQ Y   +
Sbjct  553783  ALDDKKTVWQTYSTLL  553736

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 16/136 (12%)
 Frame = +2

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG-TMRSTG  116
               K+VE F   + +N +K L+  +D       D     CGFT+    PQPIP DG  + S G
Sbjct  557024  KSVEVFKSLKVANNFKDLKTMLDDTSLYGPD-----CGFTDPNGTPQPIPTDGKAVFSRG  557188

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCK-GSC-MLRWYWLGTR  168
                 H GPCE WLD  +VL +D+C+  +     N      +DYSSC+ G C M+R+YWLG +
Sbjct  557189  LIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQ  557368

Query  169     FLKNEHS-WQVYKACI  183
                L ++ + WQ Y   +
Sbjct  557369  ALDDKKTVWQTYSTLL  557416

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 70/133 (53%), Gaps = 19/133 (14%)
 Frame = -3

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADY--YCGFTNAKAAPQPIPDG--TMRS  114
               K+V+ FN  + S+ YK LR  +D       D + Y   CG+TN    P PIP     + S
Sbjct  543032  KSVQVFNSLKGSHNYKDLRTLLD-------DTSKYGPNCGYTNPNGTP*PIPTNGKAIFS  542874

Query  115     TGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSC--KGSCMLRWYWLG  166
                G  H GPCE+WLD+ +V+ +D+C+  +     N      +DYS C  KG CM+R+Y L 
Sbjct  542873  RGLIHTGPCEIWLDNKKVMAADDCYNRYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYCLA  542694

Query  167     TRFLKNEHSWQVY  179
                + L  +  WQ Y
Sbjct  542693  FQALGKKTVWQTY  542655

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 82/170 (48%), Gaps = 21/170 (12%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFL------ESQGFKTVEDFNGWRRSNGYKTLRAF  79
               DAH  +L+P   +T          +  +      +     +VE F   + +N +K L+  
Sbjct  521804  DAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLKTL  521983

Query  80      MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
               MD    T   G D  CGFT+    PQPIP DG    S    H GPCE+WLD+T+VL  D+
Sbjct  521984  MDD---TSVYGQD--CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYEDD  522148

Query  138     CHETFPGK------TYNLDYSSCK-GSCM-LRWYWLGTRFLKNEHSWQVY  179
               C   +  +       + +DYSSC  G C  +R+YWL  + L ++  WQ Y
Sbjct  522149  CFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSY  522298

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 71/130 (55%), Gaps = 15/130 (12%)
 Frame = -1

Query  60      TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
               +VE F  ++  N +K L+  MD    T   G D  CGFT+    PQPIP DG    S G 
Sbjct  524515  SVEVFTSFKSVNNFKDLKTLMDD---TSVYGQD--CGFTDPNGTPQPIPTDGKATFSRGL  524351

Query  118     THDGPCEVWLDSTRVLQSDNCHETF--PGK----TYNLDYSSC-KGSCM-LRWYWLGTRF  169
                H GPCE+WLD  +VL  D+C+  +  P +    T+ +DYSSC  G C  +R Y LG + 
Sbjct  524350  IHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQG  524171

Query  170     LKNEHSWQVY  179
               L ++  WQ Y
Sbjct  524170  LVDKTVWQSY  524141

>SADI:scaffold_134 supercont1.134 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.134:1:99377:1 
REF
Length=99377

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 90/189 (48%), Gaps = 23/189 (12%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKD-TKY-----APLAFLESQGFK----TVEDFNGWRRSNGYKT  75
              + H  ++ P PT+   N D TKY      P+    S   +        F    R++ ++T
Sbjct  58916  NGHGFLINPTPTFNELNGDRTKYCGTIDGPVVLPGSSYNQDPAWNTRQFTMQFRASKFQT  58737

Query  76     LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDST  130
              L +F+D   +         CG TNA  APQP+P     + G      +H+GPCEVW DST
Sbjct  58736  LASFVDDPSFAPCG----TCGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCDST  58569

Query  131    RVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
              RV Q+DNC         ++D + C G+  LR  WL      +  SWQVY  C+PLS S  
Sbjct  58568  RVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPLSGSTI  58401

Query  191    RLEGAANES  199
               +  A++ S
Sbjct  58400  EIPPASSPS  58374

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 79/178 (44%), Gaps = 25/178 (14%)
 Frame = -1

Query  27     AHQVVLLPAPTYTTDNKD-TKYA---------PLAFLESQGFKTVEDFNGWRRSNGYKTL  76
               H  ++ P P +T    D +K+A         P +  E       + F    +++ +KTL
Sbjct  55799  GHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSFKTL  55620

Query  77     RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDSTR  131
              +AF+D        G D  CG T++    QP+P     + G      +H GPCE+W D TR
Sbjct  55619  KAFLD----AYPTGGD--CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELWCDETR  55458

Query  132    VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
              V Q DNC    P    ++D S C G+  L   WL          WQVYK C+ LS  A
Sbjct  55457  VFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALH----TPEWQVYKNCVNLSGVA  55296

 Score = 32.7 bits (73),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = +2

Query  121    GPCEVWLDSTRVLQSDNCHETFPGKTYNLD  150
              GPCE+W D+TRV  ++NC +     +  +D
Sbjct  69329  GPCELWCDNTRVYDNENCAKNIADGSMPID  69418

>PHKE:scaffold_949 scf_22126_949.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_949.1_contig_1:1:5261:1 
REF
Length=5261

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 70/129 (54%), Gaps = 14/129 (11%)
 Frame = +2

Query  68    RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPCEV  125
             + +N  K +R  +D    T   G D  CGFT+ KA P+ P  DG    S G  H GPCE+
Sbjct  2645  KAANNVKDIRTMLDSD--TKLYGQD--CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  2812

Query  126   WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHSWQ  177
             WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YWL  + L  +  WQ
Sbjct  2813  WLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQ  2992

Query  178   VYKACIPLS  186
             VYK C+PLS
Sbjct  2993  VYKNCVPLS  3019

>PHIF:NW_003303738.1 Phytophthora infestans T30-4 supercont1.21 
genomic scaffold, whole genome shotgun sequence
Length=2319577

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 79/176 (45%), Gaps = 22/176 (13%)
 Frame = -3

Query  28       HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTV---------EDFNGWRRSNGYKTLRA  78
                H  +  P   +T +  +T+Y         GF  +          +FN    ++ YK+L+ 
Sbjct  1059011  HGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYKSLKE  1058832

Query  79       FMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDSTR  131
                FM+     V +     CG+TN  A PQP+P        G       +H+GPCEV+ D TR
Sbjct  1058831  FMNDNMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYCDETR  1058652

Query  132      VLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                V Q DNC + FP     L  D+ +C GS  L  YW+         SWQVY  C PL
Sbjct  1058651  VFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINCAPL  1058496

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 61/133 (46%), Gaps = 15/133 (11%)
 Frame = +2

Query  61       VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTG  116
                V  F     ++ YK+++  +D     +  GA   CG  +    PQP+PD          G
Sbjct  1220684  VAAFTKAFEASKYKSIKEVIDDKAKIIVTGATLTCGIADPNTTPQPLPDKVEWSHSEGEG  1220863

Query  117      YT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKN  172
                +T  H+ PCEVW D  RV   DNC   F   T  L Y  S C G+ +L  YW+      +
Sbjct  1220864  FTSTHESPCEVWCDMKRVFYDDNCAAQF---TAELPYEKSKCSGASVLTMYWMA----MH  1221022

Query  173      EHSWQVYKACIPL  185
                  SWQVY  C PL
Sbjct  1221023  GPSWQVYVNCAPL  1221061

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 79/178 (44%), Gaps = 25/178 (14%)
 Frame = -3

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK-----------TVEDFNGWRRSNGYKT  75
                AH  + LPA T+  D   T++  +A +E+                 E F     S+ + +
Sbjct  1071527  AHGYLGLPAVTFPNDVDKTQF--IATIEASASGFSGSFSGSPSANTETFWTAFSSSKFTS  1071354

Query  76       LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLDS  129
                ++ F+      V  GA+  CG T+    PQP+P+        + G+T  H+GPCE W D 
Sbjct  1071353  IKEFVTALGQVVATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDD  1071174

Query  130      TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                T+V Q  NC   F      L Y  ++C G+  L +YWL         +WQVY  C  L
Sbjct  1071173  TQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALH----SSTWQVYANCAAL  1071012

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 89/185 (48%), Gaps = 29/185 (16%)
 Frame = +2

Query  26       DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWR-----------RSNGY  73
                + H  +  PA T+ + + D T++  +A +E+   K +  F+G              S+ Y
Sbjct  1081625  NGHGYMTDPAVTFLSSSTDNTQF--IATIEASASKFIGTFSGSPADNTAAFTTAFESSSY  1081798

Query  74       KTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                 +L+  ++  A  TVTD A   CG  +     QP+P+  +      + G+T  H+GPCEV
Sbjct  1081799  TSLKQLINALATVTVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSTEGFTSSHEGPCEV  1081975

Query  126      WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                W D  RV Q ++C   +      L  D+ +C G+  L +YWL      +  +WQVY  C 
Sbjct  1081976  WCDDVRVFQDNDCAADYTSAPAELPYDHDACLGTSTLTFYWLA----LHSSTWQVYINCA  1082143

Query  184      PLSSS  188
                PL S+
Sbjct  1082144  PLEST  1082158

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 75/178 (42%), Gaps = 22/178 (12%)
 Frame = +2

Query  26       DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
                DAH  +  P  T++ +  D T++       S GFK          V  F     ++ YK+
Sbjct  1247213  DAHGWLSKPEATFSNEAGDKTQFIATIEASSSGFKGTFNTAPKENVASFTKAFDASTYKS  1247392

Query  76       LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLDS  129
                L+AF+D        GA   CG     A  QP+P         S G+T  H+GPCE W D+
Sbjct  1247393  LKAFIDDKAKITVSGATLTCGNAEPDATAQPLPAKLEWYHSESEGFTASHEGPCEAWCDN  1247572

Query  130      TRVLQSDNCHETFPGKTYNLDYS--SCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                 RV   +NC   F      + Y    C G+  L ++W+         +WQVY  C  L
Sbjct  1247573  ERVFHDENCAAHFTTAPAVMPYEKRKCAGASKLTFFWMAMH----GPTWQVYVNCATL  1247734

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 58/195 (30%), Positives = 84/195 (43%), Gaps = 28/195 (14%)
 Frame = +2

Query  26       DAHQVVLLPAPTY------------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSN  71
                +AH  + +P PT+              D  D    P  +++    G  T   +  +  S 
Sbjct  1088168  EAHNKMTVPVPTWPEGVYNQNSPSGIIDPSDVLPVPSGMSYTTDPGSNTKAYWTAFNASK  1088347

Query  72       GYKTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDS  129
                 YK+L+    D  K  +   A   CGF+     P+ +PD         +H GPCEVW D 
Sbjct  1088348  -YKSLKELSWDSQK--LEGSASNECGFSLVDGTPRDLPDEVQWDFFTASHQGPCEVWCDD  1088518

Query  130      TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL--  185
                T V ++ NC   +P    NL Y  + CKG+ ML  YW+          WQVY  C PL  
Sbjct  1088519  TLVFENWNCAVDYPETPANLPYDKAKCKGAAMLTSYWIALHTTP----WQVYTNCAPLTG  1088686

Query  186      -SSSARRLEGAANES  199
                 SSS+   + A++ S
Sbjct  1088687  ASSSSNTSQTASSSS  1088731

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 77/183 (42%), Gaps = 30/183 (16%)
 Frame = +1

Query  26       DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
                + H  + +P   +T    D T+Y         GF     FNG  + N            Y
Sbjct  1284421  NGHGYLTIPKVRFTAQAGDPTQYIASIQASDSGFSGT--FNGAPKDNVAAFTKAFKASKY  1284594

Query  74       KTLRAFM-DGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMR-----STGYT--HDGPCE  124
                 +L+ F  D AK  V  GA   CG  + K  +  P P  T+      S G+T  H+GPCE
Sbjct  1284595  TSLKEFFTDKAKIGVP-GATLTCGSCDPK*RSAAPCP*STIEWSHSASEGFTPSHEGPCE  1284771

Query  125      VWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                VW  + R  Q DNC  H T        D  +C G+  L +YW+      +  SWQVY  C
Sbjct  1284772  VWCGNVRTFQDDNCPAHYTMVPAVLPFDREACMGATTLTFYWM----AMHSESWQVYVNC  1284939

Query  183      IPL  185
                 PL
Sbjct  1284940  APL  1284948

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 76/183 (42%), Gaps = 31/183 (17%)
 Frame = +1

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR--------------RSN  71
                DAH  + LP PT+  +  D   +P   ++S     V D  G+                ++
Sbjct  1089679  DAHSKMSLPKPTWIYE--DGTNSPAGTVDSSSVLPVPDGMGYEGDPLSNTEAYWTAFNAS  1089852

Query  72       GYKTLRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIPDGTM---RSTGYTHDGPCE  124
                 Y +L+  +   +   TD     A   CGF+      + +PD       +TG  HDGPCE
Sbjct  1089853  KYTSLKELVWKNEVVNTDSLYGTATIECGFSWTNGTARDLPDEVQWDKLTTG--HDGPCE  1090026

Query  125      VWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                +W D T V    NC   +P    ++  D ++C+G  ML   WL          WQV+  C
Sbjct  1090027  IWCDDTLVFADQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALH----SPPWQVFTNC  1090194

Query  183      IPL  185
                 PL
Sbjct  1090195  APL  1090203

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 82/200 (41%), Gaps = 30/200 (15%)
 Frame = +3

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVE---DFNGWRRSNGYKTLRAFMDG  82
                +AH  +  P PT++     T YA    ++ Q +  V     + G   SN      AF + 
Sbjct  1105089  EAHSYMSDPMPTWSVGFPSTNYA--GLIDGQDYLPVPKGMSYGGTPESNTEAYWTAF-NA  1105259

Query  83       AKYT-VTDGADYY---------------CGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEV  125
                +KYT + D AD                 CGF+  K   + +P     +  GY+H GPCEV
Sbjct  1105260  SKYTSLKDLADKTMVLQSLSPFGKATKECGFSTPKGTKRNLPAKVQWKDFGYSHQGPCEV  1105439

Query  126      WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                W D        NC   +P     L  D   C G+ M++ YW+    L     WQ+Y  C 
Sbjct  1105440  WCDDKLAFMDTNCALHYPEVPAYLPYDIDVCVGAKMIQSYWIALHGLP----WQLYLNCA  1105607

Query  184      PLSSSARRL-EGAANESAAI  202
                PL+       E  A ES ++
Sbjct  1105608  PLTGKTNSTSEAVAGESDSM  1105667

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 62/135 (46%), Gaps = 15/135 (11%)
 Frame = +3

Query  64       FNGWRRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
                F     S+ Y +L+  ++     TVTD A   CG  +     QP+P+  +      + G+
Sbjct  1046817  FTTAFESSSYTSLKELINALTTVTVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSTEGF  1046993

Query  118      T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
                T  H+GP EVW D  R  Q  NC   +      L Y   +C G+  L +YWL      + 
Sbjct  1046994  TSSHEGP*EVWCDDVRAFQDRNCAADYTSAPAKLPYDRDACLGTSTLTFYWLA----LHS  1047161

Query  174      HSWQVYKACIPLSSS  188
                 +WQVY  C PL S+
Sbjct  1047162  STWQVYINCAPLEST  1047206

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 45/105 (43%), Gaps = 8/105 (8%)
 Frame = +2

Query  91       ADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNCHETFPG--KT  146
                A   CGF+ A    + +P   +     T  HDGPCEVW D       DNC   +P     
Sbjct  1286969  ATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWCDDVLAFGDDNCAVNYPETPSK  1287148

Query  147      YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
                +  D   C G+  L  YW+    L     WQV+  C+PL+ S   
Sbjct  1287149  WPFDVYKCSGASRLTAYWIALHGLP----WQVFINCVPLTGSVNS  1287271

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 11/87 (13%)
 Frame = +3

Query  107      IPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLR  161
                +PD    S G+T  H+GPCE+W D  RV Q ++C   + T P K    D+ +C GS +L 
Sbjct  1057305  VPDCQHCSEGFTASHEGPCEIWCDDVRVFQGNDCAADYTTAPAK-LPYDHDACLGSSVLN  1057481

Query  162      WYWLGTRFLKNEHSWQVYKACIPLSSS  188
                 YW+         +WQVY  C PL S+
Sbjct  1057482  -YWMALH----SSTWQVYVNCAPLEST  1057547

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 54/121 (45%), Gaps = 27/121 (22%)
 Frame = +2

Query  78       AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-------------GYTHDGPCE  124
                A ++  +  V+D A   CGF    ++P+    G +  T             G+ H GPCE
Sbjct  1160303  AMINDNQVLVSDDATATCGF----SSPEKTSHGALNDTIYWGRNDDITMDEGFVHPGPCE  1160470

Query  125      VWLDSTRVLQSDNCHETF---PGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
                 W D+TR+ Q   C ET+    GK      +D + C  +  L +YW+G        +WQV
Sbjct  1160471  TWCDNTRIQQDMTCMETYNTPSGKGAAPIPIDNAKCTDAKRLTFYWIGMH----GSTWQV  1160638

Query  179      Y  179
                Y
Sbjct  1160639  Y  1160641

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 57/134 (43%), Gaps = 28/134 (21%)
 Frame = +3

Query  69       RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-------------  115
                + + YK+LRA ++  +  V+  A   CGF+    +P+    G + +T             
Sbjct  1083219  KKSKYKSLRAGIEDNQVLVSSEAPASCGFS----SPEQTSYGAVNNTVYWDRSDDITVGE  1083386

Query  116      GYTHDGPCEVWLDSTRVLQ---SDNCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRF  169
                G+ H GPCEVW    R  Q    D  +   PGK      +D S CK +  L ++W     
Sbjct  1083387  GFVHPGPCEVWCGDNRAHQDMTGDKTYNPPPGKGAAPVPIDKSLCKEATRLTFFW-----  1083551

Query  170      LKNEHSWQVYKACI  183
                  +   WQ+Y   +
Sbjct  1083552  YMHGPMWQIYSKLL  1083593

 Score = 40.4 bits (93),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (45%), Gaps = 15/76 (20%)
 Frame = +2

Query  78       AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-----------GYTHDGPCEVW  126
                A ++  +  V+D A   CGF    ++P+    G +  T           G+ H GPCE W
Sbjct  1113338  AMINDNQVLVSDDATATCGF----SSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETW  1113505

Query  127      LDSTRVLQSDNCHETF  142
                 D  R+ Q   C ET+
Sbjct  1113506  CDDKRIQQDMTCMETY  1113553

 Score = 40.4 bits (93),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (45%), Gaps = 15/76 (20%)
 Frame = -1

Query  78       AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-----------GYTHDGPCEVW  126
                A ++  +  V+D A   CGF    ++P+    G +  T           G+ H GPCE W
Sbjct  1166140  AMINDNQVLVSDDATATCGF----SSPEKTSYGALNDTIYWGRKDVMTLGFGHPGPCETW  1165973

Query  127      LDSTRVLQSDNCHETF  142
                 D  R+ Q   C ET+
Sbjct  1165972  CDDKRIQQDMTCMETY  1165925

>PYIR:scaffold_1319 pir_scaffold_1319 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1319:1:8199:1 
REF
Length=8199

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 74/132 (56%), Gaps = 14/132 (11%)
 Frame = -1

Query  60    TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
             +  DF       G+ T RAF++    T        CG T A A+P+PIP D T++ S   
Sbjct  5970  SAADFAKTAPGKGFATTRAFLESRGPT--------CGNTLANASPKPIPSDNTVKFSRAI  5815

Query  118   THDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
              H GPCE+W+D+TRV  +D+C   F     T+ +D+S+CKGSCMLR+YWLG +       
Sbjct  5814  VHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGAR  5641

Query  176   WQVYKACIPLSS  187
             +Q Y  C+ L S
Sbjct  5640  FQSYSKCLALVS  5605

>PHCA:scaffold_98 PHYCAscaffold_98
Length=130742

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 74/133 (56%), Gaps = 16/133 (12%)
 Frame = +2

Query  68     RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
              + SNGY  +R  +D    T   GAD  CG+TNA A  +  P   D T  S G  H GPCE
Sbjct  81212  KSSNGYSDIRTLLD--SDTSLYGAD--CGYTNADATAKDPPSTGDATF-SRGMVHVGPCE  81376

Query  125    VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
              +WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +   W
Sbjct  81377  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  81556

Query  177    QVYKACIPLSSSA  189
              QVYK C+PL+  A
Sbjct  81557  QVYKDCVPLTGPA  81595

>PHPA:scaffold_4 NW_008648990.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.4, whole genome shotgun 
sequence
Length=2787191

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 81/179 (45%), Gaps = 25/179 (14%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLES--QGFK---------TVEDFNGWRRSNGYK  74
               +AH  +  PA  Y T    ++Y  +  +ES   GFK          V  F     S+ YK
Sbjct  539050  NAHGWLTKPAAVYDTQMDKSQY--IGTIESTTSGFKGTFTGAPADNVAAFTKAFESSKYK  539223

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
               +L+A +D     +  GA   CG  + KA PQP+P         S G+T  H+GPCEVW D
Sbjct  539224  SLKAVIDDKAKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEVWCD  539403

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                 RV   DNC   +      L Y  S C G+  L  YW+      +  SWQVY  C PL
Sbjct  539404  KERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVA----MHGPSWQVYVNCAPL  539568

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 78/176 (44%), Gaps = 22/176 (13%)
 Frame = -3

Query  28      HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKTLRA  78
               H  + +P   +T +   T+Y       S GF             +FN    ++ Y +L+ 
Sbjct  493827  HGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSLKE  493648

Query  79      FMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDSTR  131
               FM      V+      CG+TN    PQP+P+       G+      +H+GPCEVW D TR
Sbjct  493647  FMTDKMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVWCDDTR  493468

Query  132     VLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               V Q DNC + FP     L  D+ +C GS  L  YW+      +  SWQVY  C  L
Sbjct  493467  VFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQVYINCAAL  493312

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 86/179 (48%), Gaps = 26/179 (15%)
 Frame = +3

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLE--SQGFK---------TVEDFNGWRRSNGYKT  75
               AH  +  PA T++ +  D K   +A +E  S GFK          V  F     ++ YK+
Sbjct  552477  AHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYKS  552653

Query  76      LRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
               L+AF+D  AK TVT GA   CG     A  QP+PD        S G+T  H+GPCE W D
Sbjct  552654  LKAFIDDKAKITVT-GATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWCD  552830

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               S RV   +NC   F      + Y  S C G+  L +YW+      +  +WQVY  C PL
Sbjct  552831  SERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWM----AMHGPTWQVYVNCAPL  552995

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 86/184 (47%), Gaps = 30/184 (16%)
 Frame = +2

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM------  80
               AH  +  PA T+ T N  T++  +A +ES        FNG    N     +AF       
Sbjct  491783  AHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNTAAFTKAFESSSFSS  491956

Query  81      ------DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
                     + A  TV+D A   CG  +     QP+PD  +      S G+T  H+GPCE+W 
Sbjct  491957  LKELINEKATLTVSD-ATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEIWC  492133

Query  128     DSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
               D  RV Q D+C   + T P K    D+ +C GS +L +YWL      +  +WQVY  C P
Sbjct  492134  DDVRVFQGDDCAADYTTAPAK-LPYDHDACLGSSVLTFYWLA----LHSSTWQVYVNCAP  492298

Query  185     LSSS  188
               L S+
Sbjct  492299  LEST  492310

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 13/135 (10%)
 Frame = +2

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----ST  115
               V  F     S+ YK+L+ ++      +  GA   CG  + K  PQP+P  T+      S 
Sbjct  566570  VAAFTKAFTSSKYKSLKEYVTDKAKIIVSGATLTCGSCDPKQEPQPMPKSTVEWSHSDSE  566749

Query  116     GYT--HDGPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLK  171
               G+T  H+GPCEVW D  R  Q D+C  H T        D  +C G+  L +YW+      
Sbjct  566750  GFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM----  566917

Query  172     NEHSWQVYKACIPLS  186
               +  SWQVY  C PL+
Sbjct  566918  HSSSWQVYVNCAPLA  566962

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 59/125 (47%), Gaps = 12/125 (10%)
 Frame = -3

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGP  122
               +S+ + +++ F+      V  GA+  CG TN     QP+PD        + G+T  H+GP
Sbjct  498216  KSSKFTSIKEFVTDLGQVVAIGANLQCGLTNPDETAQPLPDEIEWTHSDTEGFTSSHEGP  498037

Query  123     CEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
               CE W D T+V Q  NC   F      +  D + C G+  L +YWL         +WQVY 
Sbjct  498036  CEAWCDGTQVFQDTNCAAHFTTAPAKMPYDKAGCSGANRLTFYWLALH----SSTWQVYV  497869

Query  181     ACIPL  185
                C  L
Sbjct  497868  NCAAL  497854

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 84/185 (45%), Gaps = 29/185 (16%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
               + H  +  PA T+ + + D T++  +A +ES        F+G    N            Y
Sbjct  502479  NGHGYLTDPAVTFLSSSTDNTQF--IATIESSASGFSGTFSGSPADNTAAFTTAFEVSSY  502652

Query  74      KTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                +L+  ++  A  TVTD A   CG  +     QP+P+  +      S G+T  H+GPCEV
Sbjct  502653  TSLKELINALATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCEV  502829

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D  R  Q D+C   +      L Y   +C G+  L +YWL      +  +WQVY  C 
Sbjct  502830  WCDDVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLA----LHSSTWQVYINCA  502997

Query  184     PLSSS  188
               PL S+
Sbjct  502998  PLEST  503012

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 79/185 (43%), Gaps = 24/185 (13%)
 Frame = +3

Query  26      DAHQVVLLPAPTY----TTDNKDTKYAPLAFL---ESQGFKTVEDFNG---WRRSN--GY  73
               DAH  ++ P PT+     T+N     A   +L   +   + T  + N    W   N   Y
Sbjct  568506  DAHSYMIDPMPTWPVSWATNNFAATIAGQTYLPVPDGMSYSTAPELNTEAYWTAFNESSY  568685

Query  74      KTLRAFMD--GAKYTVT--DGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWL  127
                +L+  +D  G   T++    A   CGF+ A    + +P   +     T  HDGPCEVW 
Sbjct  568686  TSLKDLVDKTGEVQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWC  568865

Query  128     DSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D     + DNC   +P     +  D S C G+  L  YW+    L     WQVY  C+PL
Sbjct  568866  DDVLAFEDDNCAVNYPESPSKWPYDVSKCSGASRLTAYWIALHGLP----WQVYINCVPL  569033

Query  186     SSSAR  190
               + S  
Sbjct  569034  TGSVN  569048

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 75/179 (42%), Gaps = 25/179 (14%)
 Frame = -2

Query  26      DAHQVVLLPAPTY------------TTDNKDTKYAPLAFLESQGFKTVEDFNG-WRRSNG  72
               +AH  + LP PT+            T D  D    P     S       + N  W   N 
Sbjct  512908  EAHNKMTLPLPTWADGFYSQNSPSGTIDPSDVLPVPSGM--SYNTDPASNTNAYWTAFNA  512735

Query  73      --YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDS  129
                 YK+L+     A+ T+   A   CGF+     P+ +PD         +H GPCEVW D 
Sbjct  512734  SKYKSLKELAWDAQ-TLEGTASNECGFSLVDGTPRDLPDEVQWDFFTASHQGPCEVWCDD  512558

Query  130     TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               T V ++ NC   +P    NL Y  + CKGS +L  YW+          WQVY  C PL+
Sbjct  512557  TLVFENWNCAVDYPETPANLPYDKAKCKGSSVLTSYWIALHTTP----WQVYTNCAPLT  512393

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/198 (28%), Positives = 82/198 (41%), Gaps = 32/198 (16%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVED---FNGWRRSNGYKTLRAFMDG  82
               +AH  +  P PT++     T YA    ++ Q +  V D   + G    N      AF + 
Sbjct  506715  EAHSYMSDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGGTPEGNTEAYWTAF-NA  506545

Query  83      AKYT-VTDGADYY---------------CGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEV  125
               +KYT + D AD                 CGF+    + + +P     +  GY+H GPCEV
Sbjct  506544  SKYTSLKDLADKTMVLQSLNPFGKATKECGFSIPNGSKRNLPAQVQWKDFGYSHQGPCEV  506365

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D        NC   +P     L  D   C G+ M++ YW+    L     WQ+Y  C+
Sbjct  506364  WCDDKLAFMDTNCALHYPEVPAFLPYDIDVCIGAKMIQSYWIALHGLP----WQLYLNCV  506197

Query  184     PLSSSARRLEGAANESAA  201
               PL+    +  G +N  A 
Sbjct  506196  PLTG---KTNGTSNAVAG  506152

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 69/160 (43%), Gaps = 21/160 (13%)
 Frame = -3

Query  33      LPAP---TYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTD  89
               LP P   +Y+TD  D   A  A   +  + ++ +F   + +   +T+  F          
Sbjct  509541  LPVPDGMSYSTDPYDNTEAYWAAFNASSYTSLLEFA--KETQVLQTMATF---------G  509395

Query  90      GADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
                A   CGF+ A    + +P +        +H+GPCEV  D TRV +  NC   +      
Sbjct  509394  TATAECGFSLANGTARALPAEVEWNQLTSSHEGPCEV*CDDTRVFEDWNCALDYTSDPAK  509215

Query  149     L--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               L  D S C+G+ ML   WL    L     WQVY  C PL+
Sbjct  509214  LPYDVSKCEGASMLTSIWLALHALP----WQVYTNCAPLT  509107

 Score = 59.3 bits (142),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/179 (26%), Positives = 72/179 (40%), Gaps = 27/179 (15%)
 Frame = -1

Query  28      HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR--------------RSNGY  73
               H  + LP PT+  +  +   +P   ++S     V D  G+                ++ Y
Sbjct  511199  HSKMSLPKPTWVYE--EGTNSPAGTVDSSNVLPVPDGMGYEGDPLSNTEAYWTAFNASKY  511026

Query  74      KTLRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIPDGTMRSTGYT-HDGPCEVWLD  128
                +L+  +   +   TD     A   CG++      + +PD        T HDGPCE+W D
Sbjct  511025  TSLKELVWENEVVNTDSLYGTATIECGYSWTNGTARDLPDEVQWDKLTTGHDGPCEIWCD  510846

Query  129     STRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                T V    NC   +P    ++  D ++C+G  ML   WL          WQV+  C PL
Sbjct  510845  DTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTAIWLALH----SPPWQVFTNCAPL  510681

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 73/171 (43%), Gaps = 43/171 (25%)
 Frame = +3

Query  32      LLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGA  91
               L P  T+ TD       P   ++S     VE F      + YK++R  ++  +  V+D A
Sbjct  504171  LFPGGTFNTD-------PTINIKS----FVEHF----EKSKYKSIRTMIEDKQVLVSDDA  504305

Query  92      DYYCGFTNAKAAPQPIPDGTMRST-------------GYTHDGPCEVWLDSTRVLQSDNC  138
                  CGF    ++P+    G +  T             G  H GPCEVW D  R  Q  NC
Sbjct  504306  TATCGF----SSPEKTSYGALNDTVYWGRNDDITQDEGLVHPGPCEVWCDDNRAQQDMNC  504473

Query  139     HETF---PGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY-KAC  182
                +T+    GK      +D S C  +  L ++W+G     +  +WQVY K C
Sbjct  504474  MKTYTPASGKGAAPIPIDKSVCTDAKRLTFFWIGM----HGATWQVYSKLC  504614

>SAPA:scaffold_31 supercont2.31 dna:supercontig supercontig:ASM15154v2:supercont2.31:1:358087:1 
REF
Length=358087

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 91/190 (48%), Gaps = 25/190 (13%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPL----------AFLESQGFKTVEDFNGWRRSNGYK  74
               D H  ++ P PT+   N D TKY             ++ +   + T++ F    +++ ++
Sbjct  135601  DGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQ-FTTQFKASPFR  135425

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDS  129
               TL AF+D             CG TNA  A QP+P     + G      +H+GPCEVW DS
Sbjct  135424  TLAAFVDSQNVASCG----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCDS  135257

Query  130     TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               TRV Q+DNC         ++D + C G+  LR  WL      +  SWQVY  C+PLS S 
Sbjct  135256  TRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPLSGST  135089

Query  190     RRLEGAANES  199
                 +  AA+ S
Sbjct  135088  VVIPPAASPS  135059

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 82/178 (46%), Gaps = 25/178 (14%)
 Frame = +1

Query  27      AHQVVLLPAPTYTTDNKD-TKYA-----PLAFLES---QGFK-TVEDFNGWRRSNGYKTL  76
                H  ++ P P +T    D TK+A     P     S   QG     ++F    +++ +KTL
Sbjct  137365  GHGHLVDPVPAFTDKYGDPTKFAATLDGPTVLPGSTYGQGPDWNTDEFTKHFKASSFKTL  137544

Query  77      RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----THDGPCEVWLDSTR  131
               +AF+D        G D  CG T+A    QP+P     + G      +H GPCE+W D+ R
Sbjct  137545  KAFLDAHP----SGGD--CGITDANGPAQPLPSTVKWANGQEGFISSHQGPCELWCDNMR  137706

Query  132     VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               V   +NC   +P    ++D S C G+  L   WL          WQVYK C+ LS +A
Sbjct  137707  VFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----SPQWQVYKNCVNLSGAA  137868

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 65/134 (49%), Gaps = 15/134 (11%)
 Frame = +1

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTG----  116
                + F    +++ +KTL+AF+D        G D  CG T+     QP+P     + G    
Sbjct  132742  TDQFTKHFKASSFKTLKAFLDAHP----TGGD--CGITDPNGPAQPLPSTVKWANGELGF  132903

Query  117     -YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
                 +H GPCE+W D TRV Q +NC   +P     +D S C G+  L   WL     +    
Sbjct  132904  ISSHQGPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----  133071

Query  176     WQVYKACIPLSSSA  189
               WQVYK C+ LS +A
Sbjct  133072  WQVYKNCVNLSGAA  133113

 Score = 44.7 bits (104),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 4/59 (7%)
 Frame = +2

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               GPCE+W D TRV  +D+C +  P  +  +D S C G+  L   W+      +   WQ Y
Sbjct  210596  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMAL----HTPQWQAY  210760

 Score = 33.5 bits (75),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 16/94 (17%)
 Frame = +1

Query  27      AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLESQGFKTVEDFNGWRRSNGYKT  75
               AH  +  P PT+   N D           T     A+ +  G+   + F    +++ YKT
Sbjct  210223  AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKTSKYKT  210399

Query  76      LRAFMDGAKYTVTDGADYYCGFTNAKAA-PQPIP  108
               L+AF+D    +   G    CG T   AA PQP+P
Sbjct  210400  LKAFLDAWDTSAQCG---QCGITKVDAANPQPLP  210492

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 4/59 (7%)
 Frame = -1

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               GPCE+W D TRV  +D+C +  P  +  +D S C G+  L   W+      +   WQ Y
Sbjct  208615  GPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMAL----HTPQWQAY  208451

 Score = 32.7 bits (73),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 41/94 (44%), Gaps = 16/94 (17%)
 Frame = -3

Query  27      AHQVVLLPAPTYTTDNKD-----------TKYAPLAFLESQGFKTVEDFNGWRRSNGYKT  75
               AH  +  P PT+   N D           T     A+ +  G+   + F    +++ YKT
Sbjct  208988  AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNAAQ-FAANFKTSKYKT  208812

Query  76      LRAFMDGAKYTVTDGADYYCGFTNAKAA-PQPIP  108
               L+AF+D    +   G    CG T   AA PQP+P
Sbjct  208811  LKAFLDAWDTSAQCG---QCGITKVDAANPQPLP  208719

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = +2

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               GPCE+W D+TRV  ++NC +     +  +D + C G+  LR++WL      +  SWQVY
Sbjct  142742  GPCELWCDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSSSWQVY  142906

>PHKE:scaffold_221 scf_22126_221.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_221.1:1:58736:1 
REF
Length=58736

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 71/132 (54%), Gaps = 14/132 (11%)
 Frame = -1

Query  68    RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN--AKAAPQPIPDGTMRSTGYTHDGPCEV  125
             + SNGY  +R  +D    T   GAD  CG+TN  A A   P       S G  H GPCE+
Sbjct  2624  KSSNGYSDIRTLLD--SDTSLYGAD--CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  2457

Query  126   WLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQ  177
             WLD T VL +D+C   +   T +       +DYSSC  S CMLR+YWL  + + +   WQ
Sbjct  2456  WLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQ  2277

Query  178   VYKACIPLSSSA  189
             VYK C+PL+  A
Sbjct  2276  VYKDCVPLTGPA  2241

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 70/131 (53%), Gaps = 18/131 (14%)
 Frame = -1

Query  68     RRSNGYKTLRAFMDGAKYTVTDGADY--YCGFTNAKAAPQ-PIPDGTMR-STGYTHDGPC  123
              + +N  K +R   D      +D + Y   CGFTN  A P+ P  DGT   S G  H GPC
Sbjct  53105  KVANNAKDIRTLFD------SDTSLYGENCGFTNPDATPKDPPTDGTATFSRGIVHAGPC  52944

Query  124    EVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCK-GSCMLRWYWLGTRFLKNEHS  175
              E+WLD   VLQ+D+C   +   T         +DYSSC  G CM R+YW+  + L  +  
Sbjct  52943  EIWLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTY  52764

Query  176    WQVYKACIPLS  186
              WQVYK C+PL+
Sbjct  52763  WQVYKNCVPLT  52731

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 67/133 (50%), Gaps = 16/133 (12%)
 Frame = -3

Query  68     RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRSTGYTHDGPCE  124
              + SN Y  +R   D        GA+  CGFT+  A P+  P   D T  S G  H G CE
Sbjct  51444  KSSNCYSDIRTLPDSDNSLY--GAN--CGFTDPNATPKDPPTIGDATF-SCGMMHIGSCE  51280

Query  125    VWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKGSC-MLRWYWLGTRFLKNEHSW  176
              +WLD T VL SD+C   +   T         +D S C  S  MLR+YWL  + + ++  W
Sbjct  51279  IWLDDTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVW  51100

Query  177    QVYKACIPLSSSA  189
              QVYK C+PL+  A
Sbjct  51099  QVYKDCVPLTGPA  51061

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 10/71 (14%)
 Frame = +1

Query  121    GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTRFLK  171
              GPCE+WLD T VL +D+C E F    Y         +DYSSC  S CMLR+YWL  +  K
Sbjct  57631  GPCEIWLDDTMVLHNDDCEEAFGTSDYETIKSVMKPVDYSSCSSSGCMLRFYWLAFQGSK  57810

Query  172    N-EHSWQVYKA  181
                ++ WQ+Y A
Sbjct  57811  TGKYVWQIYSA  57843

>PLHA:NW_020187210.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_289, whole genome shotgun sequence
Length=778693

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 66/136 (49%), Gaps = 15/136 (11%)
 Frame = -2

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDG--TMRSTGYTHDG  121
               F     +N +K +R+ MDG      D     CG+T+    P   P       S G  H G
Sbjct  550086  FKELATANNFKDVRSLMDGNPVYGED-----CGYTDPNGTPVAPPSNGEATFSRGIVHAG  549922

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYN-------LDYSSCKG-SCMLRWYWLGTRFLKNE  173
               PCE+WLD   VLQ+D+C   +   T         +DYSSC    CMLR+YWL  + L  +
Sbjct  549921  PCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGK  549742

Query  174     HSWQVYKACIPLSSSA  189
                 WQ YK CIPL+  A
Sbjct  549741  TVWQAYKNCIPLNGPA  549694

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 70/130 (54%), Gaps = 15/130 (12%)
 Frame = -1

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWL  127
               +N +K+ R+ MDG       GAD  CG+T+    P  P  DGT   S    H G CE+W+
Sbjct  557065  ANNFKSARSLMDGNPVY---GAD--CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWI  556901

Query  128     DSTRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
               +   VLQ+D+C   +  K          +DYSSCKG  C+LR+YWL  + + ++  WQ Y
Sbjct  556900  NKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAY  556721

Query  180     KACIPLSSSA  189
               K CI +  S+
Sbjct  556720  KNCISIKGSS  556691

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 47/101 (47%), Gaps = 15/101 (15%)
 Frame = -2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWL  127
               +N +K  R+ +D        GAD  CG+T+    P  P  DGT   S G  H G CEVW+
Sbjct  560604  ANNFKNARSLLDSDPVY---GAD--CGYTDPNGTPVDPPSDGTATFSRGIAHVGRCEVWI  560440

Query  128     DSTRVLQSDNCHETFPGKTYN-------LDYSSC-KGSCML  160
               D    LQ D+C   F   T         +DYS C K  C++
Sbjct  560439  DEKIALQKDDCQAAFGNGTIEYKSVLKPIDYSLCDKDKCLM  560317

>PHRA:scaffold_418
Length=13567

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 18/124 (15%)
 Frame = +1

Query  92     DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
              D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  12490  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  12669

Query  145    -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                         +DYSSC G C L  YWL  +  +    WQ Y  C+PL  S    +    
Sbjct  12670  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQ  12837

Query  198    ESAA  201
               S+A
Sbjct  12838  TSSA  12849

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 75/166 (45%), Gaps = 25/166 (15%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
               DAH  +  P PT+  D    ++  +    +    G   V  F       G       +D 
Sbjct  351477  DAHGSLKQPKPTF--DGSSAEWVTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKDVILDM  351304

Query  83      AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSD  136
                K       D  CG+T A A PQPIP DG ++       G+TH GPCE+++D   VL  D
Sbjct  351303  VK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGD  351145

Query  137     NCHETFPG---KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               NC E F G       +DYSSC G+CML  YWLG +       WQ Y
Sbjct  351144  NCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAY  351019

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 81/171 (47%), Gaps = 30/171 (18%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
               DAH  +  P PT+  D    ++  L    +    G      F    +  G       +D 
Sbjct  363707  DAHGSLKQPKPTF--DGSSAEWVTLIDNCWDIGSGGDQSGKFKTMAKEKGMSIKDVILDM  363534

Query  83      AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSD  136
                K       D  CG+T A A PQPIP DG ++       G+TH GPCE+++D   VL  D
Sbjct  363533  VK-------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHRGPCEIYIDDKMVLHGD  363375

Query  137     NCHETFPG------KTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               +C E FPG      KT ++  D+SSC G+CML  YWLG    +NE  WQ Y
Sbjct  363374  DCEEEFPGGSDGSDKTSDMPVDFSSCNGNCMLTIYWLG---FQNEQ-WQSY  363234

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 66/143 (46%), Gaps = 25/143 (17%)
 Frame = +1

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   V  F    +  G       +D  K       D  CG+T     PQPIP DG ++  
Sbjct  382420  GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  382578

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE+++D   VL  D+C + FPG           ++D+SSC G C L  
Sbjct  382579  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTI  382758

Query  163     YWLGTRFLKNEHSWQVYKACIPL  185
               YWL     +NE  WQ Y  C+PL
Sbjct  382759  YWLA---FQNEQ-WQSYVNCVPL  382815

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 66/143 (46%), Gaps = 25/143 (17%)
 Frame = +1

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   V  F    +  G       +D  K       D  CG+T     PQPIP DG ++  
Sbjct  353557  GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPQPIPSDGIVKWW  353715

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE+++D   VL  D+C + FPG           ++D+SSC G C L  
Sbjct  353716  GNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTI  353895

Query  163     YWLGTRFLKNEHSWQVYKACIPL  185
               YWL     +NE  WQ Y  C+PL
Sbjct  353896  YWLA---FQNEQ-WQSYVNCVPL  353952

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 55/108 (51%), Gaps = 18/108 (17%)
 Frame = -2

Query  90      GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               G+   CG T A  + QP+P DG  +       G+TH GPCE+++D T VL  DNC + +P
Sbjct  427780  GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  427601

Query  144     GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               G            +DYSSCKG C L  YWLG +       WQ Y   I
Sbjct  427600  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQ----NAQWQAYSTLI  427469

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 49/99 (49%), Gaps = 18/99 (18%)
 Frame = +3

Query  95      CGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG----  144
               CG T A  A QPIP DG ++       G+TH GPCEV+LD   V+  DNC E F G    
Sbjct  347799  CGNTLADGAAQPIPSDGKVKWLGNGGGGFTHVGPCEVYLDDKMVVHGDNCEEEFKGGDVG  347978

Query  145     ----KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
                       +DYS+C G C L  YWL  +       WQ Y
Sbjct  347979  STETSDMTVDYSACNGKCTLTIYWLAFQ----NAQWQAY  348083

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 74/171 (43%), Gaps = 29/171 (17%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
               +AH  +  P P++  D  +  +  L    +    G   V  F    +  G       +D 
Sbjct  391797  EAHGYLEQPKPSWK-DGPNVNWVTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVVLDM  391621

Query  83      AKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSD  136
                K       D  CG T A    QPIP DG ++       G+TH GPCE++LD   VL  D
Sbjct  391620  VK-------DQKCGNTLADGPAQPIPSDGKVKWLGNNGGGFTHTGPCEIYLDDKMVLHGD  391462

Query  137     NCHETFPG------KTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               +C + F G      KT ++  D+SSC G C+L  YWL  +       WQ Y
Sbjct  391461  DCEDEFQGGDVGSKKTSDMTVDFSSCIGKCLLTIYWLAFQ----NAQWQTY  391321

 Score = 55.5 bits (132),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 6/54 (11%)
 Frame = +3

Query  92      DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCH  139
               D  CG+T A A PQPIP DG ++       G+TH GPCE+ +D   VL  DNC 
Sbjct  355431  DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHSGPCEICIDDKMVLHGDNCE  355592

 Score = 34.3 bits (77),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (61%), Gaps = 4/31 (13%)
 Frame = +2

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               +DYSSC G+CML  YWLG +       WQ Y
Sbjct  355643  IDYSSCNGNCMLTIYWLGFQ----NAQWQAY  355723

>PHCA:scaffold_50 PHYCAscaffold_50
Length=475612

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 66/132 (50%), Gaps = 13/132 (10%)
 Frame = +3

Query  63      DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
               +FN    ++ Y +L+ FM+     V       CG+TN K APQP+P   +        G+
Sbjct  150978  NFNKGMAASKYTSLKEFMNDKMVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGF  151157

Query  118     T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
               T  H+GPCEVW D TRV Q DNC + FP     + Y   +C GS  L  YW+      + 
Sbjct  151158  TQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL----HS  151325

Query  174     HSWQVYKACIPL  185
                SWQVY  C  L
Sbjct  151326  PSWQVYINCAAL  151361

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 67/126 (53%), Gaps = 15/126 (12%)
 Frame = -3

Query  70     SNGYKTLR-AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
              S+ YK+L+  F D AK TV+ GA   CG  + K  PQP+P+  +      S G+T  H+G
Sbjct  97202  SSKYKSLKDLFTDKAKITVS-GATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEG  97026

Query  122    PCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
              PCEVW D  R  Q DNC   FP     +  D  +C G+  L +YW+      +  +WQVY
Sbjct  97025  PCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMA----MHSDTWQVY  96858

Query  180    KACIPL  185
                C PL
Sbjct  96857  VNCAPL  96840

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 82/185 (44%), Gaps = 29/185 (16%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG--  82
               + H  +  PA T+ + + D T++  +A +ES   K    F+G    N     +AF     
Sbjct  154265  NGHGYMTEPAVTFLSSSTDNTQF--IATIESSASKFSGTFSGSPADNTAAFTKAFASSSY  154092

Query  83      ----------AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                         A  TVTD A   CG  N     QP+PD  +      + G+T  H+GPCEV
Sbjct  154091  TSLKDLITSLATVTVTD-ATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPCEV  153915

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D  RV Q D+C   +      L Y   +C G+  L +YWL         +WQVY  C 
Sbjct  153914  WCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVYVNCA  153747

Query  184     PLSSS  188
               PL S+
Sbjct  153746  PLEST  153732

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 13/131 (10%)
 Frame = +2

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT  118
               F     ++ YK+L+  ++      +      CG+TN    PQP+P+  +        G+T
Sbjct  149672  FTKGFEASKYKSLKEVINDLGKVTSSDFTMECGYTNPDETPQPLPETYVEWAHGSGEGFT  149851

Query  119     --HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEH  174
                 H+GPCEVW D  RV Q DNC   +P     + Y   +C G+  L +YWL      +  
Sbjct  149852  PSHEGPCEVWCDDVRVFQDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLAL----HSS  150019

Query  175     SWQVYKACIPL  185
               +WQVY  C  L
Sbjct  150020  TWQVYTNCAAL  150052

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 65/135 (48%), Gaps = 15/135 (11%)
 Frame = -1

Query  64      FNGWRRSNGYKTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
               F     S+ Y +L+  + D A  TVTD A   CG  +     Q +P   +      S G+
Sbjct  152731  FTTAFESSSYSSLKELINDKATITVTD-ATLTCGACDPDETAQALPATYVEWAHSDSEGF  152555

Query  118     T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNE  173
               T  H+GPCEVW D  RV Q D+C   +      L  D+ +C GS +L +YWL        
Sbjct  152554  TASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH----S  152387

Query  174     HSWQVYKACIPLSSS  188
                +WQVY  C PL S+
Sbjct  152386  STWQVYVNCAPLEST  152342

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 80/192 (42%), Gaps = 25/192 (13%)
 Frame = +1

Query  27      AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGF-----------KTVEDFNGWRRSNGYKT  75
               AH  +  P  T+  D   T++  +A +ES                 E F     S+ Y +
Sbjct  146965  AHGYLGQPVVTFPNDVDKTQF--IATIESSASWFSGSFSGSPAANTEAFWAAFNSSKYSS  147138

Query  76      LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---DGTMRST-GYT--HDGPCEVWLDS  129
               ++ F+      V +GA   CG T+    PQ +P   + T   T G+T  H+GPCE W D 
Sbjct  147139  IKDFVTDKGQIVANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEAWCDD  147318

Query  130     TRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
               T+V Q  NC   F      +  D + C GS  L +YWL         +WQ+Y  C  L  
Sbjct  147319  TQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCAALEG  147486

Query  188     SARRLEGAANES  199
               S      + N S
Sbjct  147487  STGSYSPSQNNS  147522

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 64/129 (50%), Gaps = 16/129 (12%)
 Frame = -2

Query  61      VEDFNGWRRSNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----S  114
               V  F    +++ YK+L+A +D  AK TVT GA   CG  +     QP+P  T+      S
Sbjct  100191  VASFTKAFKASSYKSLKALIDDKAKVTVT-GATLTCGSADPNGPAQPLP-ATLEWSHSDS  100018

Query  115     TGYT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFL  170
                G+T  H+GPCE W D T V   +NC   F      + Y  S C G+  L +YW+     
Sbjct  100017  EGFTPSHEGPCEAWCDDTMVFNDENCAANFKTAPAEMPYEKSKCSGASKLTFYWMAM---  99847

Query  171     KNEHSWQVY  179
                +  +WQVY
Sbjct  99846   -HGPTWQVY  99823

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 80/185 (43%), Gaps = 24/185 (13%)
 Frame = -2

Query  26     DAHQVVLLPAPTY----TTDNKDTKYAPLAFL---ESQGFKTVEDFNG---WRRSN--GY  73
              DAH  ++ P PT+     T+N     A   +L   +   + T  + N    W   N   Y
Sbjct  95466  DAHSYMIDPMPTWPVSWATNNFAATIAGQTYLPVPDGMSYSTAPELNTEAYWTAFNESSY  95287

Query  74     KTLRAFMD--GAKYTVT--DGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWL  127
               +L+  +D  G   T++    A   CGF+ A    + +P   +     T  HDGPCEVW 
Sbjct  95286  TSLKDLVDKTGELQTLSPFGTATLECGFSLANGTARDLPSEYVEWNQLTEGHDGPCEVWC  95107

Query  128    DSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D     + DNC   +P     +  D S C+G+  L  YW+    L     WQVY  C+PL
Sbjct  95106  DDVLAFEDDNCAVNYPENPSQWPYDVSKCQGASRLTAYWIALHGLP----WQVYINCVPL  94939

Query  186    SSSAR  190
              + S  
Sbjct  94938  TGSVN  94924

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 63/129 (49%), Gaps = 15/129 (12%)
 Frame = -1

Query  70      SNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
               S+ Y +L+  +   A  TVTD A   CG  +     Q +P   +      S G+T  H+G
Sbjct  142888  SSSYTSLKDLITSLATVTVTD-ATLTCGSCDPGETAQALPATYVEWSHSSSEGFTSSHEG  142712

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               PCEVW D TRV Q D+C   +      L Y   +C GS  L +YWL      +  +WQVY
Sbjct  142711  PCEVWCDDTRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLA----LHSSTWQVY  142544

Query  180     KACIPLSSS  188
                 C PL S+
Sbjct  142543  VNCAPLEST  142517

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 84/209 (40%), Gaps = 45/209 (22%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVED---FNGWRRSNGYKTLRAFMDG  82
               +AH  +  P PT++     T YA    ++ Q +  V D   + G    N      AF   
Sbjct  139162  EAHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGGTPEGNTEAYWTAFNAS  139335

Query  83      AKYT-VTDGADYY---------------CGFTNAKAAPQPIPDGTMRST---------GY  117
                KY+ + D AD                 CGF+        +P+GT R+          GY
Sbjct  139336  KKYSSLKDLADKTMVLQSLSPFGKATKECGFS--------LPNGTARALPAKVQWKDFGY  139491

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHS  175
               +H GPCEVW D        NC   +P    NL  D   C G+ M++ YW+    L     
Sbjct  139492  SHQGPCEVWCDDKLAFSDTNCALHYPEVPANLPYDVDVCTGAKMMQSYWIALHGLP----  139659

Query  176     WQVYKACIPLSSSARRLEGA-ANESAAIE  203
               WQ+Y  C+ LS      + A A ES A +
Sbjct  139660  WQLYLNCVRLSGKTNGTDNAVAGESDAAQ  139746

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 55/120 (46%), Gaps = 8/120 (7%)
 Frame = +3

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWL  127
                ++ Y +L+     A+ T+   A   CGF+      + +PD         +H GPCEVW 
Sbjct  112920  NASKYTSLKELSWDAQ-TLEGSATNECGFSIVDGTARELPDEVQWDFFTASHQGPCEVWC  113096

Query  128     DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D T V +  NC  T+P    NL Y  + C G+ ML  YW+          WQVY  C PL
Sbjct  113097  DDTLVFEDWNCAVTYPETPANLPYDKAKCSGASMLTSYWIALHTTP----WQVYTNCAPL  113264

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 70/179 (39%), Gaps = 23/179 (13%)
 Frame = +3

Query  26      DAHQVVLLPAPTY-----------TTDNKDTKYAPLAF-LESQGFKTVEDFNGWRRSNGY  73
               DAH  + LP PT+           T D      AP     E       + +     ++ Y
Sbjct  114468  DAHSKMSLPKPTWVYEDGTNSPAGTIDGASVLPAPTGMGYEGDPLSNTKAYWTAFNASKY  114647

Query  74      KTLRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIPDGTMRSTGYT-HDGPCEVWLD  128
                +L+  +   +   TD     A   CG++      + +PD        T HDGPCE+W D
Sbjct  114648  TSLKELVWKNEVVNTDSLYGTATIECGYSWTNGTARDLPDEVQWDKLTTGHDGPCEIWCD  114827

Query  129     STRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                T V    NC   +P    ++  D ++C+G  ML   WL          WQV+  C PL
Sbjct  114828  DTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTTIWLALH----SPPWQVFTNCAPL  114992

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 45/95 (47%), Gaps = 7/95 (7%)
 Frame = +2

Query  95      CGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--  151
               CGF+ A    + +P +        +H+GPCEVW D T V +  NC   +      L Y  
Sbjct  136202  CGFSLANGTARALPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKLPYDA  136381

Query  152     SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               S C+G+ ML   WL        H WQVY  C PL+
Sbjct  136382  SKCEGASMLTSIWLALH----AHPWQVYTNCAPLT  136474

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 47/104 (45%), Gaps = 9/104 (9%)
 Frame = +2

Query  87      VTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNCHETFPG  144
               +  GA    GF+      Q +P   +    +T  H GPCEVW D T V ++ NC   +P 
Sbjct  108632  LASGASNESGFSTVDGKAQALP-AQVEWDFFTASHQGPCEVWCDDTLVFENYNCAVDYPD  108808

Query  145     KTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                   L Y  S C G+ ML  YW+          WQVY  C PLS
Sbjct  108809  TPAKLPYDKSKCSGASMLTSYWIALH----STPWQVYTNCAPLS  108928

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 59/142 (42%), Gaps = 27/142 (19%)
 Frame = -2

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-----  115
               ++ F    + + YKTL+  +   +  V+ G    CGFT     P     G +  T     
Sbjct  141231  IKSFLEHFKKSKYKTLKDMIVDKQVLVSGGPTASCGFT----VPDQTSYGALNDTVYWGR  141064

Query  116     --------GYTHDGPCEVWLDSTRVLQSDNCHETFP------GKTYNLDYSSCKGSCMLR  161
                       G+ H GPCEVW D  R  Q +NC ET+            +D S C  +  L 
Sbjct  141063  SDDITKDQGFVHPGPCEVWCDDNRAQQDNNCMETYNNAGNVGAAPVPIDKSVCTDAKRLT  140884

Query  162     WYWLGTRFLKNEHSWQVYKACI  183
               +YW+G     +  +WQVY   +
Sbjct  140883  FYWIGM----HGPTWQVYSKLL  140830

>PHRA:scaffold_1234
Length=7828

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 18/124 (15%)
 Frame = -2

Query  92    DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
             D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  4851  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  4672

Query  145   -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                        +DYSSC G C L  YWL  +  +    WQ Y  C+PL  S    +    
Sbjct  4671  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQ  4504

Query  198   ESAA  201
              S+A
Sbjct  4503  TSSA  4492

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 18/115 (16%)
 Frame = -3

Query  92    DYYCGFTNAKAAPQPI-PDGTM-----RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
             +Y CG+T     P+ I  DG          G+TH GPCE++LD T +L  DNC + + G 
Sbjct  2747  EYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGG  2568

Query  146   TYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
               +        +DYSSC G+C L  YWLG    +NE  WQ Y   +     A R+
Sbjct  2567  ADDSGIMSDMPIDYSSCNGACTLAIYWLG---FQNEQ-WQAYSEWVEQQLPAVRM  2415

>PYIW:scaffold_2639 piw_scaffold_2639 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2639:1:4508:1 
REF
Length=4508

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 84/187 (45%), Gaps = 34/187 (18%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKD-----TKYAPLAFLESQG-------------FKTVEDFNGW  67
             D H  + +P PT+TT   +     T   P      +G             FKT   F+  
Sbjct  3942  DGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTA--FSSQ  3769

Query  68    RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR----STG---YTHD  120
               S  Y+ LR  +D  K   + G D  CGFTN  +A QP+    +     +TG    TH 
Sbjct  3768  TDSIKYRNLRDLID-TKAVFSAGTDKECGFTNVTSAKQPLSAQYVE*KSSATGGFTPTHQ  3592

Query  121   GPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQV  178
             GPCE+W D   V Q+DNC + +P     L Y  S C G+ ML++YWL    +K    W+ 
Sbjct  3591  GPCEIWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEA  3424

Query  179   YKACIPL  185
             Y  C PL
Sbjct  3423  YINCAPL  3403

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 77/183 (42%), Gaps = 28/183 (15%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKY------------APLAFL-ESQGFKTVEDFN-GWRRSN  71
             D H  + +P PT+        Y            AP      S G      +   +   N
Sbjct  2160  DGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFGNQN  1981

Query  72    GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-------DGTMRSTGYTHDGPCE  124
              Y+ LR  +D      + GAD  CGFT+A  A QP+P       +   +    TH+GPCE
Sbjct  1980  RYRNLRELVDFTA-VFSAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPCE  1804

Query  125   VWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
             VW D     +  NC + F G    L Y  S C G+ ML++YWL      +   W+VY  C
Sbjct  1803  VWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYINC  1636

Query  183   IPL  185
             +PL
Sbjct  1635  VPL  1627

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 62/130 (48%), Gaps = 14/130 (11%)
 Frame = +2

Query  65   NGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT-  118
              ++    Y +L+A +D A      GA   CG T+A  A QP+P   +        G+T 
Sbjct  254  TAFKAQTKYASLKALID-ANGKFISGASKECGVTSATGAKQPLPATYVEWAHSNEEGFTP  430

Query  119  -HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHS  175
             H GPCEVW D      +DNC + +      L Y  S C G+ ML++YWL      +  +
Sbjct  431  SHQGPCEVWCDGKVAFSNDNCPKNYATAPAKLPYDKSKCTGASMLKFYWLAL----HSDT  598

Query  176  WQVYKACIPL  185
            WQ Y AC PL
Sbjct  599  WQAYIACAPL  628

>PHPA:scaffold_12 NW_008648998.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.12, whole genome shotgun 
sequence
Length=1504206

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 73/161 (45%), Gaps = 27/161 (17%)
 Frame = -3

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   V  F    +  G       +D  K       D  CG+T     P+PIP DG ++  
Sbjct  393148  GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  392990

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE+++D   VL  DNC E FPG            +D+SSC G C L  
Sbjct  392989  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  392810

Query  163     YWLGTRFLKNEHSWQVYKACIPL--SSSARRLEGAANESAA  201
               YWLG +  +    WQ Y  C+PL  S SA + + +   S A
Sbjct  392809  YWLGFQNAQ----WQAYVNCVPLQGSGSATQTQASTGGSGA  392699

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 73/161 (45%), Gaps = 27/161 (17%)
 Frame = +2

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   V  F    +  G       +D  K       D  CG+T     P+PIP DG ++  
Sbjct  384578  GGDQVGKFKTMAKEKGMSVKDVVLDMVK-------DKKCGYTRTDVDPKPIPADGKVKWW  384736

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE+++D   VL  DNC E FPG            +D+SSC G C L  
Sbjct  384737  GNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTI  384916

Query  163     YWLGTRFLKNEHSWQVYKACIPL--SSSARRLEGAANESAA  201
               YWLG +  +    WQ Y  C+PL  S SA + + +   S A
Sbjct  384917  YWLGFQNAQ----WQAYVNCVPLQGSGSATQTQASTGGSGA  385027

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 58/137 (42%), Gaps = 25/137 (18%)
 Frame = -2

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   +  F    +  G       +D  K       D  CG T     PQPIP DG ++  
Sbjct  454862  GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  454704

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE++LD   VL  D+C + F G            +D+SSC G C+L  
Sbjct  454703  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  454524

Query  163     YWLGTRFLKNEHSWQVY  179
               YWL  +       WQ Y
Sbjct  454523  YWLAFQ----NAQWQTY  454485

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 58/137 (42%), Gaps = 25/137 (18%)
 Frame = -2

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--  113
               G   +  F    +  G       +D  K       D  CG T     PQPIP DG ++  
Sbjct  446657  GGDQIGKFKAMAKEKGMSVKDVVLDMVK-------DQKCGNTLENGDPQPIPADGKVKWH  446499

Query  114     ---STGYTHDGPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRW  162
                    G+TH GPCE++LD   VL  D+C + F G            +D+SSC G C+L  
Sbjct  446498  GNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTI  446319

Query  163     YWLGTRFLKNEHSWQVY  179
               YWL  +       WQ Y
Sbjct  446318  YWLAFQ----NAQWQTY  446280

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 50/104 (48%), Gaps = 18/104 (17%)
 Frame = -1

Query  90      GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               GA   CG T A    QPIP DG  +       G+TH GPCE++LD   VL  DNC + +P
Sbjct  457833  GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  457654

Query  144     GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               G            +DYSSC   C L  YWL  +      +WQ Y
Sbjct  457653  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAY  457534

 Score = 58.2 bits (139),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 12/70 (17%)
 Frame = +1

Query  121     GPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRWYWLGTRFLKN  172
               GPCE+++D   VL SD+C   +PG            +DYSSC G+C+   YWLG R    
Sbjct  432811  GPCELYIDDKMVLHSDDCESDYPGGPNDSGEMSVMPVDYSSCNGNCIFSIYWLGFR----  432978

Query  173     EHSWQVYKAC  182
                  WQ Y  C
Sbjct  432979  NAQWQAYSTC  433008

 Score = 32.0 bits (71),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 0/30 (0%)
 Frame = +2

Query  90      GADYYCGFTNAKAAPQPIPDGTMRSTGYTH  119
               G D  CGFT     PQP+P       G+TH
Sbjct  432656  GPDKKCGFTTTDVGPQPVPADGKAK*GFTH  432745

>PHKE:scaffold_399 scf_22126_399.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_399.1:1:32365:1 
REF
Length=32365

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 84/166 (51%), Gaps = 22/166 (13%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFL------ESQGFKTVEDFNGWRRSNGYKTLRAF  79
              +AH  +L+P   +  D        +A +      +    ++V  F+  +++N +  L+  
Sbjct  30627  NAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDLKTL  30806

Query  80     MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
              MD    T   GAD  CGFT+    PQPIP DG    S    H GPCE+WLDST+    DN
Sbjct  30807  MDD---TSVYGAD--CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFSKDN  30971

Query  138    C--HETFPGKTYNLDYSSCK-GSCM-LRWYWLGTRFLKNEHSWQVY  179
              C   ETFP     +DYSSC  G C  +R+YWL  + L ++  WQ Y
Sbjct  30972  CADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSY  31094

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 15/131 (11%)
 Frame = +1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              ++V  FN  +++N Y  L+  MD    T   GAD  CGFT+    PQPIP DG    S  
Sbjct  28096  QSVTAFNALKKANNYVDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPSDGKATYSRA  28260

Query  117    YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSCK-GSCM-LRWYWLGTR  168
                H GPCE+WLD   V   ++C+  +  +       + +DYSSC  G C  +R+YWL  +
Sbjct  28261  IQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQ  28440

Query  169    FLKNEHSWQVY  179
               +  +  WQ Y
Sbjct  28441  GVDGKTVWQSY  28473

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 12/89 (13%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKD---TKYAPL---AFLESQGFKTVEDFNGWRRSNGYKTLRAF  79
              DAH  +L+P   +  D       +  PL   +  +     +V  FN  + +N Y  L+  
Sbjct  25301  DAHGYMLIPESQFNGDKTSAWVVQIDPLWSSSDWDGNNEGSVTAFNSLKSANNYVDLKTL  25480

Query  80     MDGAKYTVTDGADYYCGFTNAKAAPQPIP  108
              MD ++     GA+  CGFTN    PQPIP
Sbjct  25481  MDSSEL----GAE--CGFTNPSGTPQPIP  25549

>PYIR:scaffold_1744 pir_scaffold_1744 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1744:1:5237:1 
REF
Length=5237

 Score = 88.2 bits (217),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 72/135 (53%), Gaps = 14/135 (10%)
 Frame = +1

Query  61    VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----ST  115
              + F    +S+ YK++R  ++ AK +   GA   CG +++  A QP+P   +      S 
Sbjct  1636  AKAFTAALKSSSYKSVRDLVN-AKASFISGASKECGISSSSGAKQPLPAQYVEWAHSSSE  1812

Query  116   GYT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLK  171
             G+T  H+GPCEVW D+     +DNC + +P     L Y  S C G+ MLR+YW+      
Sbjct  1813  GFTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----  1980

Query  172   NEHSWQVYKACIPLS  186
             +  +WQVY  C PLS
Sbjct  1981  HSSTWQVYINCAPLS  2025

 Score = 47.4 bits (111),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 30/67 (45%), Gaps = 6/67 (9%)
 Frame = -2

Query  121   GPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQV  178
             GPCEVW D       +NC   +PG    L Y  S C G+ ML   WL         + QV
Sbjct  3151  GPCEVWCDDVLAFSDENCATNYPGNPAKLPYDESKCIGASMLTSIWLALHV----PT*QV  2984

Query  179   YKACIPL  185
             Y  C PL
Sbjct  2983  YLNCAPL  2963

 Score = 26.2 bits (56),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 31/76 (41%), Gaps = 3/76 (4%)
 Frame = -3

Query  35    APTYTTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGAD  92
             +P+ T D  +    P  ++F       T      ++    Y +LR  +  A  T+  GA 
Sbjct  3390  SPSGTIDGPNALTVPTGMSFSTDSTSNTKAYTTAFKAQAKYDSLRDLV-FATQTLESGAS  3214

Query  93    YYCGFTNAKAAPQPIP  108
               CGF+      QP+P
Sbjct  3213  QECGFSLTNGTAQPLP  3166

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 32/70 (46%), Gaps = 6/70 (9%)
 Frame = -1

Query  118   THDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHS  175
             +H GPCEV  D+      +NC   +P     L  D + C G  +L+  W+         +
Sbjct  4748  SHQGPCEV*CDNVLAFSDENCVINYPEAPARLPYDMAKCTGVKILKSVWMVLHL----PA  4581

Query  176   WQVYKACIPL  185
             WQVY  C+ L
Sbjct  4580  WQVYLYCVSL  4551

>PYUU:scaffold_2036 scf1117875582036 dna:supercontig supercontig:pug:scf1117875582036:1:1090657:1 
REF
Length=1090657

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 13/128 (10%)
 Frame = +2

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
               F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  704531  FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  704686

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                  H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  704687  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  704860

Query  175     SWQVYKAC  182
                WQ Y  C
Sbjct  704861  RWQSYSKC  704884

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 13/125 (10%)
 Frame = -2

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
               F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  707613  FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  707458

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                  H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  707457  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  707284

Query  175     SWQVY  179
                WQ Y
Sbjct  707283  RWQSY  707269

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 13/125 (10%)
 Frame = -1

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
               F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  702481  FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  702326

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                  H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  702325  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  702152

Query  175     SWQVY  179
                WQ Y
Sbjct  702151  RWQSY  702137

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 70/125 (56%), Gaps = 13/125 (10%)
 Frame = -2

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
               F+T   +       GYK L++F+D    T        CG T + A  + IP DG ++ ++
Sbjct  697458  FRTGAQYAAVAPKKGYKDLKSFLDSKGPT--------CGNTLSNAKAKAIPKDGMLKFAS  697303

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                  H GPCE+WL +TR   +D+C +TF   T + +D+S+CKG+CMLR+YWLG +      
Sbjct  697302  SMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGGK  697129

Query  175     SWQVY  179
                WQ Y
Sbjct  697128  RWQSY  697114

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 66/125 (53%), Gaps = 13/125 (10%)
 Frame = -3

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
               F+T   +       GYK L++F++             CG +   A  +PIP DG ++ ++
Sbjct  713537  FRTGAQYAAVAPGKGYKDLKSFLEDKGPV--------CGNSLPDAKAKPIPSDGVIKLAS  713382

Query  116     GYTHDGPCEVWLDSTRVLQSDNCHETFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                  H GPCEVW D  R    D+C +TF   T + +D+S+CKGSCMLR+YWLG +      
Sbjct  713381  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGK  713208

Query  175     SWQVY  179
                WQ Y
Sbjct  713207  RWQSY  713193

>PYIR:scaffold_871 pir_scaffold_871 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_871:1:14137:1 
REF
Length=14137

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 84/181 (46%), Gaps = 26/181 (14%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYA-----PLAFLESQGFKTVED-------FNGWRRSNGY  73
              DAH  + +P PT+T     T+++     P       G     D       F    +++ Y
Sbjct  12938  DAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTY  12759

Query  74     KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
               ++RA ++ AK     GA   CG T+A    QP+P   +      S G+T  H GPCEVW
Sbjct  12758  DSVRALVE-AKGVFISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  12582

Query  127    LDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
               D+ +V   +NC + +P     L  D++ C G+ +L+  WL      +  +WQ+Y  C P
Sbjct  12581  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINCAP  12414

Query  185    L  185
              L
Sbjct  12413  L  12411

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 72/175 (41%), Gaps = 25/175 (14%)
 Frame = +1

Query  28    HQVVLLPAPTYTTDNKDTKYAPL-----AFLESQGFKTVED-------FNGWRRSNGYKT  75
             H  + LP PT++T   DT    L     A     G     D       FN   +++ YK+
Sbjct  2476  HGSMSLPKPTFSTQGGDTTQPGLNVDSSALTAPSGMSFTTDPTSNTNAFNAAIKTSAYKS  2655

Query  76    LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP------DGTMRSTGYTHDGPCEVWLDS  129
             ++  +  AK     GA+  CG T    A QP+P       G+      +H+GPCEVW D+
Sbjct  2656  VKDLI-AAKGVPIPGANKDCGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWCDN  2832

Query  130   TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                    NC + FP     L Y  S C G  +L+  WL         +WQ Y  C
Sbjct  2833  VLAFSDGNCAKNFPSAPAKLPYDKSKCVGKSVLKTIWLALH----SPTWQAYINC  2985

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 61/151 (40%), Gaps = 16/151 (11%)
 Frame = +2

Query  44     DTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAA  103
              D  Y   AF  +           ++    +  L+  ++  +  V  GAD  CG+T+    
Sbjct  10883  DAIYPGFAFNTAPEINVANFIKNFKNDTRHPNLKTLIEKNQKVVQAGADAKCGWTDPSKT  11062

Query  104    PQPIPDGTM--------RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK----TYNLDY  151
               +P+   ++           G+ H GPCE W D   V Q   C  T+  K       +D 
Sbjct  11063  SEPLEGSSIIYGRNFEGTGEGFVHPGPCETWCDDKMVQQDMTCDITYNVKDKAAIIPIDA  11242

Query  152    SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
              + CKG+  L  YW+      + + WQ+Y+ C
Sbjct  11243  AKCKGAKQLSTYWIAM----HGNEWQIYRTC  11323

 Score = 51.6 bits (122),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 32/70 (46%), Gaps = 6/70 (9%)
 Frame = +1

Query  118   THDGPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
             +H GPCEVW D     Q DNC  H T        D S C G  ML  +W+         +
Sbjct  6439  SHMGPCEVWCDDVMAFQDDNCSVHMTTAPAVLKYDKSKCVGKKMLTSFWIALHV----PT  6606

Query  176   WQVYKACIPL  185
             WQ+Y  C P+
Sbjct  6607  WQIYTNCAPI  6636

 Score = 27.3 bits (59),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 13/87 (15%)
 Frame = +3

Query  26    DAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNG  72
             DAH  + LPAPT            T D   T   P  +++       T     G++    
Sbjct  6123  DAHGKMSLPAPTCSAGYCSNSPSGTIDGPSTIPVPSGMSYGTDPQSNTNAYLAGFKAQTK  6302

Query  73    YKTLRAFMDGAKYTVTDGADYYCGFTN  99
             YKTL+     A   +  GA   CG+++
Sbjct  6303  YKTLKDLATSAAVKLEAGASKECGYSS  6383

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 58/142 (41%), Gaps = 30/142 (21%)
 Frame = +1

Query  64    FNGWRRSNGYKTLRAFMDGAKYT-----------VTDGADYYCGFTNAKAAPQPIPDGTM  112
             FN +   N    +  F +  ++T           V  GA   CG+T+       I   ++
Sbjct  8353  FNTYPEGNVNSFVEHFKNDTRFTSVRDMIQKHQKVIAGASEDCGYTDITKTKHTIKGSSV  8532

Query  113   --------RSTGY--THDGPCEVWLDSTRVLQSDNCHETFPGKTYN-----LDYSSCKGS  157
                        G+  +H+GPCEVW D   V Q+ NC   +P K  N     ++ + C  +
Sbjct  8533  FWGRNDAANREGFVDSHEGPCEVWCDDNMVQQNMNCVRAYPNKPGNAAEVPIEVAKCANA  8712

Query  158   CMLRWYWLGTRFLKNEHSWQVY  179
               L +YW+      NE  WQVY
Sbjct  8713  KKLTFYWVAMH--GNE--WQVY  8766

>PHSO:scaffold_10
Length=2388181

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 86/181 (48%), Gaps = 26/181 (14%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLE--SQGFK---------TVEDFNGWRRSNGYK  74
               +AH  +  PA T+ +   D K   +A +E  S GFK          V  F     ++ YK
Sbjct  492858  NAHGWLTKPAATFDSAAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFEASKYK  493034

Query  75      TLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPD----GTMRSTGYT--HDGPCEVWL  127
               +L+ F+D  AK TVT GA   CG     AA QP+P         S G+T  H+GPCE W 
Sbjct  493035  SLKEFIDDKAKITVT-GATLTCGIAEPDAAAQPVPAKLEWSHSDSEGFTSSHEGPCEAWC  493211

Query  128     DSTRVLQSDNCHETFPGKTYNLDYSS--CKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D TRV   +NC   F      + Y S  C G+ ML +YW+         +WQVY  C PL
Sbjct  493212  DDTRVFNDENCAANFKTAPAEMPYESSKCSGAKMLTFYWMAMHG----PTWQVYVNCAPL  493379

Query  186     S  186
               S
Sbjct  493380  S  493382

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 63/131 (48%), Gaps = 13/131 (10%)
 Frame = -3

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTG  116
               FN    ++ Y +L+ FM+     V+      CG+T    A QP+P+       G+     
Sbjct  455378  FNKGFSASMYSSLKEFMNDKMELVSADFTKECGYTKPDEAAQPLPETYVEWSHGSGEGFT  455199

Query  117     YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEH  174
                +H+GPCEVW D TRV Q DNC + FP     L Y   +C GS  L  YW+      +  
Sbjct  455198  SSHEGPCEVWCDETRVFQDDNCPKNFPAAPAKLPYDRDACMGSSRLTIYWIAL----HSP  455031

Query  175     SWQVYKACIPL  185
               SWQVY  C  L
Sbjct  455030  SWQVYINCAAL  454998

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 82/184 (45%), Gaps = 28/184 (15%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR-----------RSNGYK  74
               +AH  +  PA  + T    T++       + GF     FNG              S+ Y 
Sbjct  453399  NAHGYMSDPAVKFLTTGDPTQFIATIEASASGFSGT--FNGAPADNTAAFTTAFESSSYS  453572

Query  75      TLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
               +L+  + D A  TVTD A   CG  +     QP+PD  +      S G+T  H+GPCEVW
Sbjct  453573  SLKELINDKATITVTD-ATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCEVW  453749

Query  127     LDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
                D  RV Q D+C   +      L Y   +C GS  L +YWL      +  +WQVY  C P
Sbjct  453750  CDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLA----LHSSTWQVYVNCAP  453917

Query  185     LSSS  188
               L ++
Sbjct  453918  LEAT  453929

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 25/179 (14%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGF-----------KTVEDFNGWRRSNGYK  74
               +AH  + LPA T+  D   T++  +A +ES              +    F     S+ Y 
Sbjct  460711  NAHGYLGLPAVTFPNDVDKTQF--IATIESSASGFSGSFSGSPAENTAAFWTAFNSSQYS  460538

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
               +++ F+      V +GA+  CG T+    PQP+PD        + G+T  H+GPCE W D
Sbjct  460537  SIKEFVTDLGQIVANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEAWCD  460358

Query  129     STRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               +TRV Q  +C  H T        D + C G+  L +YWL         +WQVY  C  L
Sbjct  460357  NTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDCAAL  460193

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 84/185 (45%), Gaps = 29/185 (16%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
               D H  +  PA T+ + + D T++  +A +ES        F+G    N            Y
Sbjct  451971  DGHGYMTEPAVTFLSSSTDNTQF--IATIESSASDFSGTFSGSPADNTAAFTKAFEASSY  452144

Query  74      KTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                +L+  + D A  TVTD A   CG  +     QP+PD  +      + G++  H GPCEV
Sbjct  452145  TSLKELINDKATITVTD-ATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEV  452321

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D  RV Q D+C   +      L Y   +C G+  L +YWL      +  +WQVY  C 
Sbjct  452322  WCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLA----LHSSTWQVYINCA  452489

Query  184     PLSSS  188
               PL S+
Sbjct  452490  PLEST  452504

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 80/185 (43%), Gaps = 24/185 (13%)
 Frame = +2

Query  26      DAHQVVLLPAPTY----TTDNKDTKYAPLAFL---ESQGFKTVEDFNG---WRRSN--GY  73
               DAH  ++ P PT+     T+N     A   +L   +   + T  + N    W   N   Y
Sbjct  572897  DAHSHMIDPMPTWPVSWATNNFAATIAGQTYLPCPDGMSYSTAPELNTEAYWTAFNESSY  573076

Query  74      KTLRAFMDGAKYTVT----DGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWL  127
                +L+  +D      T      A   CGF+ A  + + IP   +     T  HDGPCEV+ 
Sbjct  573077  TSLKDLVDKTAEVQTLSPFGTATLECGFSLANGSARDIPSEYVEWNQLTEGHDGPCEVYC  573256

Query  128     DSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D     ++DNC E  PG    +  D S C+G+  L  YW+    L     WQVY  C+PL
Sbjct  573257  DDVLAFENDNCAENLPGSPSQWPYDVSKCEGASRLTAYWIALHGLP----WQVYINCVPL  573424

Query  186     SSSAR  190
               + S  
Sbjct  573425  TRSVN  573439

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 82/184 (45%), Gaps = 29/184 (16%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
               + H  +  PA T+ + + D T++  +A +ES        F+G    N            Y
Sbjct  465345  NGHGYLTEPAVTFLSSSTDNTQF--IATIESSASDFSGTFSGSPADNTAAFTKAFEASSY  465518

Query  74      KTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                +L+  + D A  TVTD A   CG        QP+PD  +      + G++  H GPCEV
Sbjct  465519  TSLKELINDKATITVTD-ATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEV  465695

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D  RV Q D+C   +      L Y   +C G+  L +YWL      +  +WQVY  C 
Sbjct  465696  WCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLA----LHSSTWQVYINCA  465863

Query  184     PLSS  187
               PL S
Sbjct  465864  PLES  465875

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 79/183 (43%), Gaps = 29/183 (16%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVED---FNGWRRSNGYKTLRAFMDG  82
               +AH  +  P PT++     T YA    ++ Q +  V D   + G    N      AF + 
Sbjct  469311  NAHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPVPDGMSYGGTPEGNTEAYWTAF-NA  469141

Query  83      AKYT-VTDGADYY---------------CGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEV  125
               +KYT + D AD                 CGF+ A    + +P     +  GY+H GPCEV
Sbjct  469140  SKYTSLKDLADKTMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGPCEV  468961

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D     + DNC   +P     L  D   C G+ M++ YW+    L     WQ+Y  C+
Sbjct  468960  WCDDKLAFEDDNCALHYPEVPAKLPYDVDVCAGASMIQSYWIALHGLP----WQLYLNCV  468793

Query  184     PLS  186
               PL+
Sbjct  468792  PLT  468784

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (48%), Gaps = 19/126 (15%)
 Frame = -1

Query  69      RSNGYKTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYTHDGP  122
                ++ Y +L+  + D  K T +D     CG+T     PQP+P+  +        G+T   P
Sbjct  456790  EASKYTSLKELITDLGKVTSSDFT-MECGYTT----PQPLPET*VEWAHGSGEGFTSSRP  456626

Query  123     CEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               CEVW D TRV + D+C   F   P K    D  +C G+  L +YWL      +  +WQVY
Sbjct  456625  CEVWCDDTRVFRDDDCAAHFTTAPAKV-PYDRDACLGASRLTFYWLAL----HSSTWQVY  456461

Query  180     KACIPL  185
                 C  L
Sbjct  456460  TNCAAL  456443

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 49/170 (29%), Positives = 72/170 (42%), Gaps = 42/170 (25%)
 Frame = +1

Query  32      LLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGA  91
               L P  T+ TD       P   +ES     VE+F    + + YK+++A ++  +  V+  A
Sbjct  467110  LFPDGTFNTD-------PTINVES----FVENF----KKSKYKSVKAMIEDNQVLVSKDA  467244

Query  92      DYYCGFTNAKAAPQPIPDGTMRST-------------GYTHDGPCEVWLDSTRVLQSDNC  138
                  CGF++    P     G +  T             G+ H GPCE W D  R  Q  NC
Sbjct  467245  TASCGFSD----PAQTSYGALNDTIYWGRNDDLTLDEGFVHMGPCETWCDDNRSQQDMNC  467412

Query  139     HETF---PGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                 T+    GK      +D S CK +  L +YW+      +  +WQVY  C
Sbjct  467413  QVTYTPASGKGAAPVPIDNSVCKNAKRLTFYWVAM----HGATWQVYSKC  467550

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/177 (24%), Positives = 64/177 (36%), Gaps = 23/177 (13%)
 Frame = -1

Query  28      HQVVLLPAPTY-----------TTDNKDTKYAPLAF-LESQGFKTVEDFNGWRRSNGYKT  75
               H  + LP PT+           T D+ +   AP     E       E +     ++ Y +
Sbjct  475078  HSKMSLPKPTWVFEEGTNSPAGTVDSSNVLPAPEGMGYEGDPLSNTEAYWTAFNASSYTS  474899

Query  76      LRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDST  130
               L+  +   +   TD     A    GF+      + +PD          HDGP E+W D  
Sbjct  474898  LKDLVWKNEVVNTDSLYGTATIESGFSWTNGTARDLPDQVEWDKLTEGHDGPLEIWCDDV  474719

Query  131     RVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                     N    +PG   T+  D ++C+G   L   W+          WQV+  C PL
Sbjct  474718  LAFSDQNAAVNYPGSPATFPYDKAACEGKSRLTTIWMALH----SPPWQVFTNCAPL  474560

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 59/141 (42%), Gaps = 19/141 (13%)
 Frame = -3

Query  33      LPAP---TYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTD  89
               LP P   +Y+TD  D   A      +  + ++ +F   + +   +T+  F          
Sbjct  472253  LPVPDGMSYSTDPYDNTEAYWTAFNASNYTSLLEFA--KETQVLQTMATF---------G  472107

Query  90      GADYYCGFTNAKAAPQPIPDGT-MRSTGYTHDGPCEVWLDSTRVLQ---SDNCHETFPGK  145
                A   CGF+ A    + +P+         +H+GP EVW D T V +   +   +  FP K
Sbjct  472106  TATAECGFSLANGTARDLPEQVEWNQLTSSHEGPIEVWCDDTLVFKDWYAALDYTGFPAK  471927

Query  146     TYNLDYSSCKGSCMLRWYWLG  166
                   D S CKG+ ML   WL 
Sbjct  471926  -LPYDVSKCKGASMLTSVWLA  471867

 Score = 33.5 bits (75),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 6/52 (12%)
 Frame = -2

Query  137     NCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               N    +P    NL Y  S C+G+ +L  YW+      +   WQVY  C PL+
Sbjct  479757  NAAVDYPDTPANLPYDNSKCEGAAVLTSYWIAL----HTTPWQVYTNCAPLT  479614

>PYAP:scaffold_558 pag1_scaffold_558 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_558:1:21510:1 
REF
Length=21510

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 15/102 (15%)
 Frame = +1

Query  95     CGFTNAKAAPQPIP-------DGTMRSTGY--THDGPCEVWLDSTRVLQSDNCHETFPG-  144
              CG ++ K  PQ +        + T   TG+  +H GPCE+W+D TRV+  DNC   F G 
Sbjct  19522  CGKSSGKGKPQSVEGLSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGY  19701

Query  145    -KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                   ++YS CKG CMLR+YWL      +E  WQVYK C+P+
Sbjct  19702  PAKMPVNYSVCKGECMLRFYWLAL----HEPEWQVYKNCVPI  19815

>PHKE:scaffold_155 scf_22126_155.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_155.1:1:75875:1 
REF
Length=75875

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 64/132 (48%), Gaps = 13/132 (10%)
 Frame = +2

Query  63     DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRST  115
              +FN    ++ Y +L+ FM       +      CG+TN K A QP+P+       G+    
Sbjct  41075  NFNKGMAASKYTSLKEFMAAKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGF  41254

Query  116    GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
                +H+GPCEVW D TRV Q DNC   FP     L Y   +C GS +L  YW+      + 
Sbjct  41255  TSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HS  41422

Query  174    HSWQVYKACIPL  185
               SWQVY  C  L
Sbjct  41423  PSWQVYINCAAL  41458

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 78/177 (44%), Gaps = 21/177 (12%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGF---------KTVEDFNGWRRSNGYKTL  76
              +AH  + LP  T+  D  +T++       + GF         +    F     S+ Y +L
Sbjct  30956  NAHGHLGLPTVTFPNDVDNTQFIATVESSASGFSGAFSGSPAENTAAFTAAFNSSKYSSL  31135

Query  77     RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLDST  130
              + F+      V  GA+  CG T+    PQP+PD        + G+T  H+GPCE W D T
Sbjct  31136  KDFVTSLGQIVATGANIECGLTDPNETPQPLPDHLEWTHSDTEGFTSSHEGPCEAWCDDT  31315

Query  131    RVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              RV + +NC   F      + Y  + C G+  L +YW+         +WQVY  C  L
Sbjct  31316  RVFKDENCAAHFTTAPAKMPYDDAGCDGASRLTFYWVALH----SPTWQVYANCAAL  31474

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 88/185 (48%), Gaps = 30/185 (16%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR-----------RSNGYK  74
              + H  +  PA T+ T N  T++  +A +E+        FNG              S+ Y 
Sbjct  43056  NGHGYMSDPAVTFLTSNDPTQF--IATIEASDSGLSGTFNGAPADNTAAFTTAFESSSYS  42883

Query  75     TLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVW  126
              +L+ F+ D A  TVTD A   CG  +   A Q +PD  +      S G+T  H+GPCEVW
Sbjct  42882  SLKEFINDKATITVTD-ATLTCGSCDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVW  42706

Query  127    LDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               D TRV Q D+C   + T P +    D+ +C GS  +  YWL         +WQVY  C 
Sbjct  42705  CDDTRVFQDDDCAADYTTAPAQ-LPFDHDACLGSSTVTLYWLALH----SSTWQVYVNCA  42541

Query  184    PLSSS  188
              PL ++
Sbjct  42540  PLETT  42526

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 62/130 (48%), Gaps = 15/130 (12%)
 Frame = +1

Query  69     RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
               S+ Y +L+  +       +      CG+TN     QP+PD  +      S G+T  H+G
Sbjct  39688  ESSKYSSLKELVTDLGKLTSTSYTTECGYTNPDETAQPLPDTYVEWAHSDSEGFTPSHEG  39867

Query  122    PCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              PCEVW D  RV Q D+C   + T P K    D+ +C GS  L  YWL      +  +WQV
Sbjct  39868  PCEVWCDDVRVFQDDDCAAHYTTAPAK-LPYDHDACLGSSRLTLYWLA----LHSSTWQV  40032

Query  179    YKACIPLSSS  188
              Y  C  L S+
Sbjct  40033  YTNCAALEST  40062

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 57/120 (48%), Gaps = 8/120 (7%)
 Frame = +2

Query  69     RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWL  127
               S+ YK+L+      + T+ DGA   CGF+     P+ +PD         +H GPCEVW 
Sbjct  12767  NSSKYKSLKELAWDTQ-TLADGASNECGFSLVDGTPRELPDMVQWDFFTASHQGPCEVWC  12943

Query  128    DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D T   + +NC   +P    NL Y  + C GS +L  YW+          WQ+Y  C PL
Sbjct  12944  DDTLTFEDENCALNYPDTPANLPYDKAKCAGSAVLTSYWIALH----TTPWQIYTNCAPL  13111

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 65/129 (50%), Gaps = 15/129 (12%)
 Frame = -3

Query  70     SNGYKTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
              S+ Y +L+  + D A  TVTD A   CG  +     QP+P+  +      S G+T  H+G
Sbjct  44289  SSKYTSLKELINDLATITVTD-ATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEG  44113

Query  122    PCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
              PCEVW D  RV Q  +C   +      L  D+ +C G+  L +YWL      +  +WQVY
Sbjct  44112  PCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLA----LHSSTWQVY  43945

Query  180    KACIPLSSS  188
                C PL ++
Sbjct  43944  VNCAPLETT  43918

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 78/180 (43%), Gaps = 25/180 (14%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
              + H  +  PA T+ + + D T++       + GF              F     S+ Y +
Sbjct  23988  NGHGYMTDPAVTFLSSSTDNTQFIATIESSASGFSGTFSGSPADNTAAFTTAFESSSYTS  23809

Query  76     LRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
              L+  +   A  TVTD A   CG  +     QP+P   +      S G+T  H+GPCEVW 
Sbjct  23808  LKELISALATVTVTD-ATLTCGSCDPDETAQPLPATYVEWSHSDSEGFTSSHEGPCEVWC  23632

Query  128    DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D  RV Q D+C   +      L Y   +C G+  L ++WL      +  +WQVY  C PL
Sbjct  23631  DDVRVFQDDDCAVDYTSAPAELPYDRDACLGASTLTFFWLA----LHSSTWQVYVNCAPL  23464

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 78/182 (43%), Gaps = 29/182 (16%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVE---DFNGWRRSNGYKTLRAFMDG  82
              +AH  V  P PT++     T YA L  ++ Q +        + G   SN     +AF + 
Sbjct  19638  EAHSYVTNPMPTWSVGYPSTNYAGL--IDGQKYLPCPKGLSYGGTPESNTNAYWKAF-NA  19808

Query  83     AKYT-VTDGADYY---------------CGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEV  125
              +KYT + D AD                 CGF+      + +P        G +H GPCEV
Sbjct  19809  SKYTSLKDLADKTMVLQTLSPFGKATAECGFSIKNGTARALPKEVQWHDFGLSHQGPCEV  19988

Query  126    WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              W D     +  NC   +P    +L Y  S C+G+ M++ YW+    L     WQ+Y  CI
Sbjct  19989  WCDGKLAFEDKNCALNYPEVPASLPYDKSVCEGASMMQSYWIAVHGLP----WQLYLNCI  20156

Query  184    PL  185
              PL
Sbjct  20157  PL  20162

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 68/160 (43%), Gaps = 21/160 (13%)
 Frame = +1

Query  33     LPAP---TYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTD  89
              LP P   +Y+TD  D   A         + +++D     ++   +T+  F          
Sbjct  18034  LPVPDGMSYSTDPYDNTEAYWTAFNESSYTSLKDLI--TKTAEVQTMETF---------G  18180

Query  90     GADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
               A   CGF+ A    + +P+    S    +H+GPCEVW D T V +  NC   +      
Sbjct  18181  TATLECGFSLANGTARGLPEEVEWSQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAK  18360

Query  149    LDYSS--CKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              L Y S  C G+ ML  YWL    L     WQVY  C PL+
Sbjct  18361  LPYDSSKCSGTSMLTSYWLALHGLP----WQVYINCAPLT  18468

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 75/181 (41%), Gaps = 25/181 (14%)
 Frame = +3

Query  26     DAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNG  72
              +AH  ++LP PT+           T + +D    P  L++       TV  +  +  SN 
Sbjct  16302  NAHSYMILPLPTWPVSWGTNSPSGTIEGEDYLPVPDGLSYSTDPYDNTVAYWTAFNASN-  16478

Query  73     YKTLRAFMDGAKYTVT----DGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWL  127
              Y +L  F    +   T      A   CGF+      + +P +        +H+GPCEVW 
Sbjct  16479  YTSLLEFAKETQVLQTMATFGAATAECGFSLTNGTARDLPAEVEWNQLTSSHEGPCEVWC  16658

Query  128    DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D T V +  NC   +      L  D S C+G+ ML   WL    L     WQVY  C PL
Sbjct  16659  DDTLVFEDWNCALDYTSDPAKLPYDVSKCEGASMLTSVWLALHALP----WQVYTNCAPL  16826

Query  186    S  186
              +
Sbjct  16827  T  16829

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 46/100 (46%), Gaps = 11/100 (11%)
 Frame = +2

Query  91     ADYYCGFTNAKAAPQPIPDGTM---RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTY  147
              A   CG++      + +PD       +TG  HDGPCE+W D T V    NC   +P    
Sbjct  14822  ATIECGYSWTNGTARDLPDEVQWDKLTTG--HDGPCEIWCDDTLVFADQNCAVNYPDSPA  14995

Query  148    NLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              +  Y  ++CKG  ML   WL      +   WQV+  C PL
Sbjct  14996  SFPYNKAACKGKSMLTAIWLAV----HSPPWQVFTNCAPL  15103

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 75/182 (41%), Gaps = 37/182 (20%)
 Frame = -1

Query  27     AHQVVLLPAPTYTTDNKD-TKYA---------PLAFLESQGFKTVEDFNGWRRSNGYKTL  76
              AH  ++ P   + + N D T+Y+         P     +     +  F    + + YK+L
Sbjct  22280  AHGYLVQPLVKFISQNIDITQYSSTIDSYKLFPDGTFNTDPKINIASFMEHLKKSPYKSL  22101

Query  77     RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-------------GYTHDGPC  123
              +A ++  +  V+  A   CGFT+    P     G +  T             G+ H GPC
Sbjct  22100  KAMINANQVLVSKDATPTCGFTD----PDQTHYGALNDTIIFGRSPDVSIAEGFVHPGPC  21933

Query  124    EVWLDSTRVLQSDNCHETFP------GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
              E W D  +V Q+ +C E +       G    +  ++C  +  L +YW+G     +  +WQ
Sbjct  21932  ETWCDDNQVQQNMHCDEAYNPKSGGGGAPMPIKKAACANAKRLTFYWIGM----HGPTWQ  21765

Query  178    VY  179
              VY
Sbjct  21764  VY  21759

>PYIW:scaffold_3542 piw_scaffold_3542 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3542:1:2951:1 
REF
Length=2951

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 88/184 (48%), Gaps = 26/184 (14%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
             +AH  V  P   YT     T + A      ++GF          + V+ F       GYK
Sbjct  1884  EAHGFVSQPKAQYTGGGSYTSFSAEFTASVNKGFSGYIFNRSPEQNVQQFTAAWSKTGYK  1705

Query  75    TLRAFMD----GAKYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
             +L+  MD    G  ++ TD A     G ++ K       +G + S    H GPCE W+D+
Sbjct  1704  SLKELMDKQVPGCGFSRTDIAAVDVSGMSSMKFQNNEYKEGFLGS----HHGPCEGWIDN  1537

Query  130   TRVLQSDNCHETFPGKTYN--LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
             T+V  SD+C +++PG   N  + Y++CKG+C L +YWL      +   WQ YK C+P+ +
Sbjct  1536  TKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLAL----HSQKWQAYKHCVPIKA  1369

Query  188   SARR  191
              A R
Sbjct  1368  GAAR  1357

>PHRA:scaffold_29
Length=529199

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 85/182 (47%), Gaps = 28/182 (15%)
 Frame = -2

Query  28      HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR-----------RSNGYKTL  76
               H  +  PA T+ T N  T++       + GF     FNG              S+ Y +L
Sbjct  474511  HGYLSDPAVTFLTTNDPTQFIATIEATASGFSGT--FNGAPADNTAAFTTAFESSSYSSL  474338

Query  77      RAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
               + F+D  A  TVTD A   CG  +     QP+P+  +      S G+T  H+GPCEVW D
Sbjct  474337  KEFIDDKATITVTD-ATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASHEGPCEVWCD  474161

Query  129     STRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                 RV Q D+C   F      L  D+ +C GS +L +YWL      +  +WQVY  C PL 
Sbjct  474160  DVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLA----LHSSTWQVYVNCAPLE  473993

Query  187     SS  188
               SS
Sbjct  473992  SS  473987

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 86/185 (46%), Gaps = 29/185 (16%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSN-----------GY  73
               + H  +  P  T+T    D T+Y  +A +ES        FNG    N            Y
Sbjct  437763  NGHGYMTDPKVTFTAQAGDPTQY--IATIESTASGLTGTFNGAPSDNVAAFTKAFGSSKY  437590

Query  74      KTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
                +L+ F+ D A  TVT GA   CG  + K   QP+P  TM      S G+T  H+GPCEV
Sbjct  437589  SSLKEFINDKATVTVT-GATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCEV  437413

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D  R  Q D+C   +P     L  D  +C GS  L +YW+      +  +WQVY  C 
Sbjct  437412  WCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMA----MHSSTWQVYVNCA  437245

Query  184     PLSSS  188
               PL+S+
Sbjct  437244  PLAST  437230

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 63/132 (48%), Gaps = 13/132 (10%)
 Frame = +3

Query  63      DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
               +FN    ++ Y +L+ FM      V       CG+TN   A QP+P   +        G+
Sbjct  472503  NFNKGFAASKYSSLKEFMADKLVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGF  472682

Query  118     T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
               T  H+GPCEVW D TRV Q DNC + FP     L Y   +C GS  L  YW+      + 
Sbjct  472683  TASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIAL----HS  472850

Query  174     HSWQVYKACIPL  185
                SWQVY  C  L
Sbjct  472851  ASWQVYINCAAL  472886

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 79/179 (44%), Gaps = 25/179 (14%)
 Frame = +2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGF-----------KTVEDFNGWRRSNGYK  74
               DAH  + LPA T+     +T++  +A +ES                 E F     S+ Y 
Sbjct  466571  DAHGHLGLPAVTFPNSVDNTQF--IATIESSTSGFSGSFSGSPAANTEAFWTAFNSSKYS  466744

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
               +++ F+      V DGA+  CG T+    PQPIPD        + G+T  H+GPCE W D
Sbjct  466745  SIKEFVTDLGQIVADGANIECGLTDPNETPQPIPDELEWTHSDTEGFTSSHEGPCEAWCD  466924

Query  129     STRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                T+V    +C   F      +  D + C G+  L +YWL         +WQVY  C  L
Sbjct  466925  GTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALH----SSTWQVYVNCAAL  467089

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 82/180 (46%), Gaps = 24/180 (13%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
               + H  +  PA T++ +  D T++       + G K          V  F     S+ YK+
Sbjct  442429  NGHGYMTKPAATFSAEAGDKTQFIATIDSSTSGLKGTFNTAPADNVASFTKAFASSKYKS  442250

Query  76      LRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
               L+A +D  AK TVT GA   CG  +  AA Q +P         S G+T  H+GPCEVW D
Sbjct  442249  LKALIDDKAKVTVT-GATLTCGTADPAAAAQALPKTVEWSHSESEGFTASHEGPCEVWCD  442073

Query  129     STRVLQSDNCHETFPGKTYNLDYSS--CKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                 R  Q +NC   F      L Y S  C+G+  L +YW+         SWQVY  C  LS
Sbjct  442072  DVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWMAMH----GPSWQVYVNCANLS  441905

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 57/116 (49%), Gaps = 17/116 (15%)
 Frame = +2

Query  95      CGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDSTRVLQSDNC---HETFPG  144
               CG+TN     QP+P        G+      +H+GPCEVW D  RV Q D+C   + T P 
Sbjct  471305  CGYTNPDETAQPLPKTYVEWAHGSGEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPA  471484

Query  145     KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESA  200
               K    D+ +C G+  L +YWL      +  +WQVY  C  L  +     GAA++ A
Sbjct  471485  KV-PYDHDACLGASRLTFYWLAL----HSSTWQVYTNCAALEKTTST--GAASKYA  471631

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 79/183 (43%), Gaps = 25/183 (14%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
               + H  +  PA T+ + + D T++       + GF              F     S+ Y +
Sbjct  475992  NGHGYMTEPAVTFLSSSTDNTQFIATIESSASGFSGTFSGSPADNTAAFTTAFASSSYTS  475813

Query  76      LRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
               L+  + G A  TVTD A   CG  +     Q +P   +      + G+T  H+GPCEVW 
Sbjct  475812  LKDLITGLATVTVTD-ATLTCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEGPCEVWC  475636

Query  128     DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D  RV   D+C   +      L Y   +C G+  L +YWL      +  +WQVY  C PL
Sbjct  475635  DDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLA----LHSSTWQVYVNCAPL  475468

Query  186     SSS  188
                ++
Sbjct  475467  ETT  475459

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 60/126 (48%), Gaps = 15/126 (12%)
 Frame = -1

Query  70      SNGYKTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDG  121
               S+ Y +L+  + G A  TVTD A   CG  +     Q +P   +      + G+T  H+G
Sbjct  462443  SSSYTSLKDLITGLATVTVTD-ATLTCGSCDPDETAQALPAEYVEWSHSSTEGFTSSHEG  462267

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               PCEVW D  RV   D+C   +      L Y   +C G+  L +YWL      +  +WQVY
Sbjct  462266  PCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLA----LHSSTWQVY  462099

Query  180     KACIPL  185
                 C PL
Sbjct  462098  VNCAPL  462081

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 60/122 (49%), Gaps = 10/122 (8%)
 Frame = +2

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVW  126
                ++ YK+L+     ++ T+ DGA   CGF+      Q +P   ++   +T  H GPCEVW
Sbjct  451505  NASTYKSLKELAWDSQ-TLADGASNECGFSVVDGTAQDLP-AEVQWDFFTASHQGPCEVW  451678

Query  127     LDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
                D T V ++ NC   +P    NL Y  + C  S +L  YW+          WQVY  C P
Sbjct  451679  CDDTLVFENWNCAVDYPETPANLPYDKAKCASSSVLTSYWIALHTTP----WQVYTNCAP  451846

Query  185     LS  186
               L+
Sbjct  451847  LT  451852

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/205 (27%), Positives = 80/205 (39%), Gaps = 48/205 (23%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVED---FNGWRRSNGYKTLRAFMDG  82
               +AH  +  P PT++     T YA    ++ Q +    D   + G    N      AF + 
Sbjct  457995  EAHSYMTDPMPTWSVGYPTTNYA--GLIDGQDYLPCPDGMSYGGTPEGNTDAYWTAF-NA  458165

Query  83      AKYTVTDG----------------ADYYCGFTNAKAAPQPIPDGTMRST---------GY  117
               +KYT                    A   CGF+        +P+GT R+          G 
Sbjct  458166  SKYTSLKNLADKTMVLQSLNPFGKATAECGFS--------LPNGTARNLPAEVQWHDFGL  458321

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHS  175
               +H GPCEVW D        NC   +P    +L  D   C G+ M++ YW+    L     
Sbjct  458322  SHQGPCEVWCDDKLAFMDQNCALNYPEVPASLPYDVDVCAGASMMQSYWIALHGLP----  458489

Query  176     WQVYKACIPLSSSARRLEGAANESA  200
               WQ+Y  C+PL+    +L   AN  A
Sbjct  458490  WQLYLNCVPLTG---KLNSTANNVA  458555

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 74/182 (41%), Gaps = 27/182 (15%)
 Frame = +3

Query  26      DAHQVVLLPAPTY-----------TTDNKDTKYAPLAF-LESQGFKTVEDFNGWRRSNGY  73
               DAH  + LP PT+           T D+ +   AP     E       E +     ++ Y
Sbjct  453141  DAHSKMSLPKPTWIYEGGTNSPAGTIDSSNVLPAPDGMGYEGDPLSNNEAYWTAFNASKY  453320

Query  74      KTLRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIPDGTM---RSTGYTHDGPCEVW  126
                +L+  +   +   TD     A   CGF+      + +PD       +TG  HDGPCE+W
Sbjct  453321  TSLKELVWKNEVVNTDSIYGTATIECGFSWTNGTARDLPDEVQWDKLTTG--HDGPCEIW  453494

Query  127     LDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
                D T      NC   +P    ++  D ++C+G  ML   WL          WQV+  C P
Sbjct  453495  CDDTLAFSDQNCAVNYPDTPASFPYDKAACEGKSMLTAIWLAVH----SPPWQVFTNCAP  453662

Query  185     LS  186
               LS
Sbjct  453663  LS  453668

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 45/95 (47%), Gaps = 7/95 (7%)
 Frame = +3

Query  95      CGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DY  151
               CGF+ A    + +P +        +H+GPCEVW D T V +  NC   +      L  D 
Sbjct  455277  CGFSLANGTARDLPAEVEWNQLTSSHEGPCEVWCDDTLVFEDWNCALDYTSDPAKLPYDV  455456

Query  152     SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               S CKG+ ML   WL    L     WQVY  C PL+
Sbjct  455457  SKCKGASMLTSIWLALHALP----WQVYTNCAPLT  455549

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 65/151 (43%), Gaps = 28/151 (19%)
 Frame = -3

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-----  115
               V  F    + + YK+++A ++  +  V D A   CGF++    P     G +  T     
Sbjct  460710  VASFVENLKKSSYKSVKAMIEDNQVLVADDATASCGFSD----PAQTSYGALNDTIYWGR  460543

Query  116     --------GYTHDGPCEVWLDSTRVLQSDNCHETF---PGK---TYNLDYSSCKGSCMLR  161
                       G+ H GPCE W D  +  Q  NC  T+    GK      +D S CK +  L 
Sbjct  460542  NDDLTLDEGFVHMGPCETWCDGNQAQQDMNCQVTYTPASGKGAAPVPIDSSVCKNAKRLT  460363

Query  162     WYWLGTRFLKNEHSWQVY-KACIPLSSSARR  191
               +YW+      +  +WQVY K C  L  ++R 
Sbjct  460362  FYWVAM----HGATWQVYSKFC*LLVPTSRN  460282

 Score = 29.3 bits (64),  Expect(2) = 0.62, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 17/31 (55%), Gaps = 4/31 (13%)
 Frame = +1

Query  152     SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
               + C+G+ MLR YW+    L     WQVY  C
Sbjct  456844  AKCEGTSMLRLYWIALHGLP----WQVYINC  456924

 Score = 25.0 bits (53),  Expect(2) = 0.62, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 27/67 (40%), Gaps = 5/67 (7%)
 Frame = +3

Query  68      RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWL  127
               R  N   T      G  Y+ TD A Y      A+  P+ +    +     +H GP EVW 
Sbjct  456600  RGDNQGDTFLPVPSGMSYS-TDPA-YSLASGKARDLPEEVERNQL---ALSHQGPREVWC  456764

Query  128     DSTRVLQ  134
               D T V +
Sbjct  456765  DDTLVFE  456785

>PYUU:scaffold_2029 scf1117875582029 dna:supercontig supercontig:pug:scf1117875582029:1:1550222:1 
REF
Length=1550222

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 65/122 (53%), Gaps = 14/122 (11%)
 Frame = +1

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
               YK++RA +D AK     G D  CG T+A  A QP+P   +      S G+T  H GPCEV
Sbjct  503371  YKSMRALVD-AKGVFQPGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCEV  503547

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D+TRV Q DNC + +      L Y  S C G+ ML+ YWL      +  +WQ Y  C 
Sbjct  503548  WCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLAL----HSSTWQAYINCA  503715

Query  184     PL  185
               PL
Sbjct  503716  PL  503721

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 76/175 (43%), Gaps = 20/175 (11%)
 Frame = -2

Query  26      DAHQVVLLPAPTY-----TTDNKDTKYAPLAFLESQGFKTVED-------FNGWRRSNGY  73
               +AH  + LP PT+     T     T   P A     G     D       +    +S+ Y
Sbjct  478078  EAHSKMSLPKPTWDNGYGTNSPSGTIDGPTALKVPSGMSFSTDPTSNTKAYTAAIKSSSY  477899

Query  74      KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTRV  132
                +L+A     + T   GA   CGF+    A QP+PD         +H+GPCEVW D+T  
Sbjct  477898  GSLKALAFATQKT-ESGATKECGFSKTNGAAQPLPDTVQWDELTSSHEGPCEVWCDNTMA  477722

Query  133     LQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                  DNC + +PG    L Y  S C G+ ML   WL      +  +WQVY  C P+
Sbjct  477721  FHDDNCAKNYPGSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  477569

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 71/176 (40%), Gaps = 20/176 (11%)
 Frame = +2

Query  26      DAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNG  72
               DAH  + LP PT+           T D   T   P  ++F       T      ++    
Sbjct  490187  DAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQTK  490366

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTR  131
               YK+L+         V  GA   CGF++    PQP+PD         +H GPCEVW D   
Sbjct  490367  YKSLKDLAMSDAQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVM  490546

Query  132     VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               V Q DNC    P     L Y  + C G  ML  +W+         +WQ+Y  C P+
Sbjct  490547  VFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHV----PTWQIYTNCAPI  490702

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 74/180 (41%), Gaps = 24/180 (13%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKDTKY----------APLAF-LESQGFKTVEDFNGWRRSNGYK  74
               DAH  + +P PT+T +   T++          AP      +        F    +++ YK
Sbjct  461944  DAHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAALKTSSYK  462123

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-------DGTMRSTGYTHDGPCEVWL  127
               ++R   +        GA   CG+T+A  A QP+P        G+      +H GPCEVW 
Sbjct  462124  SVRDLWNAKGVLGVTGATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCEVWC  462303

Query  128     DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D+       NC + +P     L  D++ C G  ML  YWL          WQ Y  C PL
Sbjct  462304  DNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALH----SPQWQAYINCAPL  462471

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 14/123 (11%)
 Frame = -1

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
               YK++RA +D AK     G +  CG T+     QP+P   +      S G+T  H GPCEV
Sbjct  474155  YKSVRALVD-AKGVFQPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCEV  473979

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D+     +DNC   +P     L  D S C G  ML++YWL      +  +WQ Y AC 
Sbjct  473978  WCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTWQAYIACA  473811

Query  184     PLS  186
               PL+
Sbjct  473810  PLA  473802

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 14/123 (11%)
 Frame = +2

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
               YK++RA +D AK     G +  CG T+     QP+P   +      S G+T  H GPCEV
Sbjct  464888  YKSVRALVD-AKGVFQPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCEV  465064

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D+     +DNC   +P     L  D S C G  ML++YWL         +WQ Y AC 
Sbjct  465065  WCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIACA  465232

Query  184     PLS  186
               PL+
Sbjct  465233  PLA  465241

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 14/123 (11%)
 Frame = +2

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
               YK++RA +D AK     G +  CG T+     QP+P   +      S G+T  H GPCEV
Sbjct  467468  YKSVRALVD-AKGVFQPGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCEV  467644

Query  126     WLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W D+     +DNC   +P     L  D S C G  ML++YWL         +WQ Y AC 
Sbjct  467645  WCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIACA  467812

Query  184     PLS  186
               PL+
Sbjct  467813  PLA  467821

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 77/176 (44%), Gaps = 21/176 (12%)
 Frame = +1

Query  26      DAHQVVLLPAPTY-----TTDNKDTKYAPLAFLESQG--FKTVEDFN------GWRRSNG  72
               DAH  + LP PT+     T     T   P A     G  F T    N       ++    
Sbjct  470326  DAHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTKAFTAAFKAQTK  470505

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTR  131
               YK+L+  +  A  TV  G    CGF+     PQP+PD         +H+GPCE+W D+  
Sbjct  470506  YKSLKDLV-FATQTVESGTTKECGFSLVSGTPQPLPDVVEWDELTPSHEGPCEIWCDNKL  470682

Query  132     VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                  ++NC + +PG    L Y  S C G+ ML   WL      +  +WQVY  C PL
Sbjct  470683  AFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLAL----HTPTWQVYTNCAPL  470838

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 75/178 (42%), Gaps = 25/178 (14%)
 Frame = +2

Query  28      HQVVLLPAPTYTTDNKDTKYA----PLAFLESQGFKTVED-------FNGWRRSNGYKTL  76
               H  + +P PT+      T++       A     G     D       F    +++ YK++
Sbjct  487547  HGSMSVPKPTFAIQGDTTQFGLTVDSTALTAPSGMSFTTDPESNTKAFTAALKASSYKSV  487726

Query  77      RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-------GTMRSTGYTHDGPCEVWLDS  129
               +  +  AK     GA+  CG T +    QP+PD       G+      +H GPCEVW D+
Sbjct  487727  KDLI-AAKGVPIAGANKECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVWCDN  487903

Query  130     TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               T V   DNC + +P     L Y  S C G  +L+  WL      +  +WQ Y +C  L
Sbjct  487904  TLVFSDDNCAKNYPAAPAQLPYEKSKCVGKSVLKTVWLAL----HSPTWQAYISCAAL  488065

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 71/176 (40%), Gaps = 21/176 (12%)
 Frame = +3

Query  26      DAHQVVLLPAPTY-----------TTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNG  72
               DAH  + LP PT+           T D       P  ++F       T      ++    
Sbjct  472290  DAHSKMALPKPTWDPAWGTNSPSGTIDGPSVLTPPSGMSFSTDPASNTKAYTAAFKAQTK  472469

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTR  131
               Y +++  +D A   +  GA   CGF+    A QP+PD         +H+GPCEVW D   
Sbjct  472470  YTSMKQMVD-ATQKLESGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWCDDKL  472646

Query  132     VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                   +NC   +P     L Y  S C G+ ML   WL         +WQVY  C PL
Sbjct  472647  AFSDENCAINYPDSPAKLPYDKSKCTGAKMLTSVWLALHV----PTWQVYYNCAPL  472802

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 71/176 (40%), Gaps = 26/176 (15%)
 Frame = +3

Query  26      DAHQVVLLPAPTY----------TTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKT  75
               +AH  + +PAP +          +T   D  Y   AF  +           ++    +  
Sbjct  496803  NAHGFLAIPAPFFKTGVDITSYTSTIMGDATYPGFAFNTAPSINMENFVKNFKNDAKHPN  496982

Query  76      LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR--------STGYTHDGPCEVWL  127
               LRA ++     V  GAD  CG+T+       + + T+           G+ H GPCE W 
Sbjct  496983  LRALVEKEAKVVATGADAQCGWTDPSKTSYTLTNSTITYGRNFEGTGEGFVHPGPCETWC  497162

Query  128     DSTRVLQSDNCHETF--PGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               D   V Q  +C ET+  P K     +D + CKG+  L  YW+        + WQVY
Sbjct  497163  DDVMVQQDMHCDETYNKPNKAAVIPIDVAKCKGAKQLTTYWIAMH----GNEWQVY  497318

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 57/122 (47%), Gaps = 11/122 (9%)
 Frame = -3

Query  64      FNGWRRSNGYKTLR-AFMDGAKYTVTDG--ADYYCGFTNAKAAPQPIPDGTMRSTGYTHD  120
                  + +   +KTL+   MD  KY V DG   D  CG T+ K   QP+PD  +      H 
Sbjct  614445  VEAFAKQTKWKTLKDLIMD--KY-VEDGNIPDRACGLTD-KTYMQPLPDKYVVWQAGQHP  614278

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
               GPCEVW D  RV   ++C   +PG     D S C G  +L   +LG    +    WQVY 
Sbjct  614277  GPCEVWCDDVRVFADNDCATNYPGINLPYDRSKCVGKKVLWSMFLGMHVPQ----WQVYM  614110

Query  181     AC  182
                C
Sbjct  614109  GC  614104

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 57/131 (44%), Gaps = 14/131 (11%)
 Frame = -1

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT  118
               F     ++ Y ++R  ++     +T GA   CG T     PQP+P   +      + G+T
Sbjct  498764  FTKALANSSYTSVRELVEDKGVFIT-GATKTCGITEETEDPQPLPAKYVEWSHSSTEGFT  498588

Query  119     --HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEH  174
                 H GPCEVW D       +NC   +      L Y  + C G+ +L+  WL      +  
Sbjct  498587  ASHQGPCEVWCDDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLKIVWLA----LHSS  498420

Query  175     SWQVYKACIPL  185
               +WQ+Y  C  L
Sbjct  498419  TWQIYINCATL  498387

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 73/185 (39%), Gaps = 30/185 (16%)
 Frame = +2

Query  26      DAHQVVLLPAP---------TYTTDNKDTKYAPLAFLESQGFKTVEDFNG-WRRSNGYKT  75
               +AH  ++ P P          YT+    T   P     +     V  F   ++    YK 
Sbjct  494567  NAHGFLVDPPPDFLPGIDITAYTSTIIGTSLYPDGIFNTYPEGNVNSFVAHFKNDTRYKN  494746

Query  76      LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM--------RSTGY--THDGPCEV  125
               +R  M   +  V  GA   CG+T+   +   I   ++           G+  +H+GPCEV
Sbjct  494747  IRD-MIVKEQKVISGASEDCGYTDITKSKHKINGSSVYWGRNDAANREGFVDSHEGPCEV  494923

Query  126     WLDSTRVLQSDNCHETFPGK-----TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
               W D   V  + NC   +P K        +D + C G+  L +YW+      NE  WQVY 
Sbjct  494924  WCDDNMVQTNMNCVRAYPNKPGHAAEVPIDVAKCAGAKKLTFYWIAMH--GNE--WQVYS  495091

Query  181     ACIPL  185
                 + L
Sbjct  495092  KYLQL  495106

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (42%), Gaps = 28/113 (25%)
 Frame = -1

Query  86      TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY--------------THDGPCEVWLDSTR  131
               TV  GA   CGF++      P    T+ S+ +              +H+GPCE W D   
Sbjct  442274  TVVSGATASCGFSS------PNTKQTLSSSVWWGKNTDLTGEGFVESHEGPCEAWCDDEM  442113

Query  132     VLQSDNCHETF----PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
               V+Q+ NC   +          +D S C G+    +YW+      NE  WQVY 
Sbjct  442112  VMQNTNCATAYNKAGQAAEVPIDNSKCSGASQFTFYWIAMH--TNE--WQVYS  441966

>PLHA:NW_020187244.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_323, whole genome shotgun sequence
Length=2746546

 Score = 86.3 bits (212),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 12/130 (9%)
 Frame = +2

Query  64       FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM----RSTGYT-  118
                FN    S+ Y +++ F++     VT GA+  CG TN  + PQP+P+        + G+T 
Sbjct  2022764  FNEAFDSSKYSSIKDFINNFGKIVTHGANLECGLTNPNSTPQPLPNEIQWTHSDTEGFTP  2022943

Query  119      -HDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHS  175
                 H+GPCE W D TRV    NC   FP     L  D + C G+  L +YWL         +
Sbjct  2022944  SHEGPCEAWCDYTRVFHDGNCAAHFPTAPARLPFDRTGCLGANRLTFYWLALH----SPT  2023111

Query  176      WQVYKACIPL  185
                WQ+Y  C PL
Sbjct  2023112  WQIYVNCAPL  2023141

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/165 (31%), Positives = 71/165 (43%), Gaps = 28/165 (17%)
 Frame = +1

Query  32      LLPAPT---YTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVT  88
               +LP P+   YTT++     A      S  FKT+++   W                  T+ 
Sbjct  373669  VLPVPSGMSYTTNSASNTKAYWTAFNSSKFKTLKEL-AWESQ---------------TLV  373800

Query  89      DGADYYCGFTNAKAAPQPIPDGTMRS--TGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
               D A   CGF+     PQ +PD       TG +H GPCEVW D      + NC   +P   
Sbjct  373801  DNASKECGFSVVDGTPQVLPDMVQWDFFTG-SHQGPCEVWCDDILAFTNWNCAVDYPQTP  373977

Query  147     YNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
                NL Y  S C+G+ +L  YW+          WQVY  C PL+ ++
Sbjct  373978  ANLPYDKSKCQGASVLSSYWIALHTTP----WQVYTNCAPLTGAS  374100

>PHRA:scaffold_89
Length=200592

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 18/124 (15%)
 Frame = -2

Query  92      DYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPG-  144
               D  CG+T     PQPIP DG ++       G+TH GPCE+++D T VL  D+C E +PG 
Sbjct  124517  DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  124338

Query  145     -------KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAAN  197
                          +DYSSC G C L  YWL  +  +    WQ Y  C+ L  S    +    
Sbjct  124337  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQTQTQ  124170

Query  198     ESAA  201
                S+A
Sbjct  124169  TSSA  124158

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 54/99 (55%), Gaps = 18/99 (18%)
 Frame = -1

Query  95      CGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
               CG T+  A+PQPIP DG  +       G+TH GPCE++LD T VL SDNC + +PG    
Sbjct  129429  CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  129250

Query  149     --------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
                       +DYSSC G C L  YWL  +  +    WQ Y
Sbjct  129249  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAY  129145

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 51/104 (49%), Gaps = 18/104 (17%)
 Frame = +2

Query  90      GADYYCGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               G D  CG T+  AAPQ +P DG  +       G+TH GPCE+++D   VL  DNC + +P
Sbjct  112349  GEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYP  112528

Query  144     GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               G            +DYSSC G C    YWL  +       WQ Y
Sbjct  112529  GGDVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQ----NAQWQAY  112648

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 57/115 (50%), Gaps = 18/115 (16%)
 Frame = -1

Query  92      DYYCGFTNAKAAPQPI-PDGTM-----RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145
               +Y CG+T     P+ I  DG          G+TH GPCE++LD T +L  DNC + + G 
Sbjct  123198  EYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGG  123019

Query  146     TYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
                 +        +DYSSC G+C L  YWLG    +NE  WQ Y   +     A R+
Sbjct  123018  ADDSGIMSDMPIDYSSCNGACTLAIYWLG---FQNEQ-WQAYSEWVEQQLPAVRM  122866

 Score = 35.0 bits (79),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 4/31 (13%)
 Frame = -2

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               +DYSSC G+C L  YWLG    +NE  WQ Y
Sbjct  194978  IDYSSCNGACTLAIYWLG---FQNEQ-WQAY  194898

>PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:pug:scf1117875581402:1:979788:1 
REF
Length=979788

 Score = 85.5 bits (210),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 90/194 (46%), Gaps = 34/194 (18%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
               +AH  V  P  TY   +  T Y A +    ++GF          +  + F       GYK
Sbjct  153863  EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  153684

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT---MRSTGY------THDGPCEV  125
               +L+  MD A           CG++N  AAP  +   +    ++  Y      +H GPCE 
Sbjct  153683  SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  153528

Query  126     WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W+D+TRV   D+C   FPG   T  + Y SCKG+C L +YWL     K    WQ YK+C+
Sbjct  153527  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  153360

Query  184     PLSSSARRLEGAAN  197
                + ++A   E +++
Sbjct  153359  AIKNNAYSEERSSD  153318

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 90/194 (46%), Gaps = 34/194 (18%)
 Frame = -3

Query  26      DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
               +AH  V  P  TY   +  T Y A +    ++GF          +  + F       GYK
Sbjct  150271  EAHGYVSQPKGTYNGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  150092

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT---MRSTGY------THDGPCEV  125
               +L+  MD A           CG++N  AAP  +   +    ++  Y      +H GPCE 
Sbjct  150091  SLKQMMDKAVPG--------CGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHGPCEG  149936

Query  126     WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               W+D+TRV   D+C   FPG   T  + Y SCKG+C L +YWL     K    WQ YK+C+
Sbjct  149935  WIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQAYKSCV  149768

Query  184     PLSSSARRLEGAAN  197
                + ++A   E +++
Sbjct  149767  AIKNNAYSEERSSD  149726

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 85/192 (44%), Gaps = 38/192 (20%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
               +AH  +  P   YT  +  T Y A +    ++GF          +  + F       GYK
Sbjct  148097  EAHGYISQPKAQYTGGSSYTSYSAEITASSNKGFNGYIFNRSPEQNTQQFTAAWPKTGYK  147918

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
               +L+  MD A      G    CG++    AP  +    M S  +           +H GPC
Sbjct  147917  SLKQMMDKA----VPG----CGYSRTDIAPVDV--SRMSSMKFQNNEYKEGFLASHHGPC  147768

Query  124     EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               E W+D+TRV   D+C   FPG   T  + + +CKG+C L +YWL     K    WQ YK+
Sbjct  147767  EGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK----WQAYKS  147600

Query  182     CIPLSSSARRLE  193
               C+P+  +A   E
Sbjct  147599  CVPIKYNAYSAE  147564

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 70/130 (54%), Gaps = 29/130 (22%)
 Frame = -2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------T  118
               S+ YK+LR  +D A   V D     CGFT     P  +   +++S  +           +
Sbjct  159914  SSSYKSLREMLDSA---VPD-----CGFTLTDGTPVDV--SSLKSMKWQNDQEQKGFIDS  159765

Query  119     HDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
               H GPCE+W+D T+++ SD+C   +  +P +   +DYS CKG C L +YWL      +E +
Sbjct  159764  HHGPCELWIDDTKIMHSDDCRADYTAYPAEI-PVDYSVCKGKCQLTFYWLAL----HEPN  159600

Query  176     WQVYKACIPL  185
               WQ+YK C+P+
Sbjct  159599  WQIYKQCVPI  159570

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 13/90 (14%)
 Frame = -1

Query  116     GYTHDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKN  172
               G +  GPCE+WL++TRVL +D+C   + T+P     ++YS CKG+C+L +YWL       
Sbjct  164199  GLSS*GPCEIWLNNTRVLHNDDCVATYTTYPA-VLPVNYSVCKGNCILTFYWLALH----  164035

Query  173     EHSWQVYKACIPLSSSARRLEGAANESAAI  202
               E +WQ+Y AC      A  L G+   SA +
Sbjct  164034  EPNWQIYSACF-----ATLLGGSLKCSAKL  163960

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = -1

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWL  165
               GPCEVW+D+T   Q ++C + FPG    +DYSSC+G C+LR+YWL
Sbjct  139998  GPCEVWIDNTLRFQREDCSKVFPGAI-KMDYSSCQGDCVLRFYWL  139867

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 56/119 (47%), Gaps = 23/119 (19%)
 Frame = -1

Query  72      GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT---MRSTGY------THDGP  122
               GYK+L+  +D A           CG +    AP  +   T    ++  Y      +H GP
Sbjct  158388  GYKSLKEMLDPAAPD--------CGLSLPDVAPIDVSSMTEFKFQNNEYKEGFIASHRGP  158233

Query  123     CEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               CE+W+  TR    D+C   FPG   T   D+S CKG+C + +YWL      +  +WQ+Y
Sbjct  158232  CELWIGDTRAWHYDDCAAKFPGYPATIPTDFSVCKGTCRVTFYWLAL----HSPNWQIY  158068

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 9/71 (13%)
 Frame = -2

Query  120     DGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHS  175
                GPCEVW+D+TRV   ++C   ++T+P     ++Y++CK S C L +YWL      +E +
Sbjct  162098  QGPCEVWIDNTRVFHHNDCVAAYKTYPA-VLPINYAACKTSKCTLTFYWLAL----HEPN  161934

Query  176     WQVYKACIPLS  186
               WQ+Y   + LS
Sbjct  161933  WQIYSKFLLLS  161901

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 37/61 (61%), Gaps = 6/61 (10%)
 Frame = -1

Query  121     GPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
               GPCE+W++ T+  Q+++C  + T     + +DYS CKG C+L +Y +      +E  WQ+
Sbjct  178404  GPCEIWINDTKAFQTNDCRGYTTEYPAVFPVDYSVCKGDCVLTFYLVAV----HEPQWQI  178237

Query  179     Y  179
               Y
Sbjct  178236  Y  178234

>PYUU:scaffold_1789 scf1117875581789 dna:supercontig supercontig:pug:scf1117875581789:1:837833:1 
REF
Length=837833

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 70/151 (46%), Gaps = 42/151 (28%)
 Frame = +2

Query  61      VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM----RST  115
               + DF    +  GYKTLR+F++        GA   CG+T     P+ IP DG +     + 
Sbjct  698186  MNDFARISKQKGYKTLRSFLE------NKGAS--CGYTEPNTTPRAIPRDGKVIFAHSNV  698341

Query  116     GYTH-------------------------DGPCEVWLDSTRVLQSDNCHETFPG--KTYN  148
               G+ H                          GPCE+WLD+  +L  DNC + FPG      
Sbjct  698342  GFVHPVRTAT*MSLSCCCMKAHLDVSRFPQGPCELWLDNKMILHKDNCQKAFPGVKAVMP  698521

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               +D+SSCKG+CMLR YWLG  F      WQ Y
Sbjct  698522  VDFSSCKGTCMLRMYWLG--FQDQGQRWQTY  698608

>PLHA:NW_020189511.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2604, whole genome shotgun sequence
Length=604050

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 84/177 (47%), Gaps = 22/177 (12%)
 Frame = -1

Query  27      AHQVVLLPAPTYTTDNKD---TKYAPL---AFLESQGFK-TVEDFNGWRRSNGYKTLRAF  79
               AH  +  P PT+ +   +    +  PL    + +S+G +  +  F      N YK +R  
Sbjct  431475  AHGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLSTFKELAAKNNYKNVRTL  431296

Query  80      MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
               MDG      D     CGFT+ K  P  P  DGT   S G  H GPCE+W +   +LQ+D+
Sbjct  431295  MDGNPAFGED-----CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMILQNDD  431131

Query  138     CHETFPGKTYN-------LDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
               C   +   T         + YS C  G  +LR+YWL  + L+ +  WQ YK CIPL+
Sbjct  431130  CQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPLT  430960

>PHKE:scaffold_250 scf_22126_250.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_250.1:1:52150:1 
REF
Length=52150

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 82/179 (46%), Gaps = 24/179 (13%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
              + H  +  P   +T    D T+Y       + GFK          V DF     ++ YK+
Sbjct  12648  NGHGYMTKPNVKFTATAGDPTQYVATIQASASGFKGAFNGKPSDNVADFTKAFGASKYKS  12827

Query  76     LRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT--HDGPCEVWLD  128
              L+ ++ D AK TVT GA   CG  +    PQP+P         S G+T  H+GPCEVW D
Sbjct  12828  LKEYVEDKAKITVT-GATLECGSCDPDQTPQPVPKTVEWSHSDSEGFTASHEGPCEVWCD  13004

Query  129    STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               TR  Q DNC   F      L Y  S C G+  L +YW+      +  +WQVY  C PL
Sbjct  13005  GTRAFQDDNCPAHFTMIPAELPYEQSKCTGASRLTFYWMA----MHSDTWQVYVNCAPL  13169

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 79/179 (44%), Gaps = 24/179 (13%)
 Frame = -2

Query  26     DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKT  75
              + H  +  P  T++    D T++       S GF+          V  F    +++ YK+
Sbjct  45453  NGHGWMTKPEATFSASAGDKTQFVATIGSSSTGFEGSYNSAPADNVASFTKAFKASSYKS  45274

Query  76     LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
              L+A +D        GA   CG  +  AA QP+P  T+      S G+T  H+GPCE W D
Sbjct  45273  LKALIDDKAKITVSGATLTCGSADPSAAAQPLPS-TLEWSHSDSEGFTPSHEGPCEAWCD  45097

Query  129    STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                RV Q +NC   FP     + Y  SS  G+  L +YW+         SWQVY  C  L
Sbjct  45096  DVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----SWQVYVNCAAL  44932

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 65/137 (47%), Gaps = 12/137 (9%)
 Frame = +2

Query  61     VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD----GTMRSTG  116
              V  F    +++ YKTL+A +D        GA   CG  +  AAPQP+P         S G
Sbjct  17264  VASFTKAFKASKYKTLKALIDDKTKISVPGATLTCGSADPNAAPQPLPAKLEWAHSDSEG  17443

Query  117    YT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKN  172
              ++  H+GPCE W D+TRV   +NC   F      + Y  S C G+  L ++W+       
Sbjct  17444  FSPSHEGPCEAWCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAMHGP--  17617

Query  173    EHSWQVYKACIPLSSSA  189
                SWQVY  C  LS S 
Sbjct  17618  --SWQVYVNCATLSGSG  17662

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 77/183 (42%), Gaps = 24/183 (13%)
 Frame = +1

Query  28     HQVVLLPAPTY----TTDNKDTKYAPLAFL---ESQGFKTVEDFNG---WRRSN--GYKT  75
              H  ++ P PT+    +T+N     A   +L   +   + T  + N    W   N   Y +
Sbjct  19948  HSYMVDPMPTWPVSWSTNNFAATIAGQTYLPCPDGMSYSTAPELNTEAYWTAFNESSYTS  20127

Query  76     LRAFMD--GAKYTVT--DGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDS  129
              L+  +D  G   T++    A   CGF+ A    + +P   +     T  HDGPCEVW D 
Sbjct  20128  LKDLVDQTGEVQTLSPFGTATLECGFSLANGTARDLPSQYVEWNQLTEGHDGPCEVWCDD  20307

Query  130    TRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                  Q DNC   +P     +  D S C  +  L  YW+    L     WQVY  C+PL+ 
Sbjct  20308  VLAFQDDNCAVNYPESPSQWPYDVSKCSSASQLTAYWIALHGLP----WQVYINCVPLTG  20475

Query  188    SAR  190
              S  
Sbjct  20476  SVN  20484

>PYAP:scaffold_583 pag1_scaffold_583 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_583:1:20637:1 
REF
Length=20637

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 92/194 (47%), Gaps = 38/194 (20%)
 Frame = +2

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPL----AFLESQGFK---TVED----FNGWRRSNGYK  74
             DAH  + LP  +Y      T Y  +    A+   QGFK   + ED    F    R+ G+ 
Sbjct  6185  DAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFS  6364

Query  75    TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-------RSTGY--THDGPCEV  125
             +LRA +D A           CG +    AP  +   ++          G+  +H GPCE 
Sbjct  6365  SLRALLDPAAPG--------CGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCEA  6520

Query  126   WLDSTRVLQSDNCHETFPG--KTYNLDYSSCKG--SCMLRWYWLGTRFLKNEHSWQVYKA  181
             W+D+TRV   D+C   F G   T  ++Y++C    +C+L +YWL      +E +WQVYK 
Sbjct  6521  WIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQVYKQ  6688

Query  182   CIPL--SSSARRLE  193
             C+P+    SAR+L 
Sbjct  6689  CVPIKRGGSARQLR  6730

>PYIR:scaffold_3497 pir_scaffold_3497 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_3497:1:1521:1 
REF
Length=1521

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 80/180 (44%), Gaps = 25/180 (14%)
 Frame = -1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPL----AFLESQGFKTVED-------FNGWRRSNGYK  74
             DAH  + +P PT+T     T++A      A     G     D       F    +++ YK
Sbjct  1236  DAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKAFTAAIKTSAYK  1057

Query  75    TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
             ++R  ++ AK  +  GA   CG T+A   PQP+P   +      S G+T  H GPCEVW 
Sbjct  1056  SVRDLIN-AKGVMMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGPCEVWC  880

Query  128   DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             D      +DNC + +P     L  D+S C G  +L   WL      +  +WQ Y  C  L
Sbjct  879   DDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQAYINCAVL  712

>PHCA:scaffold_22 PHYCAscaffold_22
Length=843021

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 85/176 (48%), Gaps = 21/176 (12%)
 Frame = +3

Query  26      DAHQVVLLPAPTYTTDNKD---TKYAPLAFLES---QGFKTVEDFNGWRRSNGYKTLRAF  79
               DAH  +L+P   ++         +  P+   +S       +VE F   + +N +K L+  
Sbjct  399141  DAHGYMLIPESQFSGSANSAWIVQIDPVWASDSWDGNNAGSVETFKSLKSANNFKDLKTL  399320

Query  80      MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDN  137
               MD    T   GAD  CGFTN     QPIP DG    S    H GPCE+WLD T+VL  D+
Sbjct  399321  MDD---TSVYGAD--CGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWLDDTKVLYEDD  399485

Query  138     CHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRFLKNEHSWQVYKACIPL  185
               C+  +  +       + +DYSSC  G C  +R+YWL  + +  +  WQ Y   + L
Sbjct  399486  CYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYSKFLVL  399653

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 15/130 (12%)
 Frame = +1

Query  60      TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
               +V+ F   + +N +K L+  MD    T   GAD  CGFT+     QPIP DG    S   
Sbjct  396592  SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGKAQPIPSDGKATFSRAI  396756

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
                H GPCE+WLD T+VL  D+C+  +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  396757  VHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQG  396936

Query  170     LKNEHSWQVY  179
               +  +  WQ Y
Sbjct  396937  VDGKTVWQSY  396966

>PYIR:scaffold_573 pir_scaffold_573 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_573:1:20947:1 
REF
Length=20947

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 71/126 (56%), Gaps = 17/126 (13%)
 Frame = +1

Query  72    GYKTLRAFMD----GAKYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVW  126
             GYK+L+  +D    G  +T+TDGA     G  + K        G + S    H GPCEVW
Sbjct  5425  GYKSLKEMLDLSVPGCGFTLTDGAPVDVSGLKSMKWQNDQEQKGFIDS----HHGPCEVW  5592

Query  127   LDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             +D+T+++ SD+C   +  +P +   +DYS CKG C L +YWL      +E +WQ+YK C+
Sbjct  5593  IDNTKIMHSDDCRADYTAYPAE-IPVDYSKCKGKCQLTFYWLAL----HEPNWQIYKQCV  5757

Query  184   PLSSSA  189
             P+ + +
Sbjct  5758  PIQNGS  5775

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 58/113 (51%), Gaps = 21/113 (19%)
 Frame = +1

Query  87     VTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPCEVWLDSTRVLQS  135
              + D A   CG+T+  AAP  +    + S  Y           +H GPCE W+D+T+V   
Sbjct  15814  MMDAAVPGCGYTDPNAAPVDV--SKLSSMKYQNNEYKEGFLNSHHGPCEGWIDNTKVFHY  15987

Query  136    DNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              D+C ++FPG   T  + ++SCKG+C L +YWL        HS +     IP++
Sbjct  15988  DDCVKSFPGYPATIPMSFASCKGNCRLTFYWLAL------HSQKXXXXSIPVN  16128

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 42/62 (68%), Gaps = 8/62 (13%)
 Frame = +3

Query  121   GPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
             GPCE+W+D+TRVL +D+C   ++T+P     +DYS CKG C L +YWL      +E +WQ
Sbjct  2799  GPCEIWIDNTRVLHNDDCVATYKTYPA-VLPVDYSKCKGKCTLTFYWLAL----HEPNWQ  2963

Query  178   VY  179
             +Y
Sbjct  2964  IY  2969

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = +2

Query  118   THDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
             +H GPCE+W+ +T+    D+C   FPG   T   D+S CKG+C + +YWL      +   
Sbjct  7358  SHHGPCELWVGNTKAWHYDDCSAKFPGYPATIPTDFSVCKGTCRVTFYWLAL----HSQK  7525

Query  176   WQVYKACIPL  185
             WQ+Y A I L
Sbjct  7526  WQIYSASIIL  7555

>PLHA:NW_020186941.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_20, whole genome shotgun sequence
Length=72972

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 71/131 (54%), Gaps = 16/131 (12%)
 Frame = -2

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              K+V+ F   + +N +K L+  MD + +    GA   CGF++ K  PQPIP DG    S  
Sbjct  30125  KSVKTFQKLKAANKFKDLKTLMDTSAF----GAK--CGFSDPKGKPQPIPKDGKATFSRA  29964

Query  117    YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSCM-LRWYWLGTR  168
                H GPCE+WLD+ +VL  D+C+  +     N+      DYSSC  G C  +R+YWL  +
Sbjct  29963  IVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQ  29784

Query  169    FLKNEHSWQVY  179
               +  +  WQ Y
Sbjct  29783  GVNGKTVWQSY  29751

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = +1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              K+V+ F   + +N +K L+  MD        G D  CG+++    PQPIP DG    S  
Sbjct  40627  KSVKAFQSLKAANNFKDLKTLMDNPVL----GRD--CGYSDPNGKPQPIPKDGKATFSRA  40788

Query  117    YTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL------DYSSC-KGSC-MLRWYWLGTR  168
                H GPCE+WLD+ +VL  D+C+  +     N+      DYSSC  G C  +R+YWL  +
Sbjct  40789  MVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQ  40968

Query  169    FLKNEHSWQVY  179
               +  +  WQ Y
Sbjct  40969  GINGKTFWQSY  41001

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 16/131 (12%)
 Frame = +1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DG-TMRSTG  116
              ++V+ +   + +N +K L+  M+      T      CGF++ K  PQPIP DG    S  
Sbjct  55945  QSVKAYQSLKAANNFKDLKTLME------THALGPECGFSDPKGKPQPIPKDGKATLSRA  56106

Query  117    YTHDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTR  168
                H GPCE+WLD+ +VL  D+C+  +  +         +DYSSC  G C  +R+YWL  +
Sbjct  56107  IVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQ  56286

Query  169    FLKNEHSWQVY  179
               +K    WQ Y
Sbjct  56287  GIKGITFWQSY  56319

>SADI:scaffold_91 supercont1.91 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.91:1:209005:1 
REF
Length=209005

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 80/173 (46%), Gaps = 32/173 (18%)
 Frame = -1

Query  27      AHQVVLLPAPTYTTDNKDTKYAPL--AFL----ESQGFKTVEDFN-GWRRSNGYKTLRAF  79
                H V+  P   +  D   T Y     AFL    +      V +FN  +   + YKTLR  
Sbjct  158020  GHGVISSPMAEFIPDVMRTTYVATIQAFLPGKFDDSPATNVANFNKAFAAQSQYKTLRDL  157841

Query  80      MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDST  130
               +D        G D  CG T    AP+PIP DG M      TG     +H GPCE+WLD+ 
Sbjct  157840  LD------LSGPD--CGNTRTNVAPKPIPSDGMMTWQNPDTGEGFIPSHTGPCEIWLDNN  157685

Query  131     RVLQSDNCHETF---PGKTYNLDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVY  179
               RV Q+DNC   F   P     +DY+ C    CMLR+YWL      ++  WQVY
Sbjct  157684  RVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLAL----HQPQWQVY  157538

>PYAP:scaffold_187 pag1_scaffold_187 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_187:1:47143:1 
REF
Length=47143

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 25/145 (17%)
 Frame = +2

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD---GTMRST  115
              +  + F    + +G K+LR  MD  KY         CG TN    P+ +      T ++ 
Sbjct  10010  QNTQVFTDAFKQSGLKSLRELMD--KYVPG------CGNTNPNTTPRDVTKLKTMTYQNN  10165

Query  116    GY------THDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLG  166
               Y      +H GPCEVW+D+TRV Q+++C   ++++P     +DYS CKG+C L +YWL 
Sbjct  10166  EYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPA-ALPVDYSKCKGTCRLTFYWLA  10342

Query  167    TRFLKNEHSWQVYKACIPLSSSARR  191
                  K    WQ YK C+P+   A R
Sbjct  10343  LHSQK----WQAYKQCVPIKYGASR  10405

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 94/200 (47%), Gaps = 39/200 (20%)
 Frame = -2

Query  26     DAHQVV------LLPAPTYTTDNKD--TKYAPLAFLESQGFK-----TVEDFNGWRRSNG  72
              DAH  +       +P   YT  N +   K   +A  + + F        + F    + +G
Sbjct  11706  DAHGYISQPRPDFIPGKMYTDINAEFTAKQTGIAAFQGKIFNWSPEHNTQVFTDAFKQSG  11527

Query  73     YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-GTMR------STGY--THDGPC  123
               K+LR  MD  KY         CG TN    P+ +    TM         G+  +H GPC
Sbjct  11526  LKSLRQLMD--KYVPG------CGNTNPNTTPRDVTKLKTMNWQNNEYKEGFLASHRGPC  11371

Query  124    EVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
              EVW+D+TRV Q+++C   ++++P  +  +DYS CK S CMLR+YWL      +   WQ Y
Sbjct  11370  EVWIDNTRVFQNNDCAGNYKSYPA-SLPVDYSKCKSSKCMLRFYWLAL----HSEKWQAY  11206

Query  180    KACIPLSSSARRLEGAANES  199
              K C+P+   A R     +ES
Sbjct  11205  KQCVPIKYGASRSMDDEDES  11146

 Score = 33.1 bits (74),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (51%), Gaps = 4/51 (8%)
 Frame = -3

Query  121   GPCEVWLDSTRVLQSDNC---HETFPGKT-YNLDYSSCKGSCMLRWYWLGT  167
             GPCE W+D+  + +  +C   + T+P +   N         C+LR+YW+  
Sbjct  7418  GPCETWIDNELLQRRVDCVSTYRTYPAQIPINFGRCPIGKICVLRFYWIAV  7266

>PYIW:scaffold_360 piw_scaffold_360 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_360:1:20022:1 
REF
Length=20022

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 87/190 (46%), Gaps = 33/190 (17%)
 Frame = +2

Query  26    DAHQVVLLPAPTYTTDNK-----------DTKYAPLAFLESQGFKTVEDFNGWRRSNGYK  74
             DAH  + LPAPT+    K           +TK  P A        T   F    + NG+K
Sbjct  2582  DAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRA--------TAATFAANYKKNGFK  2737

Query  75    TLRAF-MDG---AKYT-VTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLD  128
             +LRAF MD     KY     G    CGFT+    PQP+PD        + H+GPCE W D
Sbjct  2738  SLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCD  2917

Query  129   STRVLQ-SDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                V+  + +C     G    + Y  + C G  ML +YWL T F+     +Q Y  C+P+
Sbjct  2918  DVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLAT-FVS---PFQAYTNCVPI  3085

Query  186   SS-SARRLEG  194
              S +AR L+G
Sbjct  3086  KSGAARSLDG  3115

 Score = 34.3 bits (77),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 46/120 (38%), Gaps = 15/120 (13%)
 Frame = +2

Query  83    AKYTVT----DGADYYCGFTNAKAAPQPIPDGTMRSTGYTHD-GPCEVWLDSTRV--LQS  135
             AKY  T     G    C F +    PQP+     R     H  GPCE   D   +  ++ 
Sbjct  956   AKYGFTALRPSGGTPQCSFADPNDTPQPLIGNLARPRRSFHQSGPCEA*CDVHVMPCIKH  1135

Query  136   DNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
                 E F  K  ++  S  +G  +L  +W    F       QVY +C P++    R+ G 
Sbjct  1136  GKA*EAF-TKQDDVR*SQGRGKTLLSLFWFAMHF-------QVYVSCAPINRDGARVAGG  1291

>PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:pug:scf1117875582028:1:960197:1 
REF
Length=960197

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 86/192 (45%), Gaps = 38/192 (20%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYAP-LAFLESQGFK----------TVEDFNGWRRSNGYK  74
               +AH  + +P  TY  D   T +   L    +  F+            + F     + GY 
Sbjct  821813  EAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAAGYS  821634

Query  75      TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
               +L+A +D     V  G    CG  N++    P+    + +  +           +H GPC
Sbjct  821633  SLKALLD----PVAPG----CG--NSRVDVPPVGVSRLAAMEFRNDEFHEGFVNSHHGPC  821484

Query  124     EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               EVW+D+ R+   D+C   F G   T  +++S C+G C L +YWL      +E +WQVYK 
Sbjct  821483  EVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQ  821316

Query  182     CIPLSSSARRLE  193
               C+P+ +  +RL 
Sbjct  821315  CVPIENQGKRLR  821280

>PHCA:scaffold_8 PHYCAscaffold_8
Length=1194346

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (50%), Gaps = 39/139 (28%)
 Frame = -3

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------  118
                + GYK+LR  +D          DY  GF+   A P       +  TGYT          
Sbjct  824207  NATGYKSLREMVDPI------ATDY--GFSVKTATP-------VDVTGYTEMWWQNDEYK  824073

Query  119     ------HDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRF  169
                     H+GPCE W+D TR+   DNC    +T+P K    DYSSCKG C+  +YWL    
Sbjct  824072  EGFIASHEGPCEGWIDDTRIFHYDNCAAQFKTYPAK-IPADYSSCKGDCLFSFYWLAL--  823902

Query  170     LKNEHSWQVYKACIPLSSS  188
                 +E +WQ+YK C+P++++
Sbjct  823901  --HEPNWQIYKQCVPITNN  823851

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 8/76 (11%)
 Frame = -1

Query  118     THDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               +H+GPCE W+D TR+   DNC    +T+P K    DYSSCKG C+  +YWL       E 
Sbjct  820354  SHEGPCEAWIDDTRIFHYDNCAAQFKTYPAKV-PADYSSCKGDCLFVFYWLALH----EP  820190

Query  175     SWQVYKACIPLSSSAR  190
                WQ+YK C+P++++ +
Sbjct  820189  DWQIYKQCVPITNNGK  820142

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 26/128 (20%)
 Frame = -1

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDG  121
               +KTL+A MD A           CG T+      P+   +++S  +           +H G
Sbjct  815269  FKTLKAMMDTAAPD--------CGKTSLTGK-APVDVSSLKSMTWQNDQEQKGFIDSHRG  815117

Query  122     PCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               PCE W+D TRV  SD+C   + G      +D+SSC G C   +YWL      +E +WQVY
Sbjct  815116  PCEGWIDDTRVFHSDDCRGDYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVY  814949

Query  180     KACIPLSS  187
               K C  +++
Sbjct  814948  KQCAAITN  814925

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 41/76 (54%), Gaps = 8/76 (11%)
 Frame = -3

Query  111     TMRSTGYTHDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGT  167
               T R T +   GPCE W+D+T+V   D+C     ++P K    DYSSCKG C   +YWL  
Sbjct  817238  TFRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKI-PTDYSSCKGECKFVFYWLAL  817062

Query  168     RFLKNEHSWQVYKACI  183
                   +  +WQVY   I
Sbjct  817061  ----HSPTWQVYSTLI  817026

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 40/76 (53%), Gaps = 8/76 (11%)
 Frame = +3

Query  111     TMRSTGYTHDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGT  167
               T R T +   GPCE W+D+T+V   D+C     ++P K    DYSSCKG     +YWL  
Sbjct  850308  TFRLTRFHTQGPCEAWIDNTKVFHYDDCSGDFRSYPAKI-PTDYSSCKGERKFVFYWLAL  850484

Query  168     RFLKNEHSWQVYKACI  183
                   +  +WQVY   I
Sbjct  850485  ----HSPTWQVYSTLI  850520

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 7/65 (11%)
 Frame = -3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
               GPCE W+D+  V   D+C   FP     +  DYSSCKG  C+  +YWL      +   WQ
Sbjct  818906  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPEWQ  818739

Query  178     VYKAC  182
               +Y  C
Sbjct  818738  IYSTC  818724

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 6/62 (10%)
 Frame = +3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
               GPCE+WLD   V++S+NC   FP       +DYSSC   C+LR+Y L    ++    WQ 
Sbjct  821658  GPCELWLDEVVVVKSNNCAVAFPTNPAICAVDYSSCSECCVLRFYALALTGVE----WQA  821825

Query  179     YK  180
               + 
Sbjct  821826  FS  821831

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 4/49 (8%)
 Frame = +3

Query  111     TMRSTGYTHDGPCEVWLDSTRVLQSDNCH---ETFPGKTYNLDYSSCKG  156
               + R T +   GPCE W+D+T+V   D+C     ++P K    DYSSCKG
Sbjct  831366  SFRLTRFHTQGPCETWIDNTKVFHYDDCSGDFRSYPAKIPT-DYSSCKG  831509

>PHRA:scaffold_131
Length=101106

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 63/131 (48%), Gaps = 17/131 (13%)
 Frame = +1

Query  62     EDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY-CGFTNAKAAPQPIP-DGTMR--STGY  117
              E  + W   N   +L+      +Y  T G D   CG T    APQP+P DG  +  + G 
Sbjct  95980  EAVDSWFTKNNIASLK------EYITTYGTDISECGVTKKNGAPQPVPSDGYAQHDNLGN  96141

Query  118    THDGPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
              +H GPCE+W D TRV    NC   F G++     +D S+CK S  L +YWL         
Sbjct  96142  SHPGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHI----Q  96309

Query  175    SWQVYKACIPL  185
               WQVY  C+ L
Sbjct  96310  PWQVYINCVAL  96342

 Score = 35.4 bits (80),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 22/46 (48%), Gaps = 0/46 (0%)
 Frame = +1

Query  95     CGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHE  140
              CG  +    P+P     M + G +H GPCE+W D  R   ++  H 
Sbjct  99850  CGTPSRMTRPRPSYRTDMYTLGRSHLGPCEIWCDDKRAFNNNTNHR  99987

>PHSO:scaffold_3
Length=10773376

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 84/191 (44%), Gaps = 50/191 (26%)
 Frame = -2

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLE-SQGF----------KTVEDFNGWRRSNGYKT  75
                AH  +  P  TY +  + TKY  L     ++GF             + FN    + GYK+
Sbjct  6431490  AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  6431311

Query  76       LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------------H  119
                LR  +D          DY  G +   A P       +  TGYT                H
Sbjct  6431310  LREMLDPI------APDY--GHSLKTATP-------VDVTGYTEMWWQNDEYKEGFINSH  6431176

Query  120      DGPCEVWLDSTRVLQSDNCH---ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
                 GPCE W+D  ++   DNC    +++P K    DYSSCKG C+L +YWL       E +W
Sbjct  6431175  SGPCEAWIDDVKIFHHDNCAAEFKSYPAKV-PADYSSCKGDCLLVFYWLALH----EPNW  6431011

Query  177      QVYKACIPLSS  187
                Q+YK C+P+++
Sbjct  6431010  QIYKQCVPITN  6430978

 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 84/191 (44%), Gaps = 50/191 (26%)
 Frame = -1

Query  27       AHQVVLLPAPTYTTDNKDTKYAPLAFLE-SQGF----------KTVEDFNGWRRSNGYKT  75
                AH  +  P  TY +  + TKY  L     ++GF             + FN    + GYK+
Sbjct  6433885  AHGYISQPKATYDSTTEYTKYNALTSASVNKGFSGGKYDDSPENNAKAFNDHWNATGYKS  6433706

Query  76       LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT----------------H  119
                LR  +D          DY  G +   A P       +  TGYT                H
Sbjct  6433705  LREMLDPI------APDY--GHSLKTATP-------VDVTGYTEMWWQNDEYKEGFINSH  6433571

Query  120      DGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
                 GPCE W+D  ++   DNC    +++P K    DYSSCKG C+L +YWL       E +W
Sbjct  6433570  SGPCEAWIDDVKIFHHDNCAAEFKSYPAKV-PADYSSCKGDCLLVFYWLALH----EPNW  6433406

Query  177      QVYKACIPLSS  187
                Q+YK C+P+++
Sbjct  6433405  QIYKQCVPITN  6433373

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 25/125 (20%)
 Frame = -1

Query  73       YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-GTMR------STGY--THDGPC  123
                +KTLRA MD A           CG T    +P  +    +M+        G+  +H GPC
Sbjct  6425854  FKTLRAMMDTAASD--------CGNTALTGSPVDVSSLSSMKWQNDQEQMGFIDSHHGPC  6425699

Query  124      EVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
                E W+D TRV  SD+C   + ++P +   +DYS+C G C   +YWL       E +WQVYK
Sbjct  6425698  EAWIDDTRVFHSDDCRAAYTSYPAE-IPIDYSACSGDCTFTFYWLALH----EPNWQVYK  6425534

Query  181      ACIPL  185
                 C P+
Sbjct  6425533  QCAPI  6425519

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 2/51 (4%)
 Frame = +2

Query  118      THDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLG  166
                   GPCE+WLD   V QS+NC   FP       +DYSSC G C+LR+Y L 
Sbjct  6436019  VSKGPCELWLDEVVVFQSNNCAVAFPTSPAVCAVDYSSCSGFCVLRFYALA  6436171

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (55%), Gaps = 7/62 (11%)
 Frame = -2

Query  121      GPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
                GPCE W+D T+V   D+C   FP       +DYS+CKG  C+  +YWL      +   WQ
Sbjct  6429465  GPCEGWIDDTKVFHYDDCVAKFPSYPAKIPVDYSACKGDKCLFVFYWLAV----HSPEWQ  6429298

Query  178      VY  179
                +Y
Sbjct  6429297  IY  6429292

 Score = 33.5 bits (75),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (51%), Gaps = 8/51 (16%)
 Frame = -3

Query  134      QSDNCHETFP---GKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
                Q+  C  +FP   GK    DYS C G C+  +YWL      +  +WQ+Y A
Sbjct  6427907  QALPCRASFPDYPGKI-PTDYSCCTGDCLFTFYWLAL----HSPTWQIYSA  6427770

>PHKE:scaffold_72 scf_22126_72.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_72.1:1:114560:1 
REF
Length=114560

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (44%), Gaps = 20/180 (11%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGF---------KTVEDFNGWRRSNGYKT  75
              D H  +  P  T+T    D T++         GF         K V  F     S+ Y +
Sbjct  52621  DGHGYMTNPTVTFTASAGDPTQHIGTIQASDSGFSGKFDDVIEKNVAAFTQAFGSSSYTS  52800

Query  76     LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY---THDGPCEVWLDSTRV  132
              L+ F++        GA   CG  +     QP+P+ T+  + +   +H GPCEVW D  RV
Sbjct  52801  LKEFVNEKATVTVTGATLTCGSCDPNEPAQPLPESTVEWSPFFTESHVGPCEVWCDEMRV  52980

Query  133    LQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               Q+DNC  +F          D  +C GS +L +YW+      +  +WQVY  C PL  +A
Sbjct  52981  FQNDNCAGSFSNNAPAQMPYDRDACMGSSVLTFYWMAL----HSSTWQVYVNCAPLEKTA  53148

>PYVX:scaffold_639 pve_scaffold_639 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_639:1:17349:1 
REF
Length=17349

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  87    VTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
             + + A   CG T+  AA QP+P DG +       H GPCEVWLD T+V  +++C  T+  
Sbjct  2290  LANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASANDCWSTYAD  2111

Query  145   KTYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVYKACI  183
             KT  +DYS C G SC LRW WL T        W+++  C+
Sbjct  2110  KTIPIDYSVCTGSSCQLRWVWLATH----NDPWEIFDNCV  2003

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 85/174 (49%), Gaps = 34/174 (20%)
 Frame = +1

Query  27      AHQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFN-GWRRSNGYKTLRA  78
                H +V  P   + +D   TKY        P  F +S     V +FN  ++  + +KTLR 
Sbjct  448387  GHGIVSNPPAEFRSDVMRTKYVATIQANLPGKFDDSPQ-NNVANFNKAFKAQSQFKTLRD  448563

Query  79      FMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDS  129
                +D        G D  CGFT    A + IP +G M      TG     +H GPCE+W+D+
Sbjct  448564  MLD------PHGPD--CGFTLTNVARKAIPGNGQMTWKNPDTGEGFIPSHKGPCEIWIDN  448719

Query  130     TRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVY  179
                RV Q+D+C  +FP        +DYS C+G  CMLR+YW+      +E  WQVY
Sbjct  448720  ERVFQNDDCATSFPQSPEVNLPVDYSKCRGDGCMLRFYWIAL----HEPQWQVY  448869

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 80/165 (48%), Gaps = 33/165 (20%)
 Frame = +3

Query  61      VEDFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS-----  114
               V +FN  ++    +KTLR  +D        G D  CG T    A + IP   M +     
Sbjct  459279  VANFNKAFKAQTQFKTLRDMLD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPD  459434

Query  115     TGY----THDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGS-CMLRWYWLG  166
               TG     +H GPCEVW+D+ RV Q+D+C   FP K      +DYSSC  + CMLR+YWL 
Sbjct  459435  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  459614

Query  167     TRFLKNEHSWQVYKA----CIPLSS---SARRLEGAANESAAIEF  204
                    +E  WQVY      C+ + +   S+R L  A  +  A + 
Sbjct  459615  L----HEPMWQVYSTFSMLCVCMEANALSSRELRAAEGQRPAADV  459737

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 68/131 (52%), Gaps = 26/131 (20%)
 Frame = +3

Query  63      DFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG  116
               +FN  ++  + YKTLRA +D        G D  CG T    A + IP +G M      TG
Sbjct  464592  NFNKAFKAQSKYKTLRALLD------QHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTG  464747

Query  117     ----YTHDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTR  168
                    +H GPCEVWLD+ RV Q+D+C   FP K      +DYSSC    CMLR+YW+   
Sbjct  464748  EGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIAL-  464924

Query  169     FLKNEHSWQVY  179
                  +   WQVY
Sbjct  464925  ---HSPRWQVY  464948

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 85/190 (45%), Gaps = 50/190 (26%)
 Frame = +3

Query  28      HQVVLLPAPTYTTDNKDTKYAPL--AFL----ESQGFKTVEDFN-GWRRSNGYKTLRAFM  80
               H +V  P   + +D   TKY     AFL    +      V +FN  ++  + +KTLR  +
Sbjct  457344  HGIVSNPPAEFRSDVMRTKYVATIQAFLPGKFDDSPQVNVANFNKAFKAQSQFKTLRDML  457523

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STG-----------YTHD----  120
               D        G D  CG+T    A + IP DG M      TG           Y H+    
Sbjct  457524  D------PHGPD--CGYTLTNVAKKAIPSDGKMTWQNPDTGEGFIPSHTVPNYIHERIAY  457679

Query  121     -------GPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGS-CMLRWYWLGTRF  169
                      GPCEVWLD+ RV Q+D+C   F   P     +DYSSC G  CMLR+YW+    
Sbjct  457680  SSSTHW*GPCEVWLDNKRVFQNDDCPTNFADKPAAHLPVDYSSCTGDGCMLRFYWIAL--  457853

Query  170     LKNEHSWQVY  179
                 ++  WQVY
Sbjct  457854  --HQPEWQVY  457877

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 80/193 (41%), Gaps = 51/193 (26%)
 Frame = -1

Query  28      HQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFN-GWRRSNGYKTLRAF  79
               H ++  P   +T +   T Y        P  F +S     V +FN  ++    +KTLR  
Sbjct  451238  HGIISNPLAEFTPNVMRTTYVTRIQANFPGKFDDSPQ-TNVANFNKAFKAQTQFKTLRDM  451062

Query  80      MDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS----------------------TGY  117
               +D        G D  CG T    A + IP   M +                       G 
Sbjct  451061  LD------PQGPD--CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFVPSHTVCKQWPWAGN  450906

Query  118     THD----GPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGS-CMLRWYWLGTRF  169
                ++    GPCEVW+D  RV Q+D+C   FP K      +DYSSC G  CMLR+YWL    
Sbjct  450905  AYEM*Y*GPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLAL--  450732

Query  170     LKNEHSWQVYKAC  182
                 +E  WQVY  C
Sbjct  450731  --HEPMWQVYSTC  450699

>PYAP:scaffold_289 pag1_scaffold_289 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_289:1:35482:1 
REF
Length=35482

 Score = 80.1 bits (196),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = +3

Query  87     VTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              + + A   CG T+A A  QPIP DG +       H GPCEVWLD+T+V  +  C + FP 
Sbjct  14391  LAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEFPN  14570

Query  145    KTYNLDYSSCK-GSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              K   +D++ CK GSC LRW W+ T    +   W+ +  C+
Sbjct  14571  KRIKVDFAKCKSGSCQLRWVWMAT----HTSPWEFFDNCV  14678

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = -1

Query  87     VTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
              + D     CG T+   A QPIP DG ++      H GPCE+WLD   V  +  C + +P 
Sbjct  12778  LADSHGSKCGKTDPNGAVQPIPADGYVQLQITAAHIGPCELWLDGEMVASAKQCVKEYPD  12599

Query  145    KTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACI  183
              +   +D+S CK S C LRW WL T    +   W++Y  C+
Sbjct  12598  RKIKVDFSKCKSSKCQLRWVWLAT----HNSPWEIYDNCV  12491

>PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 
genomic scaffold, whole genome shotgun sequence
Length=4595942

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 15/136 (11%)
 Frame = -1

Query  60       TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
                +V  F   + +N +K L+  MD    T   GAD  CGFT+     QPIP DG    S   
Sbjct  2065313  SVNAFKALKTANKFKDLKTLMDD---TSVYGAD--CGFTDPNGKAQPIPKDGKATFSRAL  2065149

Query  118      THDGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSC-KGSCM-LRWYWLGTRF  169
                 H GPCE+WLD T+VL  D+C   +  +       + +DYSSC  G C  +R+YWL  + 
Sbjct  2065148  VHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQG  2064969

Query  170      LKNEHSWQVYKACIPL  185
                +  +  WQ Y   + L
Sbjct  2064968  VDGKTVWQSYSKLVVL  2064921

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -1

Query  60       TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
                +VE F   + +N +K L+  MD      TD     CGFT+     QPIP DG    S   
Sbjct  2062541  SVETFKSLKTANNFKDLKTLMDDTSVYGTD-----CGFTDPNGKAQPIPKDGKATFSRAL  2062377

Query  118      THDGPCEVWLDSTRVLQSDNCHETFPGKT  146
                 H GPCE+WLD T+VL  D+C   + GKT
Sbjct  2062376  VHVGPCEIWLDDTKVLYEDDCFSKY-GKT  2062293

>PYVX:scaffold_563 pve_scaffold_563 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_563:1:19577:1 
REF
Length=19577

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (47%), Gaps = 23/172 (13%)
 Frame = +1

Query  27    AHQVVLLPAPTYTTDNKDTKYAP---LAFLESQGFKTVEDF----NGWRRSNGYKTLRAF  79
              H  +++P PT  +D+      P   +   E  G  +  D+    + W  +NG  +L+  
Sbjct  7615  GHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISSLK--  7788

Query  80    MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSD  136
                 +Y  T G+   CG T     PQP+P DG  +  + G +H GPCE+W D TRV  S 
Sbjct  7789  ----EYITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFTST  7956

Query  137   NCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             NC   F G++     +D ++C GS    +YWL          WQVY  C+ L
Sbjct  7957  NCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQVYINCVAL  8100

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 81/191 (42%), Gaps = 32/191 (17%)
 Frame = +2

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLE----------SQGFKTVEDFNGWRRSNGYKTL  76
              H  ++LP PT  +D+      P   ++          S+ ++ V D   W   NG  +L
Sbjct  9449  GHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGVAD---WFTENGISSL  9619

Query  77    RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVL  133
             +      +Y         CG T      QP+P DG     + G +H GPCE+W D TRV 
Sbjct  9620  K------EYXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIWCDDTRVF  9781

Query  134   QSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL---SS  187
              S NC   F G++     +D ++C  S    +YWL          WQVY  C+ L   SS
Sbjct  9782  NSTNCVTDFSGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQVYINCVALDGTSS  9949

Query  188   SARRLEGAANE  198
             SA      ++E
Sbjct  9950  SASEASLTSDE  9982

>PHKE:scaffold_499 scf_22126_499.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_499.1_contig_1:1:23234:1 
REF
Length=23234

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 61/125 (49%), Gaps = 23/125 (18%)
 Frame = -3

Query  73    YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPC  123
             +KTLRA MD      T   D  CG T    +P  +          D   +    +H GPC
Sbjct  9435  FKTLRALMD------TVAPD--CGNTALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPC  9280

Query  124   EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
             E W+D TRV+QSD+C   +P       +DYSSC G C   +YW+       E +WQVYK 
Sbjct  9279  EAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMALH----EPNWQVYKQ  9112

Query  182   CIPLS  186
             C P++
Sbjct  9111  CAPIT  9097

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 61/129 (47%), Gaps = 28/129 (22%)
 Frame = +3

Query  73     YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPC  123
              + TLRA MD A  T        CG T    +P  +          D  M     +H GPC
Sbjct  11109  FVTLRALMDSAVPT--------CGDTLTTGSPVDVSATSSMKWQNDQEMMGFIDSHHGPC  11264

Query  124    EVWLD-----STRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
              E W+D     STRV QSD+C   +PG      +D+S+C G C   +YWL      +E +W
Sbjct  11265  EAWIDGSDGSSTRVFQSDDCRRDYPGYPAEIPIDFSTCNGDCTFTFYWLAL----HEPNW  11432

Query  177    QVYKACIPL  185
              QVYK C P+
Sbjct  11433  QVYKQCAPI  11459

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 66/138 (48%), Gaps = 19/138 (14%)
 Frame = -2

Query  59     KTVEDFNGWRRSNGYKTLRAFMD------GAKYTVTDGADYYCGFTNAKAAPQPIPDGTM  112
              +  + F     + GYK+LR  +D      G      D  +   G+T          +G +
Sbjct  14482  QNAQAFKDHWNATGYKSLRDMLDPIAPGYGFSLETADPVNV-AGYTEMWWQNDEYKEGFI  14306

Query  113    RSTGYTHDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRF  169
               S    H+GPCE W+D   V   DNC    +++P K    DYSSCKG C+  +YWL    
Sbjct  14305  AS----HEGPCEGWIDDIMVFHHDNCAAQFKSYPAKI-PTDYSSCKGDCLFVFYWLAL--  14147

Query  170    LKNEHSWQVYKACIPLSS  187
                ++  WQ+YK C+P+++
Sbjct  14146  --HQAEWQIYKQCVPITN  14099

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 6/82 (7%)
 Frame = -1

Query  121    GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              GPCE W+D   V   D+C   FP     +  DYSSCKG C+  +YWL      ++  WQ+
Sbjct  12578  GPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCLFVFYWLAL----HQADWQI  12411

Query  179    YKACIPLSSSARRLEGAANESA  200
              YK C+P+++     +  A E++
Sbjct  12410  YKQCVPITNGGSGQKEVAGEAS  12345

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 2/48 (4%)
 Frame = +2

Query  121    GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLG  166
              GPCE+WL+   V ++ NC   FP       +DYSSC G C+LR+Y L 
Sbjct  15578  GPCELWLNELMVFKAKNCAVAFPTSPAMCAVDYSSCSGYCLLRFYALA  15721

>PYAR:scaffold_674 par_scaffold_674 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_674:1:14611:1 
REF
Length=14611

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = -1

Query  81    DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSDNC  138
             D  K  +       CG TNA AA QP P DG +  +    H GPCE+WLD T+V+ + +C
Sbjct  7582  DEVKSLLEKAGGSKCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLDDTKVVSATDC  7403

Query  139   HETFPGKTYNLDYSSC--KGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              + FP K   +D+S C  K SC LRW W+ T    +   W+ Y  C+
Sbjct  7402  WKQFPDKRIPVDFSKCANKASCELRWIWMAT----HTSPWEFYDNCV  7274

>PYIW:scaffold_182 piw_scaffold_182 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_182:1:25962:1 
REF
Length=25962

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 90/211 (43%), Gaps = 56/211 (27%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGF----------KTVEDFNGWRRSNGYK  74
             +AH  +  P  TYT     T + A +    ++GF          +   +F       GY 
Sbjct  1378  EAHGFISEPKATYTGGGSYTSFSAEIGADVNKGFSGRIFNRSPEQNAAEFTAAWPKTGYT  1557

Query  75    TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGPC  123
             +L+  +D +      G    CG+TN  AAP  +    ++S  Y           +H GPC
Sbjct  1558  SLKEMLDKS----VSG----CGYTNPNAAPVDVSG--LKSMKYQNNEYKEGFLGSHRGPC  1707

Query  124   EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
             E W+D+T++  +D+C +T+PG   T  +DYS CKG+C L +YWL     K    WQVY  
Sbjct  1708  EAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVHSPK----WQVYSK  1875

Query  182   ------------------CIPLSSSARRLEG  194
                               C+ L  S R L G
Sbjct  1876  SACSSTIAYVPSCSCLTDCVSLCQSCRGLRG  1968

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = -3

Query  121   GPCEVWLDSTRVLQSDNCH---ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
             GPCE+W++ TRV Q+++C    + +P   + +DYS CKG C + +Y L    LK    WQ
Sbjct  4099  GPCEIWIEKTRVFQTNDCRGYTDAYPA-VFPVDYSVCKGDCTITFYLLAVHELK----WQ  3935

Query  178   VY  179
             +Y
Sbjct  3934  IY  3929

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = -3

Query  121    GPCEVWLDSTRVLQSDNCHETFP-GKTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
              GPCEVW+DS R  +  NC + F    T   DYS+C G+C+L  YWL      N+
Sbjct  21565  GPCEVWIDSKRAFEHQNCAKLFEVTPTIPFDYSACHGTCLLTLYWLFADIATND  21404

>PHRA:scaffold_52
Length=349176

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 84/171 (49%), Gaps = 23/171 (13%)
 Frame = -1

Query  26      DAHQVVLLPAPTYTTDNKDTKYA----PL---AFLESQGFKTVEDFNGWRRSNGYKTLRA  78
               DAH  +L+P   +  D+ ++ +     P+   A  +     +V+ F   + +N +  L+ 
Sbjct  102900  DAHGYMLIPESQFK-DSANSAWVVQIDPVWDSADWDGNNAGSVDAFKALKTANNFVDLKT  102724

Query  79      FMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLDSTRVLQSD  136
                MD    T T GAD  CGFT+    PQPIP DG    S    H GPCE+WLD  +V   D
Sbjct  102723  LMDD---TATFGAD--CGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDDKKVFYED  102559

Query  137     NCHETFPGK------TYNLDYSSCK-GSCM-LRWYWLGTRFLKNEHSWQVY  179
               +C  T+  +       + +DYS C  G C  +R+YWL  + +  +  WQ Y
Sbjct  102558  DCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  102406

>HYAP:scaffold_8 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8:1:893728:1 
REF
Length=893728

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = +2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + GYK+L AF+   +       D  CG T  K +A   +P   +  TG+TH GPCEVW D
Sbjct  537671  TKGYKSLGAFILENQELFLPKVDLNCGLTVYKDSARSELPASELTYTGFTHPGPCEVWCD  537850

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                T+VL   +C  T+PGK   + Y  S C G+  +  YWLG         WQVY  C+
Sbjct  537851  DTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGVH----GDPWQVYIDCM  538009

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 64/146 (44%), Gaps = 15/146 (10%)
 Frame = +2

Query  41      DNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNA  100
               DN    Y P A        T++ F     + GYK+L AF+   +       D  CG T  
Sbjct  522056  DNTKYGYGPNA--------TLKFFTETFPTKGYKSLGAFIIENQEIHLPNVDPDCGLTVY  522211

Query  101     K-AAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGS  157
               K +A   +P   +  T +TH GPCEVW D T+VL   +C   +P K   + Y  S C G+
Sbjct  522212  KDSARSELPASELTYTSFTHPGPCEVWCDDTKVLFDSDCQTKYPNKPATMPYVKSKCAGA  522391

Query  158     CMLRWYWLGTRFLKNEHSWQVYKACI  183
                 +  Y    R   +   WQ Y  C+
Sbjct  522392  NRMTIY----RVAVHADPWQSYINCM  522457

>PHRA:scaffold_23
Length=570991

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 81/179 (45%), Gaps = 35/179 (20%)
 Frame = -3

Query  40      TDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN  99
               T++ D+ +A L + +S    T    N +  S  YKTLR  +D A  T        CG T 
Sbjct  388874  TESSDSAFAGLKWDDSPETNTATFTNAFPNSK-YKTLRDLLDTAAPT--------CGNTL  388722

Query  100     AKAAPQPIP---------DGTMRSTGYTHDGPCEVWLDS-----TRVLQSDNCHETFPG-  144
                  +P  +          D  M+    +H GPCE W+DS     TRV +SD+C   + G 
Sbjct  388721  TTGSPVDVSSLNSMKWQNDQEMKGFIESHHGPCEAWIDSNTGTKTRVFRSDDCRRDYTGY  388542

Query  145     -KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
                    +DYS C G C   +YWL      +E +WQVYK C P+      + G A ES  +
Sbjct  388541  PAEIPIDYSLCTGECTFVFYWLA----MHEANWQVYKQCAPI------VNGPATESTTV  388395

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 63/141 (45%), Gaps = 39/141 (28%)
 Frame = +2

Query  64      FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT-----  118
               FN    + GYK+LR  +D          DY  G +   AAP       +   GYT     
Sbjct  380516  FNDHWNATGYKSLREMVDPI------APDY--GKSIQTAAP-------IDVAGYTEMWWQ  380650

Query  119     -----------HDGPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYW  164
                          H GPCE W+D  R+   DNC   F   P K    DY+SCKG C+  +YW
Sbjct  380651  NDEYKEGFIASHSGPCEAWIDDVRIFHHDNCAAQFTSYPAK-IPADYASCKGDCLFSFYW  380827

Query  165     LGTRFLKNEHSWQVYKACIPL  185
               L      +E +WQ+YK C+P+
Sbjct  380828  LAL----HEPNWQIYKQCVPI  380878

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 15/122 (12%)
 Frame = +3

Query  73      YKTLRAFMDGA-----KYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWL  127
               +KTLRA MD A        +T  A      ++ K        G + S    H GPCE W+
Sbjct  390420  FKTLRALMDTAAPDCGNTALTGTAVDVSSLSSMKWQNDQEQKGFIDS----HHGPCEAWI  390587

Query  128     DSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D TRV QSD+C   + G      +D+SSC G C   +YW+      +E +WQVYK C P+
Sbjct  390588  DDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAM----HEPNWQVYKQCAPI  390755

Query  186     SS  187
               ++
Sbjct  390756  AN  390761

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 47/77 (61%), Gaps = 8/77 (10%)
 Frame = +2

Query  118     THDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
               +H+GPCE W+D  ++   DNC    +T+P K    D+SSCKG C+  +YWL       E 
Sbjct  384854  SHEGPCEAWVDDVQIFHHDNCAAQFKTYPAKV-PADFSSCKGDCLFVFYWLALH----EP  385018

Query  175     SWQVYKACIPLSSSARR  191
               +WQ+YK C+P+++S   
Sbjct  385019  NWQIYKQCVPITNSGSS  385069

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 39/77 (51%), Gaps = 15/77 (19%)
 Frame = -2

Query  105     QPIPDGTMRSTGYTHD-------------GPCEVWLDSTRVLQSDNCHETFPGK--TYNL  149
               QP    +M  + + HD             GPCE+WLD   V Q+ NC   FP +  T  +
Sbjct  383520  QPKEVLSM*VSCFVHDVARSSITDKI***GPCELWLDEAVVFQASNCAVAFPTRPATCAV  383341

Query  150     DYSSCKGSCMLRWYWLG  166
               DYS+C G C+LR+Y L 
Sbjct  383340  DYSNCSGRCVLRFYALA  383290

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = +1

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
               GPCE W+D T V   D+C   FP     +  DYS+CKG  C+  +YWL      +   WQ
Sbjct  386578  GPCEGWIDDTMVFHYDDCVAKFPSYPAKIPTDYSACKGDKCLFVFYWLAV----HSPEWQ  386745

Query  178     VY  179
               +Y
Sbjct  386746  IY  386751

>PYVX:scaffold_894 pve_scaffold_894 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_894:1:10447:1 
REF
Length=10447

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 74/130 (57%), Gaps = 16/130 (12%)
 Frame = -3

Query  70    SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGP  122
             ++GY TL+ +++  K T+  GA   CG     A PQP+P   +      + G T  H GP
Sbjct  3716  TSGYSTLKNYVN-VKMTLIPGATEECGLAIPDATPQPLPAKYVEWYHSPTEGLTESHHGP  3540

Query  123   CEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             CE++  +TRV ++D+C   ++T P + +  D +SC G+  L +YWL      +E+ WQVY
Sbjct  3539  CEIYCGNTRVFKNDDCSTHYKTIPAQ-FPYDRASCLGASHLTFYWL----TLHEYQWQVY  3375

Query  180   KACIPLSSSA  189
               C+PL +++
Sbjct  3374  INCVPLVATS  3345

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 76/179 (42%), Gaps = 24/179 (13%)
 Frame = +1

Query  27    AHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKTL  76
             AH  +  PA T+ +   D T+Y       + GF              F     S+ Y +L
Sbjct  7267  AHGYMSNPAVTFLSTAGDPTQYIATIESSASGFSGTFNSDPATNTASFTTAFASSSYSSL  7446

Query  77    RAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
             +  +    +   T G    CG T+     Q +PD  +      S G+T  H+GPCE+W D
Sbjct  7447  KEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDSEGFTASHEGPCEIWCD  7626

Query  129   STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              TRV Q D+C  T+      L Y  +SC G+  L +YWL      +   WQVY  C  L
Sbjct  7627  DTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLA----LHSSQWQVYVNCAAL  7791

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 72/157 (46%), Gaps = 19/157 (12%)
 Frame = -3

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKTLR  77
              H  +  PA ++T +   T++       + GF              F     S+ YK+L+
Sbjct  1826  GHGYMSDPAVSFTINGDITQFIGTIEASASGFSGSFNSDPASNAAAFTKAFDSSSYKSLK  1647

Query  78    AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLDST  130
              F+   K T   GA   CG ++  A  QP+PD  +      + G+T  H+GPCE+W D T
Sbjct  1646  EFVT-EKMTPISGATKECGLSDPDATAQPLPDTYVEWAHSSNEGFTPSHEGPCEIWCDDT  1470

Query  131   RVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWL  165
             RV Q D+C  H T        D +SC GS  L ++WL
Sbjct  1469  RVFQDDDCAAHYTSAPAQLKYDRASCVGSSRLTFFWL  1359

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 62/132 (47%), Gaps = 14/132 (11%)
 Frame = +2

Query  64   FNGWRRSNGYKTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGY  117
            F     ++ Y +L+  + D  +   T G    CG T+     Q +PD  +      + G+
Sbjct  164  FTTAFEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGF  343

Query  118  T--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNE  173
            T  H+GPCE+W D TRV Q D+C  T+      L Y   +C G+  L +YWL      + 
Sbjct  344  TASHEGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLA----LHS  511

Query  174  HSWQVYKACIPL  185
             +WQVY  C  L
Sbjct  512  STWQVYINCAAL  547

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 75/191 (39%), Gaps = 38/191 (20%)
 Frame = +2

Query  26    DAHQVVLLPAPTYTTDNKD-TKYAPL----AFLESQGFKT-----VEDFNGWRRSNGYKT  75
             +AH  ++ P   + + N D T+Y+      A      F T     VE F    +++ Y  
Sbjct  9077  NAHGYLVQPLAKFISQNIDITQYSSTIDSNALFPGNVFNTAPELNVEAFVKSYKNSSYAN  9256

Query  76    LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY--------------THDG  121
             +R  +   +  V+D A   CGF++    P     G +  T Y               H G
Sbjct  9257  VREMIVANQVVVSDSATADCGFSD----PSKTSYGALNDTIYWGKSADLTGEGFVVGHMG  9424

Query  122   PCEVWLDSTRVLQSDNCHETFPGKTYN------LDYSSCKGSCMLRWYWLGTRFLKNEHS  175
             PCE W D     Q  NC  T+   + +      +D S C  +  L +YW+     +    
Sbjct  9425  PCETWCDDNLAQQDMNCQVTYNPASGSGAAPVPIDTSKCASAKRLTFYWIAMHGAQ----  9592

Query  176   WQVYKACIPLS  186
             WQVY  CI ++
Sbjct  9593  WQVYINCININ  9625

>PHRA:scaffold_37
Length=441994

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 53/99 (54%), Gaps = 18/99 (18%)
 Frame = +2

Query  95      CGFTNAKAAPQPIP-DGTMR-----STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148
               CG T+  A+PQPIP DG  +       G+TH GPCE++LD T VL SDNC + +PG    
Sbjct  285308  CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  285487

Query  149     --------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
                       +DYSSC G C L  YWL  +       WQ Y
Sbjct  285488  STQTSDMPVDYSSCNGKCTLTIYWLAFQ----NAQWQAY  285592

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 69/144 (48%), Gaps = 39/144 (27%)
 Frame = -3

Query  64       FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT-----  118
                FN    + GYK+LR   D          DY  G +   A P  +       TGYT     
Sbjct  5326373  FNERWNATGYKSLRDMADPI------APDY--GHSLKTATPVDV-------TGYTEMWWQ  5326239

Query  119      -----------HDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYW  164
                           H+GPCE W+D TRV   DNC    +++P K    DYSSCKG C+  +YW
Sbjct  5326238  NDEYKEGFIASHEGPCEAWIDETRVFHHDNCAAQFKSYPAKV-PTDYSSCKGDCLFVFYW  5326062

Query  165      LGTRFLKNEHSWQVYKACIPLSSS  188
                L      +E +WQ+YK C+P++++
Sbjct  5326061  LAL----HEPNWQIYKQCVPITNN  5326002

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 25/127 (20%)
 Frame = -1

Query  73       YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPC  123
                +KTL+A MD      T  +D  CG T+   +P  +          D   +    +H GPC
Sbjct  5289394  FKTLKALMD------TVASD--CGKTSLTGSPVDVSSLSSMTWQNDQEQKGFIDSHHGPC  5289239

Query  124      EVWLDSTRVLQSDNCHE---TFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
                E W+D  RV  SD+C     T+P +   +D+SSC G C   +YWL      +E +WQVYK
Sbjct  5289238  EAWIDDKRVFHSDDCRADFTTYPAE-IPIDFSSCSGDCTFTFYWLAL----HEPNWQVYK  5289074

Query  181      ACIPLSS  187
                 C P+++
Sbjct  5289073  QCAPITN  5289053

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 8/72 (11%)
 Frame = -3

Query  118      THDGPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                +H+GPCE W+  T++   ++C   F   P K    DYSSCKG C+L +YWL      +E 
Sbjct  5331743  SHEGPCEAWIGETQIFHHNDCAAQFKSYPAK-IPADYSSCKGDCLLVFYWLAL----HEP  5331579

Query  175      SWQVYKACIPLS  186
                +WQ+YK C+P++
Sbjct  5331578  NWQIYKQCVPIT  5331543

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 2/46 (4%)
 Frame = +2

Query  120      DGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWY  163
                 GPCE+W+D   V Q++NC   FP    T  +DY SC   C+LR+Y
Sbjct  5329082  QGPCELWIDEAVVFQANNCAVAFPTSPATCPVDYLSCYDKCVLRFY  5329219

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 32/62 (52%), Gaps = 7/62 (11%)
 Frame = -2

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
                GPCE W+D+  V   D+C   FP     +  DYS CKG  C+  +YWL      +   WQ
Sbjct  5323509  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSFCKGDKCLFVFYWLAL----HTPQWQ  5323342

Query  178      VY  179
                +Y
Sbjct  5323341  IY  5323336

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 75.9 bits (185),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 8/77 (10%)
 Frame = +3

Query  120     DGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
                GPCE+WLD+TRV Q++NC   FP K      +D+SSC GSC +R+YWL      +E  W
Sbjct  823089  QGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLW  823256

Query  177     QVYKACIP-LSSSARRL  192
               QVY  C+P LS    RL
Sbjct  823257  QVYSTCLPRLSFRKSRL  823307

 Score = 28.1 bits (61),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 9/44 (20%)
 Frame = +2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM  112
               + G+KTLRA +D        G D  CG+T      +PIP DG +
Sbjct  822887  ATGFKTLRAMLD------PHGPD--CGYTKLNVPAKPIPTDGKV  822994

>APIN:scaffold_9 supercont1.9 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.9:1:1715687:1 
REF
Length=1715687

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 66/124 (53%), Gaps = 16/124 (13%)
 Frame = -1

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY--THDG  121
               + + + +L+A +     T  +     CG T     PQP+P DG ++    + GY  +H+G
Sbjct  911123  KKSSFTSLKALVHSQPTTCGE-----CGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEG  910959

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               PCEVW D+TRV  +DNC    P     ++ ++CKG+  L + WL      +  SWQVY  
Sbjct  910958  PCEVWCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAM----HTSSWQVYIN  910791

Query  182     CIPL  185
               C+PL
Sbjct  910790  CVPL  910779

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 78/179 (44%), Gaps = 26/179 (15%)
 Frame = +1

Query  28      HQVVLLPAPTYTTDNKDTK----------YAPLAFLESQGFKTVEDFNGWRRSNGYKTLR  77
               H  ++ P PT+T+ N D              P A   +        F    +++ +KTLR
Sbjct  911683  HGGLVDPLPTWTSPNSDISQFCGTMEGPSVLPGAPYNTSPQDNTAAFTRHFQASSFKTLR  911862

Query  78      AFMDGAKYTVTDGADYYCGFTNAKAAPQPI-PDGTMR----STGY--THDGPCEVWLDST  130
                 +    Y  T G    CG T+    P+ +   G +     S G+  +H+GPCEVW D+T
Sbjct  911863  DVI--VAYPSTCGT---CGITDPFGTPRELNATGVIMWAHGSEGFVASHEGPCEVWCDAT  912027

Query  131     RVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               RV  +DNC          +D + C+G+  L  YWL         +WQ+Y  C+ L  +A
Sbjct  912028  RVFYNDNCARNVASGILKIDVAKCQGARQLVMYWLALHV----PTWQIYVNCVTLGGAA  912192

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (53%), Gaps = 4/68 (6%)
 Frame = -1

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
               +H+GPCE+W D+T V Q+DNC    P     +D + C GS      W+    +     WQ
Sbjct  921878  SHEGPCELWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIALHSV----DWQ  921711

Query  178     VYKACIPL  185
               VYK C+ L
Sbjct  921710  VYKNCVAL  921687

>PYIW:scaffold_3644 piw_scaffold_3644 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3644:1:2839:1 
REF
Length=2839

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 73/173 (42%), Gaps = 20/173 (12%)
 Frame = -3

Query  28    HQVVLLPAPTY-----TTDNKDTKYAPLAFLESQGFKTVED-------FNGWRRSNGYKT  75
             H  + LP PT+     T     T   P A     G     D       F    +++ Y +
Sbjct  1889  HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAPSGMSFSTDPTSNTKAFTAALKASSYGS  1710

Query  76    LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTRVLQ  134
             L+A     + T + GA   CGF+    A QP+PD         +H+GPCEVW D+T    
Sbjct  1709  LKALAFATQKTES-GASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAFH  1533

Query  135   SDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              DNC +T+      L Y  S C G+ ML   WL         +WQVY  C P+
Sbjct  1532  GDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLALH----TPTWQVYTNCAPI  1386

>PHRA:scaffold_313
Length=18787

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 50/104 (48%), Gaps = 18/104 (17%)
 Frame = -2

Query  90     GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
              GAD  CGFT     PQP+P             GYTH GPCE+++D   VL SDNC   +P
Sbjct  14748  GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  14569

Query  144    GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
              G   +        +DYSSC G C    YWLG +       WQ Y
Sbjct  14568  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAY  14449

>PHRA:scaffold_28
Length=530368

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 55/122 (45%), Gaps = 18/122 (15%)
 Frame = +1

Query  90     GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
              GAD  CGFT     PQP+P             GYTH GPCE+++D   VL SDNC   +P
Sbjct  77512  GADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYP  77691

Query  144    GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGA  195
              G   +        +DYSSC G C    YWLG +       WQ Y   +    +   L   
Sbjct  77692  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYSTSMCFHFTVIVLVLM  77859

Query  196    AN  197
              AN
Sbjct  77860  AN  77865

>PYAR:scaffold_370 par_scaffold_370 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_370:1:20005:1 
REF
Length=20005

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 63/112 (56%), Gaps = 5/112 (4%)
 Frame = +3

Query  73     YKTLRAFMDGAKYTVTD-GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTR  131
              YKTL+  + G +  +T+  +D  CG T    A +     T++ +G+TH GPCEVW D+T+
Sbjct  17550  YKTLKDLIMGEQTVLTEYKSDAQCGLTTKDEAKRATLPATLKYSGFTHAGPCEVWCDNTK  17729

Query  132    VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              +  +++C +T+   T  +D S C+G+  L  YW+      +   WQVY  C+
Sbjct  17730  LAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAV----HSEPWQVYTDCV  17873

>PYVX:scaffold_2510 pve_scaffold_2510 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_2510:1:1138:1 
REF
Length=1138

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 65/130 (50%), Gaps = 23/130 (18%)
 Frame = -3

Query  70   SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-------DGTMRSTGY--THD  120
            S GY +LRA +D +   V+D     CG T    +P  +               G+  +H 
Sbjct  746  STGYTSLRAMIDES---VSD-----CGNTRTDVSPVDMTGKKVLHWQNDQEGVGFVSSHH  591

Query  121  GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
            GPCEVW+D   V   D+C   +     N+  D+S C GSC LR+YWL      +E +WQ+
Sbjct  590  GPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLAL----HEPNWQI  423

Query  179  YKACIPLSSS  188
            YK C P+++S
Sbjct  422  YKQCAPITNS  393

>APAS:scaffold_33 supercont1.33 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.33:1:657536:1 
REF
Length=657536

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 16/132 (12%)
 Frame = +2

Query  63      DFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY  117
               +F    + + + +LRAF+D    T  +     CG T A   P+ +P D  ++    S G+
Sbjct  121496  EFTRQLKKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSDSKVKWAHGSEGF  121660

Query  118     --THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
                 +H+GPCE+W D+TRV ++DNC    P     ++ S C+GS  L   WL      +   
Sbjct  121661  VLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQ  121828

Query  176     WQVYKACIPLSS  187
               WQVYK C+ L+S
Sbjct  121829  WQVYKNCVRLTS  121864

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 16/126 (13%)
 Frame = +2

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY--THDG  121
               + + + +LRAF+D    T  +     CG T A   P+ +P D  ++    S G+  +H+G
Sbjct  125471  KKSSFASLRAFIDAQGNTGGE-----CGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEG  125635

Query  122     PCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               PCE+W D+TRV ++DNC    P     ++ S C+GS  L   WL      +   WQVYK 
Sbjct  125636  PCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQWQVYKN  125803

Query  182     CIPLSS  187
               C+ L+S
Sbjct  125804  CVRLTS  125821

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 77/177 (44%), Gaps = 26/177 (15%)
 Frame = -1

Query  27      AHQVVLLPAPTYTTDNKDTK----------YAPLAFLESQGFKTVEDFNGWRRSNGYKTL  76
               +H  +L P PT+ T   DT             P A   +        F    +++ +KTL
Sbjct  137075  SHGALLDPLPTWNTPYSDTSQFCGTMEGPSVLPGAAYNTSPQDNAAAFTRQFQASSFKTL  136896

Query  77      RAFMDGAKYTVTDGADYYCGFTNAKAAPQPI-PDGTMR----STGY--THDGPCEVWLDS  129
               R  +     T        CG TN    P+ I  DGT++    S G+  +H+GPCEVW D+
Sbjct  136895  RDLVLANPSTCGS-----CGITNPNGTPRQINADGTVKWAHGSEGFISSHEGPCEVWCDT  136731

Query  130     TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                RV Q+DNC          +D + CK +  L  YWL         +WQ+Y  C+ L+
Sbjct  136730  DRVFQNDNCARNAANGIVKIDVAKCKRAIHLVVYWLALHV----PTWQIYLNCVRLA  136572

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 75/175 (43%), Gaps = 25/175 (14%)
 Frame = +1

Query  26      DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK  84
               DAH  +L PAPT+     D +K+     +        + FN     N     +AF+   K
Sbjct  107881  DAHGWILSPAPTFLDPYGDPSKFC--GVINGNKLYPADVFNRSPEDN----TKAFLARFK  108042

Query  85      YTVTDGADYY--------CGFTNAKAAPQPIPDGTMR----STGY--THDGPCEVWLDST  130
                  T    ++        CG T    A +   DG ++      G+  +H+GPCEVW D+T
Sbjct  108043  VDYTSLKQFFDKNDDCGECGITKFGTAQKLPADGVVKWRNGGEGFVSSHEGPCEVWCDNT  108222

Query  131     RVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                V Q+DNC    P     +D + C G+  +   W+    +     WQVYK C+ L
Sbjct  108223  VVFQNDNCARNVPSGNMQIDVAKCSGAKKMVVLWIALHAV----DWQVYKNCVAL  108375

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 17/133 (13%)
 Frame = -1

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTN-AKAAPQPI-PDGTMR----STGY--THD  120
               +++ Y +LR F++  K + T GA   CG T    + PQ I P GT++      G+  TH+
Sbjct  249023  KASPYMSLRDFVN--KNSATCGA---CGLTTMVGSTPQSINPAGTIQWKHDDEGFVETHN  248859

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
               GPCEVW D + V Q DNC    P     +D   C+ +  L  YWL      +   WQVY 
Sbjct  248858  GPCEVWCDDSIVFQDDNCPLHEPSGLLRVDMDKCRKAKSLVIYWLAL----HSPQWQVYL  248691

Query  181     ACIPLSSSARRLE  193
                C+ L  +   ++
Sbjct  248690  NCVALGGNGNSID  248652

 Score = 35.0 bits (79),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 28/59 (47%), Gaps = 4/59 (7%)
 Frame = +2

Query  124     EVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
               EV     RV  ++NC    P     ++ ++C GS  L + WL      +  SWQVYK C
Sbjct  140858  EVGTWGRRVYSNENCARNIPDGGMPINVATCNGSKRLFFLWLAM----HTSSWQVYKNC  141022

 Score = 30.0 bits (66),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 25/46 (54%), Gaps = 6/46 (13%)
 Frame = +3

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR  113
               + + Y +L+A +D    T  +     CG T +  APQP+P DG ++
Sbjct  140739  QKSSYSSLKALVDSQANTCGE-----CGITRSDGAPQPLPADGVVK  140861

>PYAP:scaffold_23 pag1_scaffold_23 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_23:1:110862:1 
REF
Length=110862

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 70/140 (50%), Gaps = 12/140 (9%)
 Frame = -1

Query  59     KTVEDFNGWRRSNGYKTLRAF----MDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMR  113
              K  E F    +++ YKTL+ F    MD +K          CGFT+  + P QP+P+    
Sbjct  10962  KNAEVFARAFKASQYKTLKDFLLKNMDMSKGRSNMPKTRECGFTDPNSGPVQPLPNQLEW  10783

Query  114    STG-YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLK  171
                G   HDGPCEVW D+T V+  + NC +T+P   +N + ++C+G   L  YW+ T    
Sbjct  10782  YGGQMNHDGPCEVWCDNTVVIPFTANCAKTYPTGKFNYNKAACQGKKRLTMYWMSTLM--  10609

Query  172    NEHSWQVYKACIPLSSSARR  191
                  WQVY  C  +   A R
Sbjct  10608  ---EWQVYIDCAKIGGGAAR  10558

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 5/51 (10%)
 Frame = -2

Query  132   VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
              ++S NC  TFP   +  D + C G   L  YW+GT        WQVY  C
Sbjct  8987  TMKSYNCAATFPDGKFKYDKAKCVGKKRLTMYWMGTLL-----QWQVYINC  8850

 Score = 30.8 bits (68),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 21/40 (53%), Gaps = 2/40 (5%)
 Frame = -1

Query  95    CGFTNAKAAP-QPIPDGTMRSTG-YTHDGPCEVWLDSTRV  132
             CG T+  + P QP+PD      G   HDGPCEV  D   V
Sbjct  9093  CGLTDPTSGPVQPLPDQLEWYGGKMNHDGPCEV*CDDEVV  8974

>PYAR:scaffold_4452 par_scaffold_4452 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4452:1:2219:1 
REF
Length=2219

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 80/181 (44%), Gaps = 21/181 (12%)
 Frame = +2

Query  26   DAHQVVLLP--------APTYTTDNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNGYKT  75
            DAH  + LP        AP+ T D  +T   P  ++F       T      ++  + Y +
Sbjct  353  DAHSKMTLPKPNSAIDNAPSGTLDGPNTLQVPAGMSFGYGHEQNTAAFLKAYKSQSKYTS  532

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY--THDGPCEVWLDSTRVL  133
            +R  M   K+    GA   CG +     PQ +PD     TG+  TH GPCEVW D  RV 
Sbjct  533  IRQ-MIYDKFRPDGGATKECGRSAMTGPPQDLPDFVEYETGFDSTHWGPCEVWCDDKRVF  709

Query  134  QSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
              DNC   +P K   L Y  + C+G+  L+ +WL          WQ Y +C  L  S +R
Sbjct  710  YEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLALHV----PDWQAYISCATL--SGKR  871

Query  192  L  192
            L
Sbjct  872  L  874

>PYIR:scaffold_81 pir_scaffold_81 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_81:1:58218:1 
REF
Length=58218

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 85/182 (47%), Gaps = 19/182 (10%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKY-APLAFLESQGFK----------TVEDFNGWRRSNGYK  74
             +AH  + +P  +YT     T Y A L+   +  F+            + F    R+ GY 
Sbjct  5041  EAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAAGYP  4862

Query  75    TLRAFMDGAKYTVTDG-ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVL  133
             +L+  +D A     +   D      +  +A +   D        +H GPCEVW+D+TR  
Sbjct  4861  SLKTLLDPAAPGCGNSRLDVPAVDVSRLSAMEFRNDEYHEGFVSSHHGPCEVWIDNTRAF  4682

Query  134   QSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS-AR  190
              +D+C   FPG   +  +++S CK  C L +YWL      +E +WQVYK C+P+ +   +
Sbjct  4681  HNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLAL----HEPTWQVYKQCVPIQNGDGK  4514

Query  191   RL  192
             RL
Sbjct  4513  RL  4508

>PYAR:scaffold_4887 par_scaffold_4887 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4887:1:1921:1 
REF
Length=1921

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 11/124 (9%)
 Frame = -1

Query  73   YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDST  130
            YKTLR  +   K+     +   CGF+     PQ +PD    +TG++  H GPCEVW D+T
Sbjct  631  YKTLRDLVYD-KFVPNGASTKECGFSAMTGTPQSLPDYVEYATGFSESHWGPCEVWCDNT  455

Query  131  RVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
            RV    NC  ++P +   L  D + C G+  L+ +WL      +E  WQVY AC  L  +
Sbjct  454  RVFVDPNCRISYPTRPAKLPYDMAKCIGAKRLQTFWLAL----HEPKWQVYTACATL--N  293

Query  189  ARRL  192
             RR+
Sbjct  292  GRRM  281

>ALCA:scaffold_168 AcNc2_CONTIG_168_length_51659 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_168_length_51659:1:51659:1 
REF
Length=51659

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 18/130 (14%)
 Frame = -3

Query  64     FNGWRRSNGYKTLRAFMDGAKYTVTD---GADYYCGFTNAKAAPQPIP---------DGT  111
              F+G  + N    L AF      T+ D       YCG TN  A+P+PIP           T
Sbjct  27906  FDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPYCGSTNPNASPKPIPADNAIVWENPDT  27727

Query  112    MRSTGYTHDGPCEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRF  169
                    +H GPCEVWL  TRV   DNC  H T       +++SSC G C+L+++WL    
Sbjct  27726  REGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL--  27553

Query  170    LKNEHSWQVY  179
                +E  WQVY
Sbjct  27552  --HEPQWQVY  27529

>PHCA:scaffold_40 PHYCAscaffold_40
Length=570383

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = +2

Query  95      CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGK---TYN  148
               CG T     PQP+P DG ++  S G +H GPCE+W D TRV  + NC   + G+   +  
Sbjct  112640  CGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLP  112819

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
               +D  +CK S  L +YWL  +       WQVY  C+ L  SA      +N +++I
Sbjct  112820  IDLDTCKSSSELVFYWLSLQGAP----WQVYINCVKLDGSAAAGNDKSNSTSSI  112969

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 10/101 (10%)
 Frame = +2

Query  95      CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGK---TYN  148
               CG T     PQP+P DG ++  S G +H GPCE+W D TRV  + NC   + G+   +  
Sbjct  164228  CGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLP  164407

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               +D  +CK S  L +YWL          WQVY  C+ L  SA
Sbjct  164408  IDLDTCKSSSELVFYWLALHV----QPWQVYINCVTLDGSA  164518

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 75/171 (44%), Gaps = 22/171 (13%)
 Frame = +2

Query  28      HQVVLLPAPTYTTDNKDTKYAPLAFL---ESQGFKTVEDF----NGWRRSNGYKTLRAFM  80
               H  +++P P    +N      P   +   E  G  +  D+    + W   N   +L+ ++
Sbjct  108584  HGNIIVPKPQGNAENPYYIGGPAGTIDMPEIIGSASYGDYYQAVDDWFTKNNVASLKEYI  108763

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDN  137
                     +++     CG T  K   Q +P DG  +  + G +H GPCE+W D TRV    N
Sbjct  108764  TTYGTGISE-----CGNTEKKGTAQSVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFHDTN  108928

Query  138     CHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               C  TF G++     +D S+CK S    +YWL          WQVY  C+ L
Sbjct  108929  CVTTFSGQSPAKIPIDVSTCKSSSEFVFYWLALH----AQPWQVYINCVAL  109069

 Score = 37.0 bits (84),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%)
 Frame = +1

Query  112     MRST---GYTHDGPCEVWLDSTRVLQSDNCHETFPG  144
               +RST   G  H GPCE+W D+TRV    +C +T  G
Sbjct  110497  LRSTYTLGNPHPGPCEIWCDNTRVYSDADCAKTLKG  110604

 Score = 31.2 bits (69),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 20/43 (47%), Gaps = 4/43 (9%)
 Frame = +3

Query  149     LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARR  191
               +D S+CK S    +YW           WQV+  C+ L  SA R
Sbjct  110625  IDVSTCKSSSEFVFYWQALHV----QPWQVHVNCVALDGSAAR  110741

>PYAP:scaffold_630 pag1_scaffold_630 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_630:1:18565:1 
REF
Length=18565

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 61/192 (32%), Positives = 89/192 (46%), Gaps = 28/192 (15%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGF---------KTVEDFNGWRRSNGYKTL  76
              DAH  + +P PT+  D      +P A +  + F         K  E      +S G KTL
Sbjct  13975  DAHSYMSVPKPTFP-DQFYQPMSPFARINGESFPGAASVPSYKGPEKIAAAIKSTGAKTL  13799

Query  77     RAF-MDGAKYTVTDGADY---YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
              R F M     T+TD        CG + A  A Q + D T+  T + H GPCE+W D+TR+
Sbjct  13798  RQFVMTNMNITMTDMVKQPTKECGMSQANGARQALTD-TVEWT-WAHPGPCEIWCDNTRL  13625

Query  133    LQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
                + +C     G    +D S CKG+  L+  ++GT       +W+VY  C+P       L
Sbjct  13624  FFNADCSGNNVGN-VKIDKSKCKGANFLQGMYVGTHV----PNWEVYVNCVP-------L  13481

Query  193    EGAANESAAIEF  204
              EG ++ +AA  F
Sbjct  13480  EGGSSTNAAAVF  13445

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 77/160 (48%), Gaps = 17/160 (11%)
 Frame = -2

Query  26     DAHQVVLLPAPTYTTDNKDTKYA-PLAFLESQGF-KTVEDFNGWRR----SNGYKTLRAF  79
              DAH  + +P PTY  D    +Y  P+  ++   F K +  + G  +      G  +L++F
Sbjct  12519  DAHSSMTVPKPTY--DQGFYQYMNPVMRIDGNKFAKNIPGYKGIEKITAAMQGQSSLKSF  12346

Query  80     MDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCH  139
              +  A   +  G    CG+      PQP+PD    +  + H GPCEVW D+T+V  + NC 
Sbjct  12345  IM-ANAVLPGGGSKECGWGKVNGEPQPLPDAVEFT--WAHPGPCEVWCDNTKVFYNINCM  12175

Query  140    ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
                  GK   L+   C G+ M++  ++GT       +W+VY
Sbjct  12174  GNNVGKV-PLN-GKCNGAKMVQAMYIGTHV----ENWEVY  12073

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 75/177 (42%), Gaps = 20/177 (11%)
 Frame = -2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK---TVEDFNGWRR------SNGYKTL  76
              +AH  + +PAP +  D      +P+  +    F    ++  + G  +      + GY TL
Sbjct  15528  EAHTNMAVPAPKFP-DGFYNGNSPMGRINGDSFAGAASIPSYQGADKLAKVMETEGYTTL  15352

Query  77     RAF-MDGAKYTVTDG--ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVL  133
              R   M     +  DG      CG T      QP+PD      G  H GPCEVW D+ R+ 
Sbjct  15351  RQLIMKNVNLSTIDGHTGTKECGLTITTGPKQPLPDAVDFPWG--HPGPCEVWCDNNRIF  15178

Query  134    QSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
               + NC     GK   +D + C G  +++  ++G        +W+VY  C P+    +
Sbjct  15177  FNKNCQANNVGKVP-IDKTKCAGVNIIQAMYIGVHVA----NWEVYANCAPIVGGTK  15022

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 72/173 (42%), Gaps = 21/173 (12%)
 Frame = -1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT----------VEDFNGWRRSNGYKT  75
              +AH  + +PA  +  DN     +P+  ++   F +           E         GY T
Sbjct  17377  EAHTNMAVPALKWP-DNFYNGNSPMGRIDGDSFPSSAEVSKTSYGAEKLAKIMEKEGYTT  17201

Query  76     LRAF-MDGAKYTVTDG--ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
              LR   M   K +  +G      CG T      QPIPD      G  H GPCEVW D+ R+
Sbjct  17200  LRQLIMKNVKLSAINGLTGKKECGLTITTGEKQPIPDEIDFPWG--HPGPCEVWCDNNRI  17027

Query  133    LQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                + +C     GK   +D + C G  +++  ++G        +W+VY  C P+
Sbjct  17026  FYNQDCQANNVGKV-KVDKTKCAGVNIIQAMYIGVHVA----NWEVYANCAPM  16883

>PYIR:scaffold_5821 pir_scaffold_5821 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_5821:1:515:1 
REF
Length=515

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 74/176 (42%), Gaps = 26/176 (15%)
 Frame = -1

Query  28   HQVVLLPAPTYTTDNKDTKY-----APLAFLESQGFKTVED-------FNGWRRSNGYKT  75
            H  + +P  T+  +   T++      P       G     D       F    +++ YK+
Sbjct  515  HGYMSVPKTTFAINGDPTQFCATMNGPTTLTAPSGMSFTTDPASNTKAFTAALKASTYKS  336

Query  76   LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWLD  128
            +RA +D AK     GA+  CG T+     QP+P   +      + G+T  H GPCEVW D
Sbjct  335  VRALVD-AKGQFISGANKQCGVTSPTGDKQPLPAQYVEWAHSSTEGFTPSHQGPCEVWCD  159

Query  129  STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                   +NC   +P     L Y  S C G+ ML+ YWL      +  +WQ Y  C
Sbjct  158  DKMAFSDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLAL----HSSTWQAYINC  3

>PYAR:scaffold_1366 par_scaffold_1366 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1366:1:8801:1 
REF
Length=8801

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 71/164 (43%), Gaps = 16/164 (10%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLE---SQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
             DAH  V L  P        +K + +A  +      FKT   +    ++ G   LR F++ 
Sbjct  1731  DAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLED  1552

Query  83    AKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNCHE  140
                         CG +   A P+ IP     S   T  H GPCEVW D       D+C +
Sbjct  1551  KGPV--------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDCEK  1396

Query  141   TFPGKT-YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             TF   T + +D+S C GSC+LR+YWLG +       WQ Y   +
Sbjct  1395  TFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYSTIV  1270

>PYIW:scaffold_1535 piw_scaffold_1535 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1535:1:8373:1 
REF
Length=8373

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 78/180 (43%), Gaps = 26/180 (14%)
 Frame = -2

Query  27    AHQVVLLPAPTYTTDNKDTKYA-----PLAFLESQGFKTVED-------FNGWRRSNGYK  74
             AH  + +P  T+   +  T++A     P       G     D       F    +++ YK
Sbjct  7073  AHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKASTYK  6894

Query  75    TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEVWL  127
             ++RA +D  K      A+  CG T+   A QP+PD  +      S G+T  H GPCEVW 
Sbjct  6893  SMRALVDD-KAVFIKEANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPCEVWC  6717

Query  128   DSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             D       +NC   +      L  D++ C G+ +L+  WL      +  +WQ+Y  C PL
Sbjct  6716  DDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLAL----HSSTWQIYINCAPL  6549

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/175 (23%), Positives = 68/175 (39%), Gaps = 26/175 (15%)
 Frame = +2

Query  27    AHQVVLLPAPTYTTDNKDTKYAPL----AFLESQGFKTVEDFNGWRRSNGYKT------L  76
              H  ++ P P++ +    T Y       A      F T    N       +KT      L
Sbjct  4832  GHGFLVKPKPSFQSGVDITSYTGTMMGDAIYPGVAFNTAPSINMENFIKNFKTDTRHPNL  5011

Query  77    RAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM--------RSTGYTHDGPCEVWLD  128
             +  ++  +  +   AD  CG+T+     +P+   ++           G+ H GPCE W D
Sbjct  5012  KTLVEKNQKVINAKADAKCGWTDPSKTSEPLEGSSIIYGRNFEGTGEGFVHPGPCETWCD  5191

Query  129   STRVLQSDNCHETF----PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             +  V Q  +C E +          +D + CKG+  L  YW+      + + WQ+Y
Sbjct  5192  NVMVQQEMHCDEKYNVANKAAIIPIDAAKCKGAKQLTTYWIAM----HGNEWQIY  5344

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 30/68 (44%), Gaps = 6/68 (9%)
 Frame = +1

Query  120   DGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQ  177
              GPCEVW D     Q DNC      +   L Y  S C G  ML  YW+     +    WQ
Sbjct  2935  QGPCEVWCDDVMAFQDDNCSVNLTTQPAVLKYDKSKCAGKKMLTSYWIALHVPQ----WQ  3102

Query  178   VYKACIPL  185
             +Y  C PL
Sbjct  3103  IYTYCAPL  3126

>PHCA:scaffold_146 PHYCAscaffold_146
Length=47772

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = +1

Query  95   CGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSDNCHETFPGK---TYN  148
            CG T     PQP+P DG ++  S G +H GPCE+W D TRV  + NC   + G+   +  
Sbjct  49   CGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLP  228

Query  149  LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAI  202
            +D  +CK S  L +YWL  +       WQVY  C+ L  SA      +N +++I
Sbjct  229  IDLDTCKSSSELVFYWLSLQGAP----WQVYINCVKLDGSAAAGNDKSNSTSSI  378

>PYAP:scaffold_744 pag1_scaffold_744 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_744:1:14808:1 
REF
Length=14808

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (49%), Gaps = 17/140 (12%)
 Frame = +3

Query  70    SNGYKTLRAF-MDGAKYTVTDGADYYCGFTNAKAA-PQPIPDGTM----RSTGYT--HDG  121
             S+ YKTLR F +   +  V+      CG T + +  PQP+P+  +       G+T  H+G
Sbjct  4506  SSSYKTLREFVLKNQRLEVSSVITPECGRTKSDSGNPQPLPEMIVWQHGEGEGFTPSHEG  4685

Query  122   PCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             PCE+W D TRV    NC  T+P     L Y  S C G   L+  WL      +E  WQVY
Sbjct  4686  PCEIWCDETRVFHEANCARTYPQAPAMLPYDRSRCVGKNRLQLLWLAL----HEPRWQVY  4853

Query  180   KACIPLSSSARRLEGAANES  199
               C   +S A  + GA N S
Sbjct  4854  VNC---ASVAGGMSGAPNTS  4904

>SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.27:1:696964:1 
REF
Length=696964

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 34/174 (20%)
 Frame = +3

Query  27      AHQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFN-GWRRSNGYKTLRA  78
                H +V  P   + +D   TKY        P  F +S     V +FN  ++  + +KTLR 
Sbjct  290841  GHGIVSNPPAEFRSDVMRTKYVATIQANFPGKFDDSPQ-TNVANFNKAFKAQSQFKTLRD  291017

Query  79      FMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR----STGY----THDGPCEVWLDS  129
                +D        G D  CG+T      + IP +G M      TG     +H GPCEVW+D+
Sbjct  291018  MLD------PHGPD--CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFIPSHKGPCEVWIDN  291173

Query  130     TRVLQSDNCHETFPGK---TYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVY  179
                RV Q+D+C   FP        +DYSSC  + CMLR+YWL       E  WQVY
Sbjct  291174  ERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALH----EPMWQVY  291323

>PHRA:scaffold_123
Length=117378

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 27/137 (20%)
 Frame = +2

Query  72     GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-------RSTGY--THDGP  122
              GY +LR  +D     VTD     C  T    +P  +   T+          G+  +H GP
Sbjct  24674  GYSSLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTVLNWQNDQEQKGFIDSHHGP  24829

Query  123    CEVWLDSTRVLQSDNCHETFPGKTY----NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              CEVW+D T+V   D+C  T+ G  Y    + D+S C G C LR+YWL       E +WQV
Sbjct  24830  CEVWIDDTKVDHQDDCVATY-GSGYPASVSADFSKCSGDCTLRFYWLALH----EPNWQV  24994

Query  179    YKACIP-LSSSARRLEG  194
              YK C+P +++S  +++G
Sbjct  24995  YKQCVPVVNNSGTQVQG  25045

>PYVX:scaffold_385 pve_scaffold_385 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_385:1:26997:1 
REF
Length=26997

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 60/123 (49%), Gaps = 15/123 (12%)
 Frame = -3

Query  73     YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
              Y +LR F++     V       CG+TN     Q +PD  +      + G+T  H+GPCEV
Sbjct  26080  YTSLREFVEDLGQVVESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGFTSSHEGPCEV  25901

Query  126    WLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
              W D TRV Q D+C   + T P K    D  +C GS  L +YWL      +  +WQVY  C
Sbjct  25900  WCDETRVFQDDDCAANYTTAPAK-LPYDRDACLGSSALTFYWLA----LHSSTWQVYINC  25736

Query  183    IPL  185
                L
Sbjct  25735  AAL  25727

>PHSO:scaffold_15
Length=1143705

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 84/176 (48%), Gaps = 22/176 (13%)
 Frame = +2

Query  27      AHQVVLLPAPTYTTDNKDTKYAP---LAFLESQGFKTVEDF----NGWRRSNGYKTLRAF  79
               AH  +++P PT   ++      P   +   E  G  +  D+    + W   N   +L+ +
Sbjct  573122  AHGNIIVPKPTGNAEHPYYIGGPAGTIDMAELVGSASYGDYYQAADDWFTKNNVASLKEY  573301

Query  80      MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSD  136
               +   KY  TD ++  CG T  K   QP+P DG  +  + G +H GPCE+W D TRV  + 
Sbjct  573302  I--TKYG-TDISE--CGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNT  573466

Query  137     NCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189
               NC + + G+      +D S+CK S    +YWL      +   WQVY  C+ L  +A
Sbjct  573467  NCAQEYAGEVPTKLPIDVSTCKASSEFVFYWLAL----HAQPWQVYINCVALDGTA  573622

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 69/141 (49%), Gaps = 22/141 (16%)
 Frame = +2

Query  58      FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYY-CGFTNAKAAPQPIP-DGTMR--  113
               ++ V+D   W   N   +++       Y  T G+D   CG T     PQP+P DG ++  
Sbjct  579320  YQAVDD---WFSKNNIDSVK------DYIKTYGSDIAECGNTKKNGTPQPVPEDGFVKHD  579472

Query  114     STGYTHDGPCEVWLDSTRVLQSDNCHET--FPGK---TYNLDYSSCKGSCMLRWYWLGTR  168
               + G +H GPCE+W D TRV  + +C  +  F G+   +  +D ++CK S  L +YWL   
Sbjct  579473  TLGTSHPGPCEIWCDDTRVFHNVDCGLSGEFAGQAPTSLPIDVATCKASSQLVFYWLALH  579652

Query  169     FLKNEHSWQVYKACIPLSSSA  189
                      WQVY  C+ L   A
Sbjct  579653  V----QPWQVYINCVTLDGKA  579703

>PYIR:scaffold_973 pir_scaffold_973 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_973:1:12152:1 
REF
Length=12152

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 74/172 (43%), Gaps = 21/172 (12%)
 Frame = -1

Query  26    DAHQVVLLPAPTY-----TTDNKDTKYAPLAFLESQGFKTVED-------FNGWRRSNGY  73
             DAH  + LP PT+     T     T   P A     G     D       F    +S+ Y
Sbjct  4889  DAHSKMSLPKPTWDNGYGTNSPSGTIDGPSALTAPSGMSFSTDPSSNTKAFTAALKSSKY  4710

Query  74    KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTRV  132
              +L+      + T + GA   CGF+   AA QP+PD         +H+GPCEVW D T  
Sbjct  4709  GSLKELAFATQKTES-GASKDCGFSKVGAA-QPLPDVVQWDELTPSHEGPCEVWCDGTMA  4536

Query  133   LQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
                DNC +T+ G    L Y  S C G+ +L   WL      +  +WQVY  C
Sbjct  4535  FHGDNCAKTYTGTPAKLPYDKSKCSGAKVLMSIWLAL----HTPTWQVYTNC  4392

>SADI:scaffold_264 supercont1.264 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.264:1:6072:1 
REF
Length=6072

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 79/177 (45%), Gaps = 42/177 (24%)
 Frame = +1

Query  28    HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNG------------YKT  75
             H +V  P   +  D   T Y      E Q F   + FNG  R N             YKT
Sbjct  1408  HGIVSNPFAEFKADVMHTTYV----AEIQAFLPGK-FNGSPRDNAVNFNKAFKAQSKYKT  1572

Query  76    LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR------STGY--THDGPCEVW  126
             LRA +D        G D  CG T    A + IP +G M         G+  +H GPCEVW
Sbjct  1573  LRAMLD------PHGPD--CGNTLTNVARKEIPSNGKMTFQNPDTGEGFIPSHTGPCEVW  1728

Query  127   LDSTRVLQSDNCHETFPGK---TYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSWQVY  179
             LD+ RV Q+D+C   FP K      +DYSSC    CMLR+YW+     +    WQVY
Sbjct  1729  LDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALHSPR----WQVY  1887

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 71/153 (46%), Gaps = 43/153 (28%)
 Frame = -3

Query  61   VEDFN-GWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----  113
            V +FN  ++  + +KTLR  +D        G D  CG T    A + IP DGTM      
Sbjct  544  VANFNKAFKAQSQFKTLRDMLD------PQGPD--CGNTLTTGAKKSIPSDGTMTWQNPD  389

Query  114  -STGYT---------------HD----GPCEVWLDSTRVLQSDNCHETFPGKT---YNLD  150
               G+                HD    GPCEVWLD  RV Q+D+C   FP K      +D
Sbjct  388  TGEGFVPSHTVYKECPWFDDAHDLSY*GPCEVWLDDKRVFQNDDCATNFPAKPAAHLPID  209

Query  151  YSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKAC  182
            YSSC G  CMLR+YWL      +E  WQVY  C
Sbjct  208  YSSCSGDGCMLRFYWLAL----HEPMWQVYSTC  122

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 78/176 (44%), Gaps = 24/176 (14%)
 Frame = -2

Query  26      DAHQVVLLPAPTY--------TTDNKDTKYAPLAFLESQGFKT-VEDFNGWRRSNGYKTL  76
               +AH  + LPAPT+        +T +      P     S G  T    F+    + G ++L
Sbjct  690943  NAHGQLTLPAPTFNGYGGGVASTIDVALLPVPSGMTYSAGPDTNAAAFDKAFSATG-QSL  690767

Query  77      RAFM------DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDST  130
               + F+       GA  T    A   CGF++ K  PQP+PD     T + H GPCE W D  
Sbjct  690766  KDFILKNQDQSGATSTPLSAA---CGFSDPKGTPQPLPDKIQWGTSFIHPGPCEAWCDDE  690596

Query  131     RVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                V+  + NC   F   +   D + C+G   L +YWL      +   WQVY  C+PL
Sbjct  690595  IVVPYTANCWTEFKDGSVPYDKAKCQGKKQLTFYWLAV----HSPPWQVYINCVPL  690440

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 65/130 (50%), Gaps = 12/130 (9%)
 Frame = -2

Query  62      EDFNGWRRSNGYKTLRAFM----DGAKYTVTDG-ADYYCGFTNAKAAPQPIPDGTMRSTG  116
               + F+   R+    TL+ F+    D +K +   G AD  CGF+ +  A Q +PD     TG
Sbjct  681175  DSFDKAFRAQKKSTLKDFILQYQDTSKGSAGGGTAD--CGFSKSNGAAQALPDSLQWGTG  681002

Query  117     YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
               + H GPCE W D+  V+  + NC +TF G       + C G   L +YWLG     +   
Sbjct  681001  FIHPGPCEAWCDNEIVVPYTANCWKTFSGGNVPYAKAKCAGKSRLTFYWLGV----HGPP  680834

Query  176     WQVYKACIPL  185
               WQVY  C+PL
Sbjct  680833  WQVYINCVPL  680804

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 70/177 (40%), Gaps = 26/177 (15%)
 Frame = +3

Query  27      AHQVVLLPAPTY--------TTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRA  78
               AH  +  PAPT+         T +     AP       G+    D N       +K L+ 
Sbjct  736209  AHGQLTEPAPTFKGYGGGFPATIDISVMPAPAGM----GYSAGPDTNDAAFDTAFKALKP  736376

Query  79      FMDGA----KYTVTDGAD-----YYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
                M       KY    GA        CGF++    PQ +PD     T + H GPCE W D 
Sbjct  736377  KMSLKDFILKYQDPKGASSPPLSTECGFSDPDGTPQALPDKLQWGTSFIHPGPCEAWCDD  736556

Query  130     TRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                 V+  + NC  T+   T   + + C+G   L +YWL      +   WQ Y  C+PL
Sbjct  736557  VNVVPYTANCWITYKNGTVPYEKAKCEGKKRLTFYWLAV----HSPPWQPYINCVPL  736715

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +1

Query  121     GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
               GPCE+WLD T VL+ +NC   FPG      +D+SSC G C++R+YWL  +    E +WQ+
Sbjct  299515  GPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQI  299682

Query  179     Y  179
               Y
Sbjct  299683  Y  299685

 Score = 39.3 bits (90),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  120     DGPCEVWLDSTRVLQSDNCHETFPG  144
                GPCE+WLD T VL+ +NC   FPG
Sbjct  309225  SGPCEIWLDDTPVLKEENCAGRFPG  309151

 Score = 37.7 bits (86),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/64 (30%), Positives = 35/64 (55%), Gaps = 13/64 (20%)
 Frame = -2

Query  142     FPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANES  199
                PG+     +D+SSC G C++R+YWL  +    E +WQ+Y       S +R + G  + +
Sbjct  309160  LPGQPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQIY-------SESRDVHGVTDRN  309014

Query  200     AAIE  203
                +++
Sbjct  309013  GSMD  309002

>PYIR:scaffold_2812 pir_scaffold_2812 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2812:1:2225:1 
REF
Length=2225

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 69/171 (40%), Gaps = 19/171 (11%)
 Frame = +1

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYT  86
             AH  ++ P PT++             +++   K  + F G   +N      AF    K +
Sbjct  889   AHGNLVRPQPTFSGYGXXXXXXXXXIIQTAKLKAGQSFVGAPDTNAASFDAAFKAAGKSS  1068

Query  87    VTD--------------GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
             + D              G    CGF+N    PQP+PD     TG+ H GPCE + D+  V
Sbjct  1069  LKDFILANQDTSQGSAKGLSPACGFSNPNGTPQPLPDTLQWGTGFIHPGPCEAYCDNEIV  1248

Query  133   LQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
             +  + NC +TF         + C G   L +YWL      +   WQVY  C
Sbjct  1249  VPYTANCWKTFASGAVPYSKAKCAGKKQLTFYWLAV----HGPPWQVYSKC  1389

>PYAP:scaffold_209 pag1_scaffold_209 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_209:1:44730:1 
REF
Length=44730

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 84/190 (44%), Gaps = 40/190 (21%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKY----------APLAFLESQGFKTVE--DFNGWRRSNGY  73
             DAH  ++ PA  +  +   T Y          AP A  +     T     F    + + Y
Sbjct  2245  DAHGYLVQPAAKFKPNVMTTNYNGIINAYSLPAPFAGKKFNDNPTANANTFTAAFKQSSY  2424

Query  74    KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THDGP  122
             K+++A MD  KY V D     CG T    +P  I    MRS  +           +H GP
Sbjct  2425  KSIKALMD--KY-VPD-----CGNTLMNGSP--INVSGMRSVKWANDQERVGFIKSHSGP  2574

Query  123   CEVWLDSTRVLQS-DNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             CEVW+D+  V Q   NC E +      L  DYS CKG C L +YWL      +E +WQ+Y
Sbjct  2575  CEVWIDNKMVFQELGNCVEKYTSYPAELPVDYSVCKGKCQLTFYWLAL----HEPNWQIY  2742

Query  180   KACIPLSSSA  189
             K C P+ + +
Sbjct  2743  KQCAPIQNGS  2772

>PHCA:scaffold_49 PHYCAscaffold_49
Length=508508

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/196 (29%), Positives = 81/196 (41%), Gaps = 40/196 (20%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQG-----------FKTVEDFNGWRRSNGYK  74
              DAH  +  PA  +      T Y      +  G                 F     + GY 
Sbjct  24620  DAHGYISKPAAQFVDPTASTSYVKTITADVNGAFGGLKWDDNPVANAATFTSSFPNTGYS  24799

Query  75     TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-------RSTGY--THDGPCEV  125
              +LR  +D     V+D     C  T    +P  +   T+          G+  +H GPCEV
Sbjct  24800  SLRNMLD---QQVSD-----CANTKTDVSPVDVSGLTVMNWQNDQEQKGFIDSHHGPCEV  24955

Query  126    WLDSTRVLQSDNCHETFPGKTY----NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
              W+D T V   D+C  T+ G +Y      DYS C G C LR+YWL       E +WQ+YK 
Sbjct  24956  WIDDTMVDHQDDCVATY-GSSYPANVKADYSQCSGDCTLRFYWLALH----EPNWQIYKQ  25120

Query  182    CIPL---SSSARRLEG  194
              C+P+   S +  +++G
Sbjct  25121  CVPIVNNSGTQSQVQG  25168

>PLHA:NW_020187410.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_490, whole genome shotgun sequence
Length=4199

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 16/125 (13%)
 Frame = +2

Query  71    NGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGYTHDGPCEVWLD  128
             N +K LR+  +G      +     CG+T+ K  P   P DG    S G  H G CE+W D
Sbjct  3314  NNFKDLRSLFEGNPIYGEE-----CGYTDPKGPPADRPNDGAATFSRGILHAGTCEIWFD  3478

Query  129   STRVLQSDNCHETFPGKTYN-------LDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYK  180
                VLQ+D+C   +   T         +DY  C    CMLR+YWL  + + ++  WQVY+
Sbjct  3479  DKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRI-DKTVWQVYR  3655

Query  181   ACIPL  185
              CIPL
Sbjct  3656  NCIPL  3670

>PYAR:scaffold_3482 par_scaffold_3482 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3482:1:3236:1 
REF
Length=3236

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 67/128 (52%), Gaps = 11/128 (9%)
 Frame = +2

Query  64    FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGF-TNAKAAPQPIPDGTM--RSTGYTHD  120
             FN   +++ YK+L+  +   +  V+ GA   CGF T + A PQP+PD       TG +H 
Sbjct  1739  FNAAFKNSKYKSLKELVLQNQ-KVSAGATAECGFATLSGATPQPLPDVVEWDEFTG-SHT  1912

Query  121   GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYS--SCKGSCMLRWYWLGTRFLKNEHSWQV  178
             GPCEVW D+    Q DNC +   G    L+Y   +C G+ +L  YW+     +    WQV
Sbjct  1913  GPCEVWCDNNLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQV  2080

Query  179   YKACIPLS  186
             Y  C PLS
Sbjct  2081  YTGCAPLS  2104

>PYIW:scaffold_878 piw_scaffold_878 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_878:1:13019:1 
REF
Length=13019

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 76/182 (42%), Gaps = 23/182 (13%)
 Frame = +3

Query  26   DAHQVVLLPAPTYTTDNKDTKYA---PLAFLESQGFKTVEDFNGWR-------RSNGYKT  75
            DAH V+  P P +        Y+   P+  + +         N W        + + YK+
Sbjct  51   DAHGVLSKPGPAFAGTAYAGGYSADIPMKAMPAVAPDVYSPSNSWAEVFGKAFKKSSYKS  230

Query  76   LRAFM---DGAKYTVTDG--ADYYCGFTNA-KAAPQPIPDGTM-RSTGYTHDGPCEVWLD  128
            LR FM         V  G  +   CGFT   K   Q +PD       G  H GPCE W D
Sbjct  231  LREFMMKNQNMNGGVKSGNPSTKECGFTAPEKQTAQALPDNIEWYGGGMNHPGPCEAWCD  410

Query  129  STRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
            +  VL  +DNC +TFP      D + C G   L +YW+ T      + WQVY  C+ + +
Sbjct  411  NELVLPFTDNCQQTFPKGVMKYDKAKCVGKNQLSFYWMATL-----NQWQVYIDCVKIGN  575

Query  188  SA  189
             A
Sbjct  576  GA  581

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 23/125 (18%)
 Frame = +2

Query  73       YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPC  123
                +KTL+A MD      T  +D  CG T+   +P  +          D   +    +H GPC
Sbjct  4462331  FKTLKAMMD------TVASD--CGKTSLTGSPVDVSSLSSMTWQNDQEQKGFIDSHRGPC  4462486

Query  124      EVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
                E W+D TRV  SD+C   + G      +D+SSC G C   +YWL      +E +WQVYK 
Sbjct  4462487  EGWIDDTRVFHSDDCRADYTGYPAEIPVDFSSCSGDCTFTFYWLAL----HEPNWQVYKQ  4462654

Query  182      CIPLS  186
                C P++
Sbjct  4462655  CAPIT  4462669

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 8/74 (11%)
 Frame = -3

Query  118      THDGPCEVWLDSTRVLQSDNCH---ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
                +H+GPCE W+  T+V   DNC    +++P K    DYSSCKG C+  +YWL       E 
Sbjct  4473243  SHEGPCEAWIGETQVFHYDNCAARFKSYPAK-IPADYSSCKGDCLFAFYWLALH----EP  4473079

Query  175      SWQVYKACIPLSSS  188
                +WQ+YK C+P++++
Sbjct  4473078  NWQIYKQCVPITNN  4473037

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 54/117 (46%), Gaps = 15/117 (13%)
 Frame = -2

Query  59       KTVEDFNGWRRSNGYKTLRAFMD------GAKYTVTDGADYYCGFTNAKAAPQPIPDGTM  112
                +  + F     + GYK+LR  +D      G         D   G+T          +G +
Sbjct  1914931  QNAQAFTDHWNATGYKSLRDMLDPIAPDYGHSLKTATPVDV-SGYTEMWWQNDEYKEGFI  1914755

Query  113      RSTGYTHDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLG  166
                 S    H+GPCE W+D TR+   DNC    +++P K    DYSSCKG C+  +YWL 
Sbjct  1914754  AS----HEGPCEAWIDDTRIFHYDNCAAQFKSYPAKI-PADYSSCKGDCLFAFYWLA  1914599

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 66/163 (40%), Gaps = 33/163 (20%)
 Frame = +3

Query  59       KTVEDFNGWRRSNGYKTLRAFMD---------------GAKYTVTDGADYYCGFTNAKAA  103
                  V+ F     S G+ +LR F++               GA   V  GA+    F N  AA
Sbjct  4478445  NNVDTFTEAFPSTGFASLRQFVENVYQNSRSTGCSSGTGASKVVIVGAEVQKFFWNDDAA  4478624

Query  104      PQPIPDGTMRSTGYT-----HD-------GPCEVWLDSTRVLQSDNCHETFPGK--TYNL  149
                 +   +    S  +      HD       GPCE+W+D   V Q++NC   FP    T  +
Sbjct  4478625  AEGGFEHVSLSFAWQVG*RRHDKVFVSL*GPCELWIDEGVVFQANNCAVAFPSSPATCPV  4478804

Query  150      DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
                +YSSC   C+LR+Y L         +WQ +     L   A R+
Sbjct  4478805  NYSSCNDKCVLRFYALSLA----GTAWQAFSTLNSLPLLASRV  4478921

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 66/161 (41%), Gaps = 33/161 (20%)
 Frame = +1

Query  61       VEDFNGWRRSNGYKTLRAFMD---------------GAKYTVTDGADYYCGFTNAKAAPQ  105
                V+ F     S G+ +LR F++               GA   V  GA+    F N  AA +
Sbjct  1916008  VDTFTEAFPSTGFASLRQFVENVYQNSRSTGCSSGTGASKVVIVGAEVQKFFWNDDAAAE  1916187

Query  106      PIPDGTMRSTGYT-----HD-------GPCEVWLDSTRVLQSDNCHETFPGK--TYNLDY  151
                   +    S  +      HD       GPCE+W+D   V Q++NC   FP    T  ++Y
Sbjct  1916188  GGFEHVSLSFAWQVG*RRHDKVFVSL*GPCELWIDEGVVFQANNCAVAFPSSPATCPVNY  1916367

Query  152      SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
                SSC   C+LR+Y L         +WQ +     L   A R+
Sbjct  1916368  SSCNDKCVLRFYALSLA----GTAWQAFSTLNSLPLLASRV  1916478

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = +2

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
                GPCE W+D+  V   D+C   FP     +  DYSSCKG  C+  +YWL      +   WQ
Sbjct  4458299  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPEWQ  4458466

Query  178      VY  179
                +Y
Sbjct  4458467  IY  4458472

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = -3

Query  121      GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
                GPCE W+D+  V   D+C   FP     +  DYSSCKG  C+  +YWL      +   WQ
Sbjct  4470399  GPCEGWIDNKMVFHYDDCVAEFPSYPAKIPTDYSSCKGDKCLFVFYWLAL----HSPEWQ  4470232

Query  178      VY  179
                +Y
Sbjct  4470231  IY  4470226

>ALLA:FR824076 dna:supercontig supercontig:ENA1:FR824076:1:147313:1 
REF
Length=147313

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 60/131 (46%), Gaps = 20/131 (15%)
 Frame = +3

Query  64     FNGWRRSNGYKTLRAFMDGAKYTVTD---GADYYCGFTNAKAAPQPIP---------DGT  111
              F+G    N    L AF       + D       YCG TN  A P+PIP           T
Sbjct  47601  FDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPYCGSTNPNAQPKPIPADHAIVWENPDT  47780

Query  112    MRSTGYTHDGPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTR  168
                    +H GPCEVWL+  RV   DNC E F   P +   +D+S+C   C+L+++WL   
Sbjct  47781  KEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARI-PIDFSTCTNGCLLQFFWLAL-  47954

Query  169    FLKNEHSWQVY  179
                 +E  WQVY
Sbjct  47955  ---HEPQWQVY  47978

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 24/135 (18%)
 Frame = +2

Query  72    GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGP  122
             GY +LR  +D     VTD     C  T    +P  +          D   +    +H GP
Sbjct  3134  GYSSLRDMLD---QQVTD-----CANTRTDVSPVDVSGLTTMNWQNDQEQKGFIDSHHGP  3289

Query  123   CEVWLDSTRVLQSDNCHETFPG---KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             CEVW+D T V   D+C  T+      + N D+S C G C LR+YW+      +E +WQ+Y
Sbjct  3290  CEVWIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIAL----HEPNWQIY  3457

Query  180   KACIPLSSSARRLEG  194
             K C+P+ +++   E 
Sbjct  3458  KQCVPVVNNSGAQEA  3502

>PYAR:scaffold_212 par_scaffold_212 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_212:1:25069:1 
REF
Length=25069

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 7/94 (7%)
 Frame = +2

Query  95     CGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSS  153
              CG T    APQP+PD    S    +H GPCEVW D  RV Q DNC   +P +   L  ++
Sbjct  20057  CGITPPGGAPQPVPDHVEWSAFADSHVGPCEVWCDQKRVFQEDNCAGKYPARPAKLPINA  20236

Query  154    --CKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                C  +  L++YWL      +   WQ+Y  C PL
Sbjct  20237  ADCANAKELKFYWLAL----HSQDWQIYINCAPL  20326

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 77/175 (44%), Gaps = 25/175 (14%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKDTKYA-----PLAF-------LESQGFKTVEDFNGWRRSNGY  73
              DAH  ++LP     + +  T+YA     P A          S     V+ F    +++G 
Sbjct  17812  DAHGYMMLPKAQLASGDP-TRYATTIRGPNALKVPAGGSFSSSPQVNVDSFTKAFKASGL  17988

Query  74     KTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDSTRV  132
               +L+A ++ A  +        CG T    APQ +PD    S    +H GPCEVW D+TRV
Sbjct  17989  SSLKALIEKAAPSTP-----ACGITPPGGAPQDVPDHVEWSAFADSHVGPCEVWCDNTRV  18153

Query  133    LQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               Q  NC   +P +   L  + + C  +  ++  WL      +   WQVY  C PL
Sbjct  18154  FQEANCAGRYPSRPARLPINKAQCSNAKQMKIIWLAL----HSQDWQVYINCAPL  18306

>PHRA:scaffold_51
Length=360848

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
 Frame = -3

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTN-AKAAPQPIPDGTMRSTGY  117
               TV  F     S+GY +L  F++  +   +D  D  CG+T     A Q +P   +  TG+
Sbjct  40476  ATVAFFEAQFNSSGYNSLGQFIETNQVLYSDNIDEQCGYTVYDDTARQTMPATNLTHTGF  40297

Query  118    THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHS  175
              TH GPCEVW D T VL   +C  T+P     + Y  S C  +     YWL          
Sbjct  40296  THPGPCEVWCDDTVVLFEYDCQATYPDIPAGIPYDESLCADANRFTIYWLAVHGAP----  40129

Query  176    WQVYKACI  183
              WQVY  C+
Sbjct  40128  WQVYTDCV  40105

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 55/115 (48%), Gaps = 7/115 (6%)
 Frame = -2

Query  72     GYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLDST  130
              GY +L AF+   +   +   D  CG T  K +A   +P   +  +G+TH GPCEVW D T
Sbjct  38692  GYDSLGAFIAKNQELYSSKTDPDCGLTVYKDSARSELPASKLTYSGFTHTGPCEVWCDDT  38513

Query  131    RVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              +VL   +C   +P    T   D S C  +  L  YW+G         WQVY  C+
Sbjct  38512  KVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLH----GDPWQVYTDCV  38360

>PHKE:scaffold_884 scf_22126_884.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_884.1_contig_1:1:6277:1 
REF
Length=6277

 Score = 60.8 bits (146),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 12/67 (18%)
 Frame = -2

Query  121   GPCEVWLDSTRVLQSDNCHETFPG--------KTYNLDYSSCKGSCMLRWYWLGTRFLKN  172
             GPCEV++D   VL  DNC + +PG            +DYSSC G CML +YWLG    +N
Sbjct  3858  GPCEVYIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLG---FQN  3688

Query  173   EHSWQVY  179
             E  WQ Y
Sbjct  3687  EQ-WQSY  3670

 Score = 36.6 bits (83),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 40/103 (39%), Gaps = 16/103 (16%)
 Frame = -1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
             DAH  + +P PT+      + +  L    +    G   V  F       G       +D 
Sbjct  4222  DAHGALKVPEPTFEQGASHSNWVTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKDVILDM  4043

Query  83    AKYTVTDGADYYCGFTNAKAAPQPIP-DGTM-----RSTGYTH  119
              K       D  CGFT A A PQP+P DG +      + G+TH
Sbjct  4042  VK-------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTH  3935

>PHIF:NW_003303506.1 Phytophthora infestans T30-4 supercont1.253 
genomic scaffold, whole genome shotgun sequence
Length=123523

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 87/185 (47%), Gaps = 29/185 (16%)
 Frame = +3

Query  26    DAHQVVLLPAPTYTTDNKD-TKYAPLAFLESQGFKTVEDFNGWR-----------RSNGY  73
             + H  +  PA T+ + + D T++  +A +E+   K    F+G              S+ Y
Sbjct  1839  NGHGYMTDPAVTFLSSSTDNTQF--IATIEASASKFSGTFSGSPADNTAAFTTAFESSSY  2012

Query  74    KTLRAFMDG-AKYTVTDGADYYCGFTNAKAAPQPIPDGTMR-----STGYT--HDGPCEV  125
              +L+  ++  A  TVTD A   CG  +     QP+P+  +      + G+T  H+GPCE+
Sbjct  2013  TSLKELINALATVTVTD-ATLTCGSCDPDETSQPLPETYVEWSHSSTEGFTSSHEGPCEI  2189

Query  126   WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             W D  RV Q ++C   +      L Y   +C GS  L +YWL      +  +WQVY  C 
Sbjct  2190  WCDDVRVFQDNDCAADYTSAPAELPYDRDACLGSSTLTFYWLA----LHSSTWQVYINCA  2357

Query  184   PLSSS  188
             PL S+
Sbjct  2358  PLEST  2372

 Score = 61.6 bits (148),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 37/71 (52%), Gaps = 6/71 (8%)
 Frame = +2

Query  118    THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHS  175
              TH+GPCEVW D  RV   DNC   F      L Y  S C G+ +L  YW+      +  S
Sbjct  72047  THEGPCEVWCDKKRVFYDDNCAAHFTAAPAELPYEKSKCSGASVLTMYWMAM----HGPS  72214

Query  176    WQVYKACIPLS  186
              WQVY  C PLS
Sbjct  72215  WQVYVNCAPLS  72247

 Score = 30.4 bits (67),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 33/90 (37%), Gaps = 9/90 (10%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK---------TVEDFNGWRRSNGYKTL  76
              + H  +  PA TY      ++Y       + GFK          V  F     ++ YK++
Sbjct  71722  NGHGFLTKPAATYDPQMDKSQYIATIDSSTSGFKGVFTGPPADNVAAFTKAFEASKYKSI  71901

Query  77     RAFMDGAKYTVTDGADYYCGFTNAKAAPQP  106
              +  +D     +  GA   CG  +    P P
Sbjct  71902  KEVIDDKAKIIVTGATLTCGIADPNTPPPP  71991

>PHKE:scaffold_1151 scf_22126_1151.1_contig_1 dna:supercontig 
supercontig:PhyKer238_432v1:scf_22126_1151.1_contig_1:1:3259:1 
REF
Length=3259

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (45%), Gaps = 24/170 (14%)
 Frame = -1

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFL---ESQGFKTVEDF----NGWRRSNGYKTLRAF  79
              H  +++P  T  +D++    +P   +   E  G KT  +F    + W   N   +L+  
Sbjct  2245  GHGNIIVPKLTGDSDHEYYVGSPAGIIKMDELVGDKTYGEFYLGVDDWFTKNKIASLK--  2072

Query  80    MDGAKYTVTDGADY-YCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQS  135
                 +Y  T G D   CG T+    PQP+P DG  +  + G +H GPCE+W D TRV   
Sbjct  2071  ----QYITTYGTDIDKCGSTDMAGTPQPVPSDGYAQHDTLGTSHPGPCEIWCDDTRVFHD  1904

Query  136   DNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
              NC   F G+      +D S C+ S    +YWL          WQVY  C
Sbjct  1903  TNCAGKFAGQVPTKIPIDVSVCQASSEFIFYWLALHV----KPWQVYINC  1766

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 75/175 (43%), Gaps = 22/175 (13%)
 Frame = -3

Query  27    AHQVVLLPAPTYTTDN-------KDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAF  79
              H  +++P PT  +D+         T   P    ++      E  + W   NG  +L+ +
Sbjct  1049  GHGNIIVPPPTGDSDHVYYFGGPAGTIDMPKIIGDASYGDYYEAVDEWFTKNGISSLKEY  870

Query  80    MDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR--STGYTHDGPCEVWLDSTRVLQSD  136
             +      +++     CG T      + IP DG     + G +H GPCE+W D TRV  + 
Sbjct  869   ITTYGTNISE-----CGNTLKDGTAEAIPSDGYAEHDTLGNSHPGPCEIWCDDTRVFNNT  705

Query  137   NCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
             NC   F G++     +D S+CK S    +YWL          WQVY  C+ L  +
Sbjct  704   NCVTEFSGQSPAKIPIDVSTCKASSEFVFYWLALH----AQPWQVYINCVALDGT  552

>HYAP:scaffold_463 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_463:1:12715:1 
REF
Length=12715

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 61/123 (50%), Gaps = 18/123 (15%)
 Frame = -1

Query  72    GYKTLRAFMD----GAKYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVW  126
             GYK+LR  +D    G   T TD A     G T           G + S    H GPCE W
Sbjct  7783  GYKSLRDMLDQQVPGCANTRTDVAPVDVAGLTVMNWQNDKEHKGFIDS----HHGPCETW  7616

Query  127   LDSTRVLQSDNCHET----FPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKAC  182
             +D T V + D+C  T    FP  + N D+S C G C LR+YWL      +E +WQVYK C
Sbjct  7615  IDDTMVDRQDDCVATYGTGFPA-SVNADFSRCSGVCTLRFYWLAL----HEVNWQVYKQC  7451

Query  183   IPL  185
             +P+
Sbjct  7450  VPI  7442

>PYAR:scaffold_1972 par_scaffold_1972 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1972:1:6441:1 
REF
Length=6441

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 66/150 (44%), Gaps = 15/150 (10%)
 Frame = -2

Query  26    DAHQVVLLPAPTYTTDNKD----------TKYAPLAFLESQGFKTVEDFNGWRRSNGYKT  75
             DAH ++ LP P    +N            T  A ++F +     T    + W     YKT
Sbjct  5120  DAHSMMTLPKPNSNINNSPSGTLDGPSVLTVPAGMSFGQGHEQNTKAFASAWASQTKYKT  4941

Query  76    LRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY--THDGPCEVWLDSTRVL  133
             +R  M  A +    GA   CG   A   PQP+PD    + G   TH GPCEVW D TRV 
Sbjct  4940  IRE-MIYANFKGDGGATKECGQAAATGPPQPLPDAVEYAGGLDSTHWGPCEVWCDDTRVF  4764

Query  134   QSDNCHETFPGKTYNLDY--SSCKGSCMLR  161
                NC  T+P K   L Y  + C G+  L+
Sbjct  4763  YDANCAVTYPQKPAKLPYEKAKCAGAKRLQ  4674

>HYAP:scaffold_176 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_176:1:128177:1 
REF
Length=128177

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 73/180 (41%), Gaps = 27/180 (15%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNG-----------YK  74
              +AH     PA T+      T++  +A +ES        F G    N            + 
Sbjct  37311  NAHGYCSRPAVTFPNGGDTTQF--VATIESSASGLPGVFTGSPADNAAAFWTAFGSSKFS  37138

Query  75     TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD----GTMRSTGYT--HDGPCEVWLD  128
              +++         V  GA   CG T+    PQPIPD        + G+T  H+GPCE W D
Sbjct  37137  SIKDLATSLGQIVAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCD  36958

Query  129    STRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               T+V Q +NC   F   P K    D + C G+    +YWL         +WQVY  C  L
Sbjct  36957  DTQVFQDENCAAHFTTAPAK-MPYDKAKCSGASRFTFYWLALH----SSTWQVYVNCAAL  36793

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/177 (28%), Positives = 75/177 (42%), Gaps = 25/177 (14%)
 Frame = -3

Query  28     HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTV--------------EDFNGWRRSNGY  73
              H  +LLP PT+  D    +  P AF++      V              + F     ++ +
Sbjct  42678  HNKMLLPLPTWPKDFY-AQNNPCAFVDPAKVLPVPTGLSYTYDPASNTKAFWTAFNASSF  42502

Query  74     KTLRAFM-DGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWLDSTR  131
              K+++  +  G K  +  G+   CGF+     P+ +PD         +H+GP EV+ D   
Sbjct  42501  KSIKQLIYKGQK--LEPGSSAECGFSLVDGTPRDLPDQIQWDFFTASHEGPFEVYCDDKL  42328

Query  132    VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              V +  N    FP    N  Y  + CKG+ ML  YWL    +     WQVY  C PL+
Sbjct  42327  VFKDWNAAIDFPEHPANTPYDKAKCKGAKMLTSYWLALHSV----PWQVYTNCAPLT  42169

>SAPA:scaffold_32 supercont2.32 dna:supercontig supercontig:ASM15154v2:supercont2.32:1:360474:1 
REF
Length=360474

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/172 (34%), Positives = 79/172 (46%), Gaps = 32/172 (19%)
 Frame = -2

Query  28      HQVVLLPAPTYTTDNKDTKYAPL--AFL----ESQGFKTVEDFN-GWRRSNGYKTLRAFM  80
               H V+  P   +  +   T Y  +  AFL    +      V +FN  +     YKTLR  +
Sbjct  117083  HGVISSPLAEFAPNIMRTTYVAIIQAFLPGKFDDSPQTNVANFNKAFAAQTQYKTLRDLL  116904

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR------STGY--THDGPCEVWLDSTR  131
               D        G D  CG T    A + IP DG M         G+  +H GPCE+WLDSTR
Sbjct  116903  D------LHGPD--CGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGPCEIWLDSTR  116748

Query  132     VLQSDNCHETFPGKT---YNLDYSSC-KGSCMLRWYWLGTRFLKNEHSWQVY  179
               V Q+++C   FP        +DY+ C    C+LR+YWL      ++  WQVY
Sbjct  116747  VFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLAL----HQPQWQVY  116604

>PHCA:scaffold_11 PHYCAscaffold_11
Length=1076090

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 7/136 (5%)
 Frame = -2

Query  59      KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMRSTGY  117
                TV  F     ++GY +L  F++  +    D  D  CG+T   A+  Q +P   +  TG+
Sbjct  651538  ATVAFFEVEFNASGYNSLGQFIETNQVLYCDDVDEQCGYTVYDASGRQTMPTTNLTHTGF  651359

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHS  175
               TH GPCE+W D T+VL   NC  T+P     + Y  S C  +     YWL          
Sbjct  651358  THPGPCEIWCDDTKVLFDYNCQATYPDIPAGIPYDESLCADANRFTIYWLAVHGAP----  651191

Query  176     WQVYKACIPLSSSARR  191
               WQVY  C+ L + +  
Sbjct  651190  WQVYTDCVWLETGSSS  651143

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 63/135 (47%), Gaps = 10/135 (7%)
 Frame = -2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + G  +L+A +   +    D  D  CG T  K +A   +P   +  TG+TH GPCEVW D
Sbjct  685048  TTGGGSLKALISKNQKLYNDKVDPECGLTAFKDSARSKLPASQLEFTGFTHPGPCEVWCD  684869

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                T+VL   NC   +P     + Y  S C G+  L  +W+      +   WQVY  C+ L 
Sbjct  684868  DTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAV----HGEPWQVYTDCVYLE  684701

Query  187     SSARRLEGAANESAA  201
                 +    GAA  S+ 
Sbjct  684700  GGSG---GAATPSSG  684665

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (49%), Gaps = 7/117 (6%)
 Frame = -1

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + GY +L AF+   +   +   D  CG T  K +A   +P   +  +G+TH GPCEVW D
Sbjct  649565  TKGYDSLGAFIAKNQELYSSKTDPDCGLTVYKDSARSKLPASELEYSGFTHTGPCEVWCD  649386

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                T+VL   +C   +P     L Y  S C  +  L  YW+G     +   WQVY  C+
Sbjct  649385  DTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGL----HGDPWQVYTDCV  649227

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 63/135 (47%), Gaps = 10/135 (7%)
 Frame = +1

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + G  +L+A +   +    D  D  CG T  K +A   +P   +  TG+TH GPCEVW D
Sbjct  647857  TTGGGSLKALISKNQKLYNDKVDPECGLTAFKDSARSKLPASQLEFTGFTHPGPCEVWCD  648036

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                T+VL   +C   +P     + Y  S C G+  L  +W+      +   WQVY  C+ L 
Sbjct  648037  DTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAV----HGEPWQVYTDCVYLE  648204

Query  187     SSARRLEGAANESAA  201
                 +    GAA  S+ 
Sbjct  648205  GGSG---GAATPSSG  648240

>PYAP:scaffold_94 pag1_scaffold_94 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_94:1:69112:1 
REF
Length=69112

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 56/130 (43%), Gaps = 8/130 (6%)
 Frame = +1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM---RST  115
              K  E+F    +++ YKTL+  +D        G    CGF+  +  PQP+PD       S 
Sbjct  27007  KNYEEFTKNFKASKYKTLKDLVDELS-KPEGGTSKECGFSKEEGKPQPLPDKVEWEGFSG  27183

Query  116    GYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
                +H GPCEVW D       DNC + F       D + C G   LR  WL     K    
Sbjct  27184  SPSHVGPCEVWCDDVLAFHDDNCVKNFADGKLPYDKAKCAGKKRLRSIWLALHVDK----  27351

Query  176    WQVYKACIPL  185
              WQVY  C  L
Sbjct  27352  WQVYPYCATL  27381

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 62/135 (46%), Gaps = 19/135 (14%)
 Frame = -1

Query  61    VEDFNGWRRSNGYKTLRAFMD------GAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS  114
             V+ F       G+ +LR+ +D      GA        D   G T+ K        G + S
Sbjct  5704  VKSFTKGYAKAGFSSLRSILDLIVTDCGATRIDVPAVDV-TGLTSMKFQNDEDKKGLIPS  5528

Query  115   TGYTHDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSC--KGSCMLRWYWLGTRFL  170
                 H GP E+W+DS R    D+C   F G      +DYS C  + +C+LR+YWL     
Sbjct  5527  ----HRGPREIWIDSKRAFHGDDCAAEFTGYPAVLPVDYSLCPPQKTCILRFYWLAL---  5369

Query  171   KNEHSWQVYKACIPL  185
              +E  WQVYK C+P+
Sbjct  5368  -HESLWQVYKQCVPI  5327

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 76/177 (43%), Gaps = 27/177 (15%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYA-----PLAFLESQGFK-------TVEDFNGWRRSNGY  73
              +AH  +++P     T    T YA     P A     G K        +  F    +S G+
Sbjct  43502  EAHGYLMVPKAYIPTSGDPTTYATTIYGPNALTPPAGMKFSDTTDRNLAAFTQAFKSAGW  43323

Query  74     KTLRAFMDGAKYTVTDGADYYCGFTNAKAA-PQPIPDGTMRST-GYTHDGPCEVWLDSTR  131
               +L +F+   K     GA   CG +      PQ + D    S    +H GPCEVW DSTR
Sbjct  43322  SSLASFIK--KKAPGAGA---CGISRLDPKNPQAVGDYVQWSALADSHVGPCEVWCDSTR  43158

Query  132    VLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              V   DNC   + T P K   +  S C  +  L +YWL      +E +WQVY  C+ L
Sbjct  43157  VFHHDNCAGAYRTAPAK-LPIKKSKCTNAKQLTFYWLAL----HEINWQVYINCVSL  43002

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 59/127 (46%), Gaps = 19/127 (15%)
 Frame = +2

Query  64     FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT----MRSTGYT-  118
              +  W +++ +K+L+  +      V  G    CG + A   PQP+PD        + G+T 
Sbjct  50921  YTAWIKTSEFKSLKDLI------VKKGNVGECGIS-ALGDPQPLPDQVEWAHSSNEGFTP  51079

Query  119    -HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHS  175
               H GPCEVW D       DNC + +      L Y  S C G+  L +YWL      ++ +
Sbjct  51080  SHQGPCEVWCDDKMAFHDDNCAKDYTSAPAKLPYDKSKCVGAKKLTFYWLAL----HDPN  51247

Query  176    WQVYKAC  182
              WQ+Y  C
Sbjct  51248  WQIYINC  51268

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 44/77 (57%), Gaps = 8/77 (10%)
 Frame = -2

Query  118    THDGPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
              +H GPCEVW D+ RV Q+DNC   + T P K   ++ + C  +  L +YWL      +E 
Sbjct  42114  SHVGPCEVWCDNQRVFQNDNCAGAYRTAPAK-LPINKAKCANAKQLTFYWLAL----HEI  41950

Query  175    SWQVYKACIPLSSSARR  191
              +WQVY  C+ L   A++
Sbjct  41949  NWQVYINCVSLKGGAKK  41899

>PHCA:scaffold_39 PHYCAscaffold_39
Length=591971

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 49/104 (47%), Gaps = 18/104 (17%)
 Frame = +3

Query  90      GADYYCGFTNAKAAPQPIPDGTMR------STGYTHDGPCEVWLDSTRVLQSDNCHETFP  143
               G D  CGFT     P+P+P             G+TH GPCE+++D   VL SD+C   +P
Sbjct  200073  GNDKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYP  200252

Query  144     GKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               G   +        +DYSSC G C    YWLG +       WQ Y
Sbjct  200253  GGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAY  200372

>PHSO:scaffold_8
Length=3549547

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 59/127 (46%), Gaps = 7/127 (6%)
 Frame = +2

Query  60       TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYT  118
                T+  F     S GY +L  F+   +  V    D  CG T  K +A   +P   +  TG+T
Sbjct  1238090  TLNFFKATFPSKGYDSLGEFIAKNQELVDSKTDADCGLTIYKDSARSELPASKLTHTGFT  1238269

Query  119      HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSW  176
                H GPCEVW D T+VL   +C   +P     L Y  S C G+  L  YWL      +   W
Sbjct  1238270  HTGPCEVWCDDTKVLFDYDCQTKYPAIPATLPYDESKCSGANRLTIYWLAL----HGDPW  1238437

Query  177      QVYKACI  183
                QVY  C+
Sbjct  1238438  QVYTDCV  1238458

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 60/132 (45%), Gaps = 14/132 (11%)
 Frame = +3

Query  72       GYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLDST  130
                G  +L AF+   +   +   D  CG T  K +A   +P   +  TG+TH GPCEVW D T
Sbjct  1240617  GGGSLGAFIAKNQKLYSSSVDPNCGLTTYKESARSKLPSSQIEYTGFTHPGPCEVWCDDT  1240796

Query  131      RVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
                +VL   +C   F G    + Y  S C  +  L  YW+      +   WQVY  C+     
Sbjct  1240797  KVLFDYDCQTKFAGSPAKMAYDESKCANANRLTIYWV----AMHGSPWQVYTDCV-----  1240949

Query  189      ARRLEGAANESA  200
                   LEG + E A
Sbjct  1240950  --WLEGGSGEGA  1240979

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query  60       TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKA-APQPIPDGTMRSTGYT  118
                TV  F     S+GY +L  F++  +   +D  D  CG+T   A A Q +P   +  TG+T
Sbjct  1236231  TVAFF*AQFNSSGYNSLGQFIETNQVLYSDDIDAQCGYTVYDASARQTMPSTNLTYTGFT  1236410

Query  119      HDGPCEVWLDSTRVLQSDNCHETFP  143
                H GPCE+W D T+VL   NC  + P
Sbjct  1236411  HPGPCEIWCDDTKVLFDYNCQASCP  1236485

>PYIR:scaffold_2511 pir_scaffold_2511 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2511:1:2703:1 
REF
Length=2703

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 55/126 (44%), Gaps = 7/126 (6%)
 Frame = -3

Query  64    FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGP  122
               G++    YK+L+     A   +  GA   CG+++     QP+PD         +H GP
Sbjct  1837  LAGFKAQTKYKSLKDLATSAAVKLEAGASKECGYSSVTGTAQPLPDTVQWDRFDSSHMGP  1658

Query  123   CEVWLDSTRVLQSDNC--HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
             CEVW D     + DNC  H T        D S C G  ML  +W+         +WQ+Y 
Sbjct  1657  CEVWCDDVLAFEDDNCSVHMTTTPAVLKYDKSKCVGKKMLTSFWIALHV----PTWQIYT  1490

Query  181   ACIPLS  186
              C P++
Sbjct  1489  NCAPIA  1472

>PHPA:scaffold_19 NW_008649005.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.19, whole genome shotgun 
sequence
Length=1020763

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 74/184 (40%), Gaps = 37/184 (20%)
 Frame = +2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQ----GFK-------TVEDFNGWRRSNGYK  74
              DAH  V  PA  +   +  TKY      +      G K           F     + GY 
Sbjct  49298  DAHGYVSKPAAQFVDPSSSTKYVKTITADVNSAFGGLKWDDSPEANAATFTSSFANAGYS  49477

Query  75     TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGPCEV  125
              +LR  +D     VTD     C  T    +P  +          D   +    +H GPCEV
Sbjct  49478  SLRDMLD---QQVTD-----CANTRTDVSPVDVSGLSVMNWQNDQEQKGFIDSHHGPCEV  49633

Query  126    WLDSTRVLQSDNCHETFPGKTY----NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
              W+D T V   D+C   + G  Y      D+S C G C LR+YWL       E +WQ+YK 
Sbjct  49634  WIDDTMVDHQDDCVAAY-GTGYPASVKADFSKCSGDCTLRFYWLALH----EPNWQIYKQ  49798

Query  182    CIPL  185
              C+P+
Sbjct  49799  CVPI  49810

>PLHA:NW_020188562.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1651, whole genome shotgun sequence
Length=1372582

 Score = 71.2 bits (173),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 58/116 (50%), Gaps = 8/116 (7%)
 Frame = +3

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVWLDSTR  131
               YKTL+ F   A   +  GA   CGF+     PQ +P+     +  Y+H GPCEVW D  R
Sbjct  929214  YKTLKEFA-WATQKLEKGASNECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDKR  929390

Query  132     VLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               V Q+ NC   +      L Y  +SC+G+ +L  YW+    +     WQ+Y  C P+
Sbjct  929391  VFQNWNCGVDYTETPAKLPYDKASCEGAAVLSCYWIAVHTVP----WQIYTNCAPI  929546

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 53/113 (47%), Gaps = 6/113 (5%)
 Frame = +2

Query  73      YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
               YKTL+     A   +  GA   CGF+     PQ +PD  +   G+ H GPCEV  D   V
Sbjct  921410  YKTLKELA-WATQKLEKGASKECGFSLVDGEPQELPD-KVEWDGFIHYGPCEVHCDDKLV  921583

Query  133     LQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                Q+ NC   F       D ++C G+ +L  YW+G         WQ+Y  C P+
Sbjct  921584  FQNWNCAIDFKDGKLPYDKAACAGASVLTSYWIGLHTTP----WQIYTNCAPI  921730

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 71/183 (39%), Gaps = 27/183 (15%)
 Frame = -2

Query  26      DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWR--------------RSN  71
               DAH  +  P PT+  +     +A    ++ Q +  V D   +                ++
Sbjct  906522  DAHSYMSDPMPTWNVNFPSPSFA--GLIDGQKYLPVPDGMSYATDPELITKAYWIAFEAS  906349

Query  72      GYKTLRAFMDGAKYTVT----DGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEVW  126
                Y +L+ F D      T      A   CG +      + +PD     + G +H GPCE+W
Sbjct  906348  KYTSLKDFADQTMELQTLPPFGKASPECGHSIVNGTARELPDKVKWLAFGLSHQGPCEIW  906169

Query  127     LDSTRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
                D        NC   +P     L  D   C G+ M++ YW+    L     WQ+Y  C+P
Sbjct  906168  CDKKLAFMDKNCALNYPQDPALLPYDIKICIGAKMMQAYWIALHGLP----WQLYLNCVP  906001

Query  185     LSS  187
               L S
Sbjct  906000  LKS  905992

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/165 (25%), Positives = 67/165 (41%), Gaps = 32/165 (19%)
 Frame = +1

Query  32      LLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGA  91
               L P  T++TD       PL          VE F    +S+ YK+ +  +   +  V+  A
Sbjct  904468  LFPGGTFSTD-------PLI--------NVESFKEKFKSSKYKSFKEMIMDNQVLVSKRA  904602

Query  92      DYYCGFTNAKAAPQPIPDGTM---------RSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142
                  CGFT  +       + T+         +  G  H+G CE W ++ RV Q  NC  T+
Sbjct  904603  TADCGFTTTEKVTYGSLNDTIYWGREFDITKGEGLVHEGVCESWCENVRVQQDTNCMVTY  904782

Query  143     PGKTYN----LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                  + +    +D + C  +  L +YW+      +   WQVY   +
Sbjct  904783  KAASGSSPIPIDKAKCASAKRLTFYWIAM----HGPIWQVYSKLV  904905

>PYIW:scaffold_270 piw_scaffold_270 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_270:1:22416:1 
REF
Length=22416

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 71/156 (46%), Gaps = 18/156 (12%)
 Frame = +1

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLES------QGFK-------TVEDFNGWRRSNG  72
              +AH  + +P  +Y      T Y+  A L S      QG K        V+ F    R+ G
Sbjct  16630  EAHGYISVPQASYANSYTKTSYS--ATLSSSINPAFQGRKWDGSPEANVQQFAVGFRAAG  16803

Query  73     YKTLRAFMDGAKYTVTDG-ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTR  131
              Y +L+  +DGA     +   D      +  AA Q   D        +H GPCEVW+D+ R
Sbjct  16804  YSSLKTLLDGAAPGCGNSRLDVPAVDVSGLAAMQFRNDEYHEGFVSSHHGPCEVWIDNKR  16983

Query  132    VLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWL  165
              +   D+C   FPG      +D+S+CKG C L +YWL
Sbjct  16984  MFHGDDCRAQFPGFPAAVPVDFSACKGKCTLTFYWL  17091

>PHKE:scaffold_22 scf_22126_22.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_22.1:1:203587:1 
REF
Length=203587

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 7/117 (6%)
 Frame = -3

Query  70     SNGYKTLRAFMDGAKYTVTDGADYYCGFTN-AKAAPQPIPDGTMRSTGYTHDGPCEVWLD  128
              ++GY++L  +++  +   +D  D  CG+T    +A Q +P   +  TG+TH GPCEVW D
Sbjct  39362  ASGYESLGQYIETNQVMYSDEIDEQCGYTTYDDSARQTMPSTNLTYTGFTHPGPCEVWCD  39183

Query  129    STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               T VL   NC  T+P     + Y  S C  +     YWLG     +   WQV+  C+
Sbjct  39182  DTVVLFDYNCQSTYPDIPAGIPYDESLCADANRFTIYWLGV----HGAPWQVFTDCV  39024

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 58/119 (49%), Gaps = 7/119 (6%)
 Frame = -1

Query  70     SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
              S GY +L AF+   +   +   D  CG T  K +A   +P   +  +G+TH GPCEVW D
Sbjct  37594  SKGYDSLGAFISKNQELYSSATDADCGLTVYKDSARSELPASKLTYSGFTHTGPCEVWCD  37415

Query  129    STRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               T+VL   +C   +P    T + D S C  +  L  YW+G         WQVY  C+ L
Sbjct  37414  DTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLH----GDPWQVYTDCVWL  37250

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 6/121 (5%)
 Frame = -3

Query  73     YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
              YKTL A +   +   +   D  CG T  K + +      +  TG+TH GPCEVW D+T+V
Sbjct  35351  YKTLSALIADKQELYSKSVDPECGLTAYKDSARSELPKELAFTGFTHPGPCEVWCDNTKV  35172

Query  133    LQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSAR  190
              L   +C + +P    T + D S C  +  L  YW+      +   WQVY  C+ L   + 
Sbjct  35171  LYKADCQKAYPDIPATMSYDSSLCANANRLTIYWIAV----HGDPWQVYADCVWLKGGSG  35004

Query  191    R  191
              R
Sbjct  35003  R  35001

>SAPA:scaffold_12 supercont2.12 dna:supercontig supercontig:ASM15154v2:supercont2.12:1:690970:1 
REF
Length=690970

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 80/188 (43%), Gaps = 48/188 (26%)
 Frame = -1

Query  28      HQVVLLPAPTYTTDNKDTKYA-------PLAFLESQGFKTVEDFNGWRRSNGYKTLRAFM  80
               H +V  PA  ++ +   T Y        P  F  S         + ++  + +KTLR  +
Sbjct  306757  HGIVTNPAAEFSPNVMRTNYVATIQANLPGKFDGSPQDNVAAFTSAFKAQSQFKTLRDML  306578

Query  81      DGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM------------------RSTGYTHD-  120
               +             CG +   A+ + IP DGTM                  R +G  H  
Sbjct  306577  EPQGPA--------CGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTVDRPSGRRHGL  306422

Query  121     -----GPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGS-CMLRWYWLGTRFLK  171
                    GPCEVWLD  RV Q+D+C   FP K      +DYSSC G+ CMLR+YWL      
Sbjct  306421  IRRA*GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYWLAL----  306254

Query  172     NEHSWQVY  179
               ++  WQVY
Sbjct  306253  HQPQWQVY  306230

>PYAP:scaffold_74 pag1_scaffold_74 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_74:1:72664:1 
REF
Length=72664

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 63/125 (50%), Gaps = 16/125 (13%)
 Frame = -2

Query  69    RSNGYKTLRAFMDGAKY----TVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPC  123
             + + YK+++  MD        T+TDG      G  + K A      G ++S    H GPC
Sbjct  3891  KQSSYKSIKEMMDPVVADCGNTLTDGEPVDVSGMKSVKWANDQERVGFVKS----HTGPC  3724

Query  124   EVWLDSTRVLQ-SDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
             EVW+D+  V Q + +C   F G    L  DYS CKG C L +YWL      +E +WQVYK
Sbjct  3723  EVWIDNKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLAL----HEPNWQVYK  3556

Query  181   ACIPL  185
              C P+
Sbjct  3555  QCAPI  3541

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 80/180 (44%), Gaps = 28/180 (16%)
 Frame = -3

Query  26    DAHQVVLLPAPTYTTDNKDTKY----------APLAFLESQGFKTV--EDFNGWRRSNGY  73
             DAH  ++ PA  +      T Y          AP A  +     T   + F    + + Y
Sbjct  1178  DAHGYLVQPAAKFKPGVMTTNYNGVIDSSKLAAPFAGKKFNDNPTANAKTFTDAFKQSKY  999

Query  74    KTLRAFMDGA----KYTVTDGADY-YCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLD  128
             K+++  MD        T+ DGA     G  + K A      G ++S    H GPCEVW+D
Sbjct  998   KSIKELMDPVVGDCGNTLMDGAPVDVSGMKSVKWANDQERVGFIKS----HTGPCEVWID  831

Query  129   STRVLQ-SDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             +  V Q + +C   F G    L  DYS CKG C L +YWL      +E +WQVYK C P+
Sbjct  830   NKMVFQETGDCVAKFTGYPAELPVDYSVCKGKCQLTFYWLAL----HEPNWQVYKQCAPI  663

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 7/71 (10%)
 Frame = -3

Query  118   THDGPCEVWLDSTRVLQSDNCHETFPGK---TYNLDYSSCKGSCMLRWYWLGTRFLKNEH  174
             +H GPCEVW+D  +V   D+C   F G+   +  +D+S CKG C L +YW+      ++ 
Sbjct  2375  SHHGPCEVWIDDNKVFHDDDCSAKFDGQFPASIPVDFSKCKGKCELTFYWIAL----HQA  2208

Query  175   SWQVYKACIPL  185
              WQ+YK C P+
Sbjct  2207  QWQLYKQCAPI  2175

>PYUU:scaffold_2033 scf1117875582033 dna:supercontig supercontig:pug:scf1117875582033:1:91152:1 
REF
Length=91152

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +3

Query  113    RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFL  170
              RST     GPCE+WLD  RV+Q D+C  TF  +   +N+D+SSCK +CMLR++WLG +  
Sbjct  27729  RSTY*PR*GPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--  27902

Query  171    KNEHSWQVY  179
               +   WQVY
Sbjct  27903  DSGTRWQVY  27929

>PHPA:scaffold_81 NW_008649067.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.81, whole genome shotgun 
sequence
Length=244838

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 73/171 (43%), Gaps = 29/171 (17%)
 Frame = +3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLA---FLESQGFKTVEDFNGWRRSNGYKTLRAFMDG  82
              DAH  +  P P +  D+ +  +  +    +    G   V  F    +  G       +D 
Sbjct  87246  DAHGYLKQPEPDWK-DSPNPGWITMVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVVLDM  87422

Query  83     AKYTVTDGADYYCGFTNAKAAPQPIP-DGTM-----RSTGYTHDGPCEVWLDSTRVLQSD  136
               K       D  CG T    +P+PIP DG +     R  G+TH GPCE++LD   VL  D
Sbjct  87423  VK-------DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGD  87581

Query  137    NCHETFPGKTYN--------LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
              +C E +PG +          +D+SSC G C L  YWL  +       WQ Y
Sbjct  87582  DCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQ----NAQWQTY  87722

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (55%), Gaps = 7/62 (11%)
 Frame = -3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSSCKG-SCMLRWYWLGTRFLKNEHSWQ  177
               GPCE W+D T+V   D+C   FP     +  DYS+CKG  C+  +YWL      +   WQ
Sbjct  134379  GPCEGWIDDTKVFHYDDCVAEFPSYPAKIPTDYSACKGDKCLFVFYWLAL----HSPKWQ  134212

Query  178     VY  179
               +Y
Sbjct  134211  IY  134206

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 35/69 (51%), Gaps = 6/69 (9%)
 Frame = -1

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
               +H+G CEV +  T+V   DNC   F  K+Y         S     YWL      +E +WQ
Sbjct  136220  SHEGHCEV*IGETQVSHYDNCAARF--KSYPTKIPVVHSSRKSDCYWLAL----HEPNWQ  136059

Query  178     VYKACIPLS  186
               +YK C+P++
Sbjct  136058  IYKQCVPIT  136032

>PYVX:scaffold_1070 pve_scaffold_1070 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1070:1:7524:1 
REF
Length=7524

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 48/95 (51%), Gaps = 7/95 (7%)
 Frame = -3

Query  95    CGFTNAKAAPQPIPDGTMRSTGYT-HDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DY  151
             CGF+ A    + +P+    +   T HDGPCEVW D T   Q DNC   +P     L  D 
Sbjct  1633  CGFSLANGTARALPEYVEWNQFTTGHDGPCEVWCDDTLAFQDDNCAVNYPDDPAKLPYDI  1454

Query  152   SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             S C G+ ML  YW+    L     WQVY  C+PL+
Sbjct  1453  SKCTGASMLTSYWIALHGLP----WQVYINCVPLN  1361

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 58/125 (46%), Gaps = 13/125 (10%)
 Frame = -1

Query  70    SNGYKTLRAFMDGAKYTVTDG----ADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCE  124
             ++ Y +L  F D  +   T      A   CGF+ A    + +P +        +H+GPCE
Sbjct  4539  ASNYTSLLQFADATQEVQTMATFGTATKECGFSLANGTARALPAEVEWNQLTSSHEGPCE  4360

Query  125   VWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
             VW D TRV +  NC   + T P K    D S C+G+ ML   WL    L     WQVY  
Sbjct  4359  VWCDDTRVFEDWNCAVDYTTSPAK-LPYDASKCEGAKMLTSIWLALHALP----WQVYTN  4195

Query  182   CIPLS  186
             C PLS
Sbjct  4194  CAPLS  4180

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 74/182 (41%), Gaps = 29/182 (16%)
 Frame = -2

Query  27    AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVED------------FNGWRRSN--G  72
             AH  ++LP PT+        Y+ L  +E   +  V D               W   N   
Sbjct  3410  AHSNMILPLPTWPVSWSTNSYSGL--IEGDTYLPVPDGMSYSTDPYDNTLAYWTAFNESS  3237

Query  73    YKTLRAFMDGAKYTVTDGADYY------CGFTNAKAAPQPIPDGTM-RSTGYTHDGPCEV  125
             Y +L+  +   +   TD    +      CG++ A    + +P+         +H GPCEV
Sbjct  3236  YTSLKDLVLATQELQTDSTGTFGTATAECGYSLADGTARDLPEYVEWNQLTSSHQGPCEV  3057

Query  126   WLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             W D T V ++ NC  T+      L Y  S C+G+ ML  YW+    L     WQVY  C 
Sbjct  3056  WCDDTLVFENWNCAYTYTADPAQLPYDASKCEGASMLTSYWIALHGLP----WQVYTNCA  2889

Query  184   PL  185
             PL
Sbjct  2888  PL  2883

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 11/97 (11%)
 Frame = -3

Query  95    CGFTNAKAAPQPIPDGTM---RSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK--TYNL  149
             CG++      + +PD       +TG  HDGPCE+W D T V    NC   +P     +  
Sbjct  6298  CGYSWTNGTARDLPDTVQWDKLTTG--HDGPCEIWCDETLVFSDQNCAVNYPDDPAVFPY  6125

Query  150   DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             D S C+G+ ML   WL          WQV+  C PL+
Sbjct  6124  DKSKCEGASMLTAIWLALH----SPPWQVFTNCAPLT  6026

>PLHA:NW_020188258.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1343, whole genome shotgun sequence
Length=1546205

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 59/134 (44%), Gaps = 12/134 (9%)
 Frame = -2

Query  61       VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS----TG  116
                V  F    +++ YK+++  ++        GA   CG  N  A PQP+P+    S     G
Sbjct  1356604  VASFTTAFKASNYKSIKELIEDKAVISVTGASLTCGNANPDAPPQPLPEQVEWSHSAEEG  1356425

Query  117      YT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKN  172
                +T  H GPCEVW D+ +    +NC   F      L Y  + C G+  L  YW+       
Sbjct  1356424  FTPSHQGPCEVWCDNKQAFHDENCAAHFTTAPAQLSYEKTMCSGASKLTLYWIAMHGPI-  1356248

Query  173      EHSWQVYKACIPLS  186
                   WQVY  C  +S
Sbjct  1356247  ---WQVYINCANIS  1356215

>PYAR:scaffold_480 par_scaffold_480 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_480:1:17633:1 
REF
Length=17633

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 69/150 (46%), Gaps = 28/150 (19%)
 Frame = -2

Query  64     FNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY------  117
              F    + + YK L+  +D     V  G    CG T+       I   +MRS  +      
Sbjct  17596  FTAAFKQSRYKNLKEMLD----PVVSG----CGRTSLSGPA--IDVSSMRSVKWQNDQEG  17447

Query  118    -----THDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFL  170
                   +H GPCEVW+ +T VL  D C   FPG      + +S+C+G+C L +YWL     
Sbjct  17446  QGFVKSHTGPCEVWIGNTMVLHEDECVSRFPGFPAEMPVSFSACQGTCTLTFYWLAL---  17276

Query  171    KNEHSWQVYKACIPLSSSARRLEGAANESA  200
               +E  WQVYK C  L  + R L G A  S+
Sbjct  17275  -HEPQWQVYKQC-ALIKNGRMLRG*APSSS  17192

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 7/79 (9%)
 Frame = +1

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHS  175
            +H GPCE+W+D+T +   D C   FP       + +S+CKG+C L +YWL      +E  
Sbjct  124  SHTGPCEIWIDNTMIFHEDECVSRFPAYPAEIPVSFSACKGTCTLTFYWLAL----HEPQ  291

Query  176  WQVYKACIPLSSSARRLEG  194
            WQVYK C  L  + R L G
Sbjct  292  WQVYKQCA-LIKNGRMLRG  345

>PYAR:scaffold_1918 par_scaffold_1918 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1918:1:6575:1 
REF
Length=6575

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 9/74 (12%)
 Frame = +1

Query  118  THDGPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKG--SCMLRWYWLGTRFLKN  172
            +H GPCEVW+DSTRV +  +C E F G     + +DYS C    +C L +YWL      +
Sbjct  730  SHHGPCEVWIDSTRVFRGSDCVEQFRGAMPARFPVDYSVCPSGQTCTLMFYWLPL----H  897

Query  173  EHSWQVYKACIPLS  186
            E +WQVYK C+P++
Sbjct  898  EAAWQVYKQCVPIT  939

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 35/62 (56%), Gaps = 9/62 (15%)
 Frame = +3

Query  130   TRVLQSDNCHETFPGK---TYNLDYSSCKG--SCMLRWYWLGTRFLKNEHSWQVYKACIP  184
             TRV   D+C   F G    +  +DYS C+   +C L +YWL      +E +WQVYK C+P
Sbjct  1938  TRVFHGDDCAAQFRGAKPASIPVDYSVCQSGQTCTLTFYWLAL----HEPNWQVYKQCVP  2105

Query  185   LS  186
             ++
Sbjct  2106  IT  2111

 Score = 33.5 bits (75),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 59/151 (39%), Gaps = 36/151 (24%)
 Frame = +2

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPL-------AFLESQGFKTVED----FNGWRRSNGYK  74
            +AH  + LPA  Y   +  T Y  L       AF   +   + E+    F    R  G  
Sbjct  92   EAHGYISLPAAAYRDTSTKTSYNALLTASVNAAFEGKKWNDSPENNEQMFRTSFRQAGLP  271

Query  75   TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPD-GTMR------STGY--THDGPCEV  125
            +LRA +D A           CG +    AP  +   G M+      S G+  +H GPCEV
Sbjct  272  SLRALLDPAAPG--------CGNSRTDVAPIDVSSLGVMQFQNDEYSEGFIASHHGPCEV  427

Query  126  WLDSTRV--------LQSDNCHETFPGKTYN  148
            W+    +        L + +    F GKT+N
Sbjct  428  WIXXXXLWKKTSYNGLLNASSDAAFVGKTWN  520

>PYVX:scaffold_121 pve_scaffold_121 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_121:1:49194:1 
REF
Length=49194

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 70/154 (45%), Gaps = 37/154 (24%)
 Frame = -1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              ++V+ +   +  NG   +R+ +D    T   GAD  CG+TN     Q IP D T   S G
Sbjct  19995  ESVDTYVSLKEENGLSNIRSLLDD---TSIYGAD--CGYTNPDGTAQDIPTDSTATFSRG  19831

Query  117    YTH----------------------DGPCEVWLDSTRVLQSDNCHETFPG------KTYN  148
                H                       GPCE+WLD T VL  D+C+  + G        + 
Sbjct  19830  MVHVVSHSRCS*WSGWC*IGLAXXXXGPCEIWLDDTMVLSEDDCYSLYGGDDQDVKSVFP  19651

Query  149    LDYSSC-KGSCM-LRWYWLGTRFLKNEHSWQVYK  180
              +DYSSC  G C  +R+YWL  + + +E  WQVY 
Sbjct  19650  VDYSSCDSGGCSEMRFYWLAFQGVDDETVWQVYS  19549

 Score = 61.2 bits (147),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 8/68 (12%)
 Frame = -3

Query  120    DGPCEVWLDSTRVLQSDNCHETFPG------KTYNLDYSSCK-GSCM-LRWYWLGTRFLK  171
               GPCE+WLD T VL  D+C+ T+ G        +N+DYSSC  G C  +R+YWL  + + 
Sbjct  17638  QGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFNIDYSSCNSGGCKEMRFYWLAFQGVD  17459

Query  172    NEHSWQVY  179
                  WQVY
Sbjct  17458  GATKWQVY  17435

 Score = 30.8 bits (68),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 29/63 (46%), Gaps = 7/63 (11%)
 Frame = -1

Query  59     KTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STG  116
              ++V+ +       G   +R+ +D    T   GAD  CGFTN     QPIP DG    S G
Sbjct  17874  QSVDTYKSLASEKGVSQIRSLLDD---TSIYGAD--CGFTNPSGTAQPIPTDGKATFSRG  17710

Query  117    YTH  119
                H
Sbjct  17709  IVH  17701

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 6/66 (9%)
 Frame = -1

Query  121    GPCEVWLDSTRVLQSDNCHETFPGK-----TYNLDYSSCKGS-CMLRWYWLGTRFLKNEH  174
              GPCE+WLD T V+ +D+C   + G+      + +DYSSC  S CMLR+YWL  + +  E 
Sbjct  28977  GPCEIWLDDTMVMYNDDCQAAYGGEQDIKSVFPVDYSSCSSSGCMLRFYWLALQGIDGEV  28798

Query  175    SWQVYK  180
               WQVY 
Sbjct  28797  VWQVYS  28780

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 8/68 (12%)
 Frame = -2

Query  121    GPCEVWLDSTRVLQSDNCHETFPG------KTYNLDYSSC--KGSCMLRWYWLGTRFLKN  172
              GPCE+WLD T VL  D+C+ T+ G        + +DYSSC   G  M+R+YWL  + + +
Sbjct  22115  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDD  21936

Query  173    EHSWQVYK  180
              E  WQVY 
Sbjct  21935  ETVWQVYS  21912

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 23/100 (23%)
 Frame = -1

Query  103    APQPIPDGTMRSTGYTH----------------DGPCEVWLDSTRVLQSDNCHETFPG--  144
               P  +P     ST Y H                 GPCE+WLD T  + +D+C+  + G  
Sbjct  24558  VPARLPSRAASSTWYVHR*VEQNRGLT*SNNVLQGPCEIWLDDTLAMYNDDCYSAYGGDE  24379

Query  145    ---KTYNLDYSSCK--GSCMLRWYWLGTRFLKNEHSWQVY  179
                   + +DYS+C+  G   +R+YWL  + + +E  WQVY
Sbjct  24378  DVKSVFPVDYSTCESSGCSEMRFYWLAFQGVDDETVWQVY  24259

 Score = 28.5 bits (62),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 21/41 (51%), Gaps = 5/41 (12%)
 Frame = -3

Query  68     RRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP  108
              +   G   +R+F+D    T   GAD  CG+T+     QPIP
Sbjct  24667  KEEKGVTNIRSFLDD---TSIYGAD--CGYTDPDGTAQPIP  24560

 Score = 59.7 bits (143),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 8/79 (10%)
 Frame = -1

Query  120    DGPCEVWLDSTRVLQSDNCHETFPGK------TYNLDYSSCK--GSCMLRWYWLGTRFLK  171
               GPCE+WLD T VL  D+C+ T+ G+       + +DYS C+  G   +R+YWL  + L 
Sbjct  27210  QGPCEIWLDDTMVLHDDDCYTTYGGEDQDIKSVFPVDYSVCETTGCKEMRFYWLAFQGLS  27031

Query  172    NEHSWQVYKACIPLSSSAR  190
               +  WQVY    P  SS R
Sbjct  27030  GKTVWQVYSKLRPAPSSVR  26974

 Score = 24.3 bits (51),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 4/32 (13%)
 Frame = -2

Query  90     GADYYCGFTNAKAAPQPIP-DGTMR-STGYTH  119
              GAD  CGFT+     QPIP DG    S G  H
Sbjct  27389  GAD--CGFTDPDGEAQPIPTDGKATFSRGIVH  27300

>PYAP:scaffold_793 pag1_scaffold_793 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_793:1:13419:1 
REF
Length=13419

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 71/163 (44%), Gaps = 14/163 (9%)
 Frame = +3

Query  26    DAHQVVLLPAPTY------TTDNKDTKYAPLAFLE--SQGFKTVEDFNGWRRSNGYKTLR  77
             +AH  ++LP PTY       T        P A+ +   Q F       G    + +    
Sbjct  2748  EAHGELMLPRPTYPKWGGGVTSTISPSVLPFAWRQDFPQAFDEAITKTGLSLKD-FIMKY  2924

Query  78    AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQ-SD  136
               M GA  T   G+   CG+++ K  PQP+P+     TG+ H GPCE + D+  V + + 
Sbjct  2925  QNMSGASDT---GSTPECGYSDPKGTPQPLPEKIQFHTGFMHWGPCEAYCDNVLVTKHAA  3095

Query  137   NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             +C   +PG     D + C G    ++YWLG     N   WQ Y
Sbjct  3096  DCKVAYPGGAVPYDKAKCAGKKQFKFYWLGMD-SGNSAPWQAY  3221

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 74/168 (44%), Gaps = 19/168 (11%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTT--DNKDTKYAP--LAFLESQGFKTVEDFNGWRRSNGYKTLRAFMD  81
             +AH  ++LP PTY           AP  + F   Q +   + F+   +  G  +L+ F+ 
Sbjct  910   EAHGELMLPRPTYPKWGGGVAATIAPSVMPFPWRQDYP--QAFDEAFKKTGL-SLKDFI-  1077

Query  82    GAKYTVTDGAD-----YYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQ-S  135
               KY  T GA        CG+++ K  PQP+P+     TG+ H GPCE + D   V + +
Sbjct  1078  -LKYQNTSGASDTGSSAQCGYSDPKGTPQPLPEKIQFHTGFIHWGPCEAYCDDVLVTKHT  1254

Query  136   DNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              +C   +P      D + C G     ++WL      +   WQVY   +
Sbjct  1255  ADCRAAYPAGAVPYDKAKCAGKKQFTFWWL----TMDGSPWQVYSTSL  1386

>PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_123:1:61624:1 
REF
Length=61624

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 60/114 (53%), Gaps = 7/114 (6%)
 Frame = -2

Query  73     YKTLRAFMDGAKYTVTD-GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTR  131
              YK+L+  +   +  +T  G+D  CG T    A +     T++ TG++H GPCEVW D T+
Sbjct  53844  YKSLKDLILAKQNVLTQYGSDAECGMTTKDEAKRAELPSTIKYTGFSHPGPCEVWCDKTK  53665

Query  132    VLQSDNCHETFPGKTYN--LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
              +  + +C +T+  +     +D S C G+  L  YW+G     +   WQVY  C+
Sbjct  53664  LAYAVDCQKTYGSQDAKIPIDASKCAGADRLTLYWIGV----HGDPWQVYTNCV  53515

>PYIR:scaffold_152 pir_scaffold_152 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_152:1:48504:1 
REF
Length=48504

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 8/119 (7%)
 Frame = +2

Query  70     SNGYKTLRAFMDGAKYTVTDGADYYCGFTN---AKAAPQPIPDGTMRSTGYTHDGPCEVW  126
              ++GY +LR  +   +    +  D  CG T    AK    P   G +  +G+TH GPCE+W
Sbjct  47810  TSGYTSLRDLILANQDMYDESTDKECGLTTLDEAKRTTMPA-SGNITFSGFTHPGPCELW  47986

Query  127    LDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               D  ++  ++NC  T+P      D + C G+   R +W+G     +   WQVY  C+ L
Sbjct  47987  CDDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGV----HGSPWQVYTNCVYL  48151

>PHPA:scaffold_9 NW_008648995.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.9, whole genome shotgun 
sequence
Length=1651025

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 7/127 (6%)
 Frame = +1

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + G  +L A +   +   +   D  CG T  K +A   +P   +  TG+TH GPCEVW D
Sbjct  538333  TKGGGSLGALIAKNQKLYSSDVDPDCGLTTFKESARSKLPASQLEYTGFTHPGPCEVWCD  538512

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                T+VL   +C   FPG    + Y  S C  +  L  YWL      +   WQVY  C+ L 
Sbjct  538513  DTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAV----HGEQWQVYSDCVWLE  538680

Query  187     SSARRLE  193
                 + + E
Sbjct  538681  GGSGKGE  538701

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 64/145 (44%), Gaps = 14/145 (10%)
 Frame = +2

Query  60      TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYT  118
               T+  F     + GY +L AF+   +   +   D  CG T  K +A   +P   +  TG+T
Sbjct  523973  TLNFFKATFPTKGYDSLGAFIAKNQELYSSKTDPDCGLTVYKDSARSELPASQLEYTGFT  524152

Query  119     HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSW  176
               H GPCEVW D T+VL   +C   +P     + Y  S C  +  L  YWL          W
Sbjct  524153  HTGPCEVWCDDTKVLFDYDCQTKYPDIPAKIPYDESKCANANRLTIYWLALH----GDPW  524320

Query  177     QVYKACIPLSSSARRLEGAANESAA  201
               QVY  C+        LEG +   AA
Sbjct  524321  QVYTDCV-------WLEGGSGSGAA  524374

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 7/127 (6%)
 Frame = +2

Query  70      SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
               + GY +L  F+   +   +   D  CG+T  K +A   +P+  +  TG+TH GPCE+W D
Sbjct  509252  TKGYDSLGQFIAKNQELYSSDIDPDCGWTIYKDSARSELPEAQLEYTGFTHPGPCEIWCD  509431

Query  129     STRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                T++L   +C   +P     + Y  S C  +  L  YW+G   +     WQ+Y  C+ L 
Sbjct  509432  DTKLLFDYDCWTKYPAIPAKIPYDKSKCADANRLTIYWIGIHGVP----WQIYTDCVWLK  509599

Query  187     SSARRLE  193
                 + R E
Sbjct  509600  GGSGRGE  509620

 Score = 37.4 bits (85),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +3

Query  107     IPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETF  142
               IP   +  TG+TH GPCEV  D T+VL   N   T+
Sbjct  522294  IPSTNLMHTGFTHPGPCEVCCDDTKVLIEYN*QATY  522401

>PYIR:scaffold_277 pir_scaffold_277 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_277:1:34862:1 
REF
Length=34862

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 75/184 (41%), Gaps = 27/184 (15%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKYA---PLAFLESQGFKTVEDFNGWR-------RSNGYKT  75
             DAH V+  P P +        Y+   P++ + +         N W        + + YK+
Sbjct  682   DAHGVLSKPGPAFAGTAYAGGYSAAIPMSAMPAVAPDVYGPSNSWADVFGNAFKKSKYKS  861

Query  76    LRAFM-------DGAKYTVTDGADYYCGFTNA-KAAPQPIPDGTM-RSTGYTHDGPCEVW  126
             LR F         G K      A+  CGFT   K   QP+PD       G  H GPCE W
Sbjct  862   LREFFMKNQDMSQGVKSGNPSTAE--CGFTAPDKQTAQPLPDNIEWYGGGQNHPGPCEAW  1035

Query  127   LDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D+  VL  + NC   FP      D + C G   L +YW+ T      + WQVY  C+ +
Sbjct  1036  CDNEIVLPFTANCQAAFPKGIMAYDKAKCVGKNRLSFYWMATL-----NQWQVYIDCVKI  1200

Query  186   SSSA  189
              + A
Sbjct  1201  GNGA  1212

>PYAR:scaffold_593 par_scaffold_593 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_593:1:15936:1 
REF
Length=15936

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = -2

Query  137    NCHETFPGK--TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              NC++ FPG+  +Y +D+S CKG C + WYWL  R +  + SWQ YK CIP+S
Sbjct  15929  NCNKDFPGQPVSYKVDFSVCKGDCTIHWYWLAKRLIGKKWSWQAYKECIPIS  15774

>PHIF:NW_003303743.1 Phytophthora infestans T30-4 supercont1.16 
genomic scaffold, whole genome shotgun sequence
Length=3114892

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 7/127 (6%)
 Frame = -1

Query  70       SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYTHDGPCEVWLD  128
                + G  +L A +   +   +   D  CG T  K +A   +P   +  TG+TH GPCEVW D
Sbjct  1481332  TKGGGSLGALIAKNQKLYSSEVDPDCGLTTFKDSARSKLPASQLEYTGFTHPGPCEVWCD  1481153

Query  129      STRVLQSDNCHETFPGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                 T+VL   +C   FPG    +  D S C  +  L  YWL      +   WQVY  C+ L 
Sbjct  1481152  DTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAV----HGEQWQVYSDCVWLE  1480985

Query  187      SSARRLE  193
                  + + E
Sbjct  1480984  GGSGKGE  1480964

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 58/127 (46%), Gaps = 7/127 (6%)
 Frame = -3

Query  60       TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYT  118
                T+  F     + GYK+L AF+   +   +   D  CG T  K +A   +P   +  TG+T
Sbjct  1519631  TLNFFKATFPTKGYKSLGAFIAKNQELYSSKTDPDCGLTVYKDSARSKLPASQLEHTGFT  1519452

Query  119      HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSW  176
                H GPCEVW D T+VL   +C   +      + Y  + C  +  L  YWL      +   W
Sbjct  1519451  HTGPCEVWCDDTKVLSDYDCQTKYSAIPAKIPYDEAKCAKANRLTIYWLAL----HGDPW  1519284

Query  177      QVYKACI  183
                Q Y  C+
Sbjct  1519283  QEYTDCV  1519263

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (46%), Gaps = 6/124 (5%)
 Frame = -1

Query  70       SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
                + GY +L  F+   +   +   D  CG+T  K + +      +  TG+TH GPCE+W D 
Sbjct  1541398  TKGYDSLGQFIAKNQELYSSDIDPDCGWTVYKDSARSALPTQLEYTGFTHPGPCEIWCDD  1541219

Query  130      TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
                T++L   +C   +P     + Y  S C  +  L  +W+G         WQ+Y  C+ L  
Sbjct  1541218  TKLLFDYDCWTKYPAIPAKIPYDKSKCANANRLTIFWIGIHGTP----WQIYTDCVWLKG  1541051

Query  188      SARR  191
                 + R
Sbjct  1541050  GSGR  1541039

>PHIF:NW_003303637.1 Phytophthora infestans T30-4 supercont1.122 
genomic scaffold, whole genome shotgun sequence
Length=232370

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 24/126 (19%)
 Frame = -2

Query  72      GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGP  122
               GY +LR  +D     V D     C  T    +P  +          D   +    +H GP
Sbjct  183181  GYSSLRDMLD---QQVAD-----CANTRTDGSPVDVSGLSLINWQNDEEQKGFIDSHHGP  183026

Query  123     CEVWLDSTRVLQSDNCHETF-PGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               CEVW+D T V   ++C  T+  G   N+  D+S C G C LR+YWL       E +WQ+Y
Sbjct  183025  CEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH----EPNWQIY  182858

Query  180     KACIPL  185
               K C+P+
Sbjct  182857  KQCVPI  182840

>PHIF:NW_003303594.1 Phytophthora infestans T30-4 supercont1.165 
genomic scaffold, whole genome shotgun sequence
Length=182585

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (47%), Gaps = 24/126 (19%)
 Frame = +3

Query  72     GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTHDGP  122
              GY +LR  +D     V D     C  T    +P  +          D   +    +H GP
Sbjct  79011  GYSSLRDMLD---QQVAD-----CANTRTDGSPVDVSGLSLMNWQNDEEQKGFIDSHHGP  79166

Query  123    CEVWLDSTRVLQSDNCHETF-PGKTYNL--DYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
              CEVW+D T V   ++C  T+  G   N+  D+S C G C LR+YWL       E +WQ+Y
Sbjct  79167  CEVWIDDTMVDHQEDCVATYGTGYPANIKADFSKCSGDCTLRFYWLALH----EPNWQIY  79334

Query  180    KACIPL  185
              K C+P+
Sbjct  79335  KQCVPI  79352

>PYIR:scaffold_1361 pir_scaffold_1361 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1361:1:7810:1 
REF
Length=7810

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 52/111 (47%), Gaps = 4/111 (4%)
 Frame = -1

Query  73    YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
             YK+L+  +   +    DG D  CG+T    A +      ++ +G+ H GPCE W D  ++
Sbjct  4537  YKSLKELILAKQVMEPDGGDKECGYTLKDEAKREALPPVIKHSGFFHPGPCEAWCDGNKI  4358

Query  133   LQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
                 +C + +   +  +D S C G+  L  YWL    +     WQVY  C+
Sbjct  4357  AYDVDCSKKYASGSIPIDASKCSGADKLSLYWLAVHGV----PWQVYSDCV  4217

>APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.49:1:457786:1 
REF
Length=457786

 Score = 63.5 bits (153),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 7/62 (11%)
 Frame = +2

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
               GPCE+WLD+TRV Q+D+C   FP K      +D++SC GSC +R+YW+      ++  WQ
Sbjct  302651  GPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIAL----HQDLWQ  302818

Query  178     VY  179
               VY
Sbjct  302819  VY  302824

 Score = 27.7 bits (60),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 12/58 (21%)
 Frame = +1

Query  59      KTVEDFNGWRR---SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTM  112
               K V  FN   R   + G+KTLRA +D        G D  CG++      +PIP DG +
Sbjct  302401  KNVAAFNKAFRDQQATGFKTLRAMLD------PQGPD--CGYSKLDVPAKPIPSDGNV  302550

>PYAR:scaffold_4639 par_scaffold_4639 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4639:1:2087:1 
REF
Length=2087

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 46/83 (55%), Gaps = 8/83 (10%)
 Frame = +1

Query  104   PQPIPDGTMRSTGY--THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCM  159
             PQP+PD      G+  +H+GPCEVW D TRV   +NC + + GK   L Y  S C G+  
Sbjct  1750  PQPLPDAVEYGGGFDSSHEGPCEVWCDDTRVFYEENCSKKYTGKPAKLPYDKSKCAGAKR  1929

Query  160   LRWYWLGTRFLKNEHSWQVYKAC  182
             L+ +W    F  +  +WQ Y AC
Sbjct  1930  LQSFW----FALHVPAWQAYIAC  1986

>PYVX:scaffold_698 pve_scaffold_698 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_698:1:15486:1 
REF
Length=15486

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 40/70 (57%), Gaps = 6/70 (9%)
 Frame = +1

Query  121    GPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              GPCE W+  TRV  SD+C   + G      +DYSSC G C   +YWL       E +WQV
Sbjct  13126  GPCEAWIGKTRVFHSDDCAAAYTGYPAEIPIDYSSCSGDCDFTFYWLALH----EPNWQV  13293

Query  179    YKACIPLSSS  188
              YK C P+S+S
Sbjct  13294  YKQCAPISNS  13323

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 10/68 (15%)
 Frame = +1

Query  121    GPCEVWLDSTRVLQSDNC---HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
              GPCE+W+D TRV   D+C     +FP K    DYSSC G C++ +YWL       E +WQ
Sbjct  15193  GPCELWIDDTRVWHYDDCAGDFTSFPAKV-PTDYSSCNGDCLVVFYWLALH----EPNWQ  15357

Query  178    VYK--ACI  183
              +Y   AC+
Sbjct  15358  IYSTFACL  15381

>PYVX:scaffold_305 pve_scaffold_305 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_305:1:30708:1 
REF
Length=30708

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 59/127 (46%), Gaps = 7/127 (6%)
 Frame = -1

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAK-AAPQPIPDGTMRSTGYT  118
              TV  F     S+GY +L  F+   +   +   D  CG T  K +A   +P   +  +G+T
Sbjct  15771  TVAFFEAEFNSSGYDSLGQFIITNQVLYSSSVDAECGMTVYKDSARSALPATNLTYSGFT  15592

Query  119    HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSW  176
              H GPCEVW D T++L   NC  T+      + Y  S C G+  L  YWL      +   W
Sbjct  15591  HPGPCEVWCDDTKLLFDYNCQATYSDIPAGVPYDESKCTGANRLTVYWLAL----HAAPW  15424

Query  177    QVYKACI  183
              Q Y  C+
Sbjct  15423  QAYIDCV  15403

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 56/125 (45%), Gaps = 5/125 (4%)
 Frame = -1

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFT-NAKAAPQPIPDGTMRSTGYT  118
              TV  F     S+GY +L  F+   +   +D AD  CG T    +A   +P G +  +G+T
Sbjct  13761  TVAFFEDQWPSSGYDSLGQFIIANQELASDTADEQCGLTVYDDSARSTMPSGNLTYSGFT  13582

Query  119    HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              H GPCE W D  ++    +C  +FP  +   D S C  +     YWL          WQ 
Sbjct  13581  HQGPCEAWCDDNKLFFEYDCSVSFPSGSMAYDSSLCTDANRFTIYWLALH----GDPWQA  13414

Query  179    YKACI  183
              Y  C+
Sbjct  13413  YIDCV  13399

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 54/114 (47%), Gaps = 5/114 (4%)
 Frame = -3

Query  71     NGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMRSTGYTHDGPCEVWLDS  129
              +GY +L   +   +   +D  D  CG T    A +  +P      +G+TH GPCE W D 
Sbjct  10564  SGYASLWDLIKAKQVLYSDDIDAECGLTIYDDAKRSALPASKFTYSGFTHAGPCEFWCDD  10385

Query  130    TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               +V   ++C  T+   T   + + C+G+  L  YW+G     +   WQVY  C+
Sbjct  10384  NKVAFDNDCQSTYADGTVPFEAAQCEGANRLAVYWIGV----HGDPWQVYSDCV  10235

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 56/123 (46%), Gaps = 7/123 (6%)
 Frame = -1

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQ-PIPDGTMRSTGYT  118
              TV+ F      +GY+TL+ F+   +  V    D  CG T    A +  +PD     +G+T
Sbjct  12183  TVKFFKAEFPESGYETLQDFILANQELVDSTIDKSCGMTIYDDAKRSALPDSAFSYSGFT  12004

Query  119    HDGPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSW  176
              H GPCE W D  +V    +C  T+P    +   D + C  +  L  YW+G         W
Sbjct  12003  HAGPCEFWCDDNKVAFDYDCQATYPDIPASVPFDSAQCANANKLTVYWIGLH----GDPW  11836

Query  177    QVY  179
              QVY
Sbjct  11835  QVY  11827

>PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:pug:scf1117875582007:1:931704:1 
REF
Length=931704

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 62/133 (47%), Gaps = 9/133 (7%)
 Frame = -3

Query  57      GFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFT---NAKAAPQPIPDGTMR  113
               G  T++ F      +GY TL+  +   +    D  D  CG+T    AK A  P  + T  
Sbjct  549925  GEGTIKYFKANYPDSGYTTLKDLILANQDMYEDTIDKQCGYTILDEAKRADMPATEITF-  549749

Query  114     STGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
                +G+TH GPCE+W D  ++    +C  T+      +D S C G+   R +WL      + 
Sbjct  549748  -SGFTHPGPCELWCDDNKLAFDYDCQTTYASGKVPVDASKCSGANRFRIFWLAL----HS  549584

Query  174     HSWQVYKACIPLS  186
                 WQVY  C+ L+
Sbjct  549583  APWQVYTNCVYLT  549545

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 4/92 (4%)
 Frame = -3

Query  92      DYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY  151
               D  CG T    A +      ++ +G++H GPCE+W D+ ++  +++C  T+P     +D 
Sbjct  551107  DPQCGLTIKDEAKRATMPSEVKFSGFSHPGPCELWCDNNKLAFANDCAATYPTGVVPVDA  550928

Query  152     SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
               S C G+   R +W+G     +   WQVY  C+
Sbjct  550927  SKCAGADRFRIFWIGV----HSAPWQVYTDCV  550844

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 50/114 (44%), Gaps = 9/114 (8%)
 Frame = -2

Query  71      NGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAA-----PQPIPDGTMRSTGYTHDGPCEV  125
               +G  +L+  +   +   T G D  CG+T    A     P  +  G     G+TH GPCE+
Sbjct  552836  SGVASLKDLILENQVMWTSGLDEACGYTKLDEAKRSELPTEMKFGNGDVGGFTHPGPCEL  552657

Query  126     WLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
               W D T++   ++C   +P     +D S C  +     YWL      +   WQVY
Sbjct  552656  WCDDTKLSYDNDCAAKYPSGLVPIDTSKCANANQFTVYWLAV----HASMWQVY  552507

>SADI:scaffold_24 supercont1.24 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.24:1:724546:1 
REF
Length=724546

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 49/87 (56%), Gaps = 12/87 (14%)
 Frame = +3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
               GPCEVWLD  RV Q+D+C   FP K      +DYSSC G  CMLR+YWL      ++  W
Sbjct  440046  GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQW  440213

Query  177     QVYKACIPLSSSARRLEGAANESAAIE  203
               QVY      S  + R  G  N+ +AIE
Sbjct  440214  QVYST---FSLPSLR-TGQPNDLSAIE  440282

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 39/63 (62%), Gaps = 8/63 (13%)
 Frame = -3

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKG-SCMLRWYWLGTRFLKNEHSW  176
               GPCEVWLD  RV Q+D+C   FP K      +DYSSC G  CMLR+YWL      ++  W
Sbjct  452981  GPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLAL----HQPQW  452814

Query  177     QVY  179
               QVY
Sbjct  452813  QVY  452805

>PYIR:scaffold_452 pir_scaffold_452 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_452:1:24914:1 
REF
Length=24914

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 76/173 (44%), Gaps = 48/173 (28%)
 Frame = +2

Query  58     FKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-ST  115
              +K  ++F    +  G+ TLR++++    T        CGFT+   AP+ IP D  +R S 
Sbjct  23843  WKDPKNFATAAKEKGFATLRSYLEDKGAT--------CGFTDPNVAPRAIPADRKVRFSR  23998

Query  116    GYTHD----------------------------------GPCEVWLDSTRVLQSDNCHET  141
                +H                                   GPCE+W+D  RV Q+D+C   
Sbjct  23999  DISHPVRANIWCCLTQTRSACAELTRFVLSLTHWLLSM*GPCELWIDDKRVYQNDDCESA  24178

Query  142    FPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRL  192
              F G   ++++D++ C G CM+R+YWL  +   +   WQVY     LS    R+
Sbjct  24179  FTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQVYSKWTRLSVLTMRI  24331

>PHSO:scaffold_31
Length=53937

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 59/131 (45%), Gaps = 12/131 (9%)
 Frame = +3

Query  59     KTVEDFNGWRRSNGYKTLRAFM----DGAKYTVTDGADYYCGFTN-AKAAPQPIPDGTM-  112
              K    F+   +++ YK+L+ FM    D  K          CGFT+    A QP+PD    
Sbjct  11418  KNTAAFDRALKASQYKSLKEFMYSTQDMTKGRFNLPKTAECGFTDPVDGAVQPLPDQVEW  11597

Query  113    RSTGYTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLK  171
                 G  HDGPCE+W D    +  + NC   +P   +  + + C+G   L  YWLGT    
Sbjct  11598  YGGGMIHDGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYEKAKCEGKKRLTMYWLGTLL--  11771

Query  172    NEHSWQVYKAC  182
                  WQVY  C
Sbjct  11772  ---EWQVYIDC  11795

>PHRA:scaffold_532
Length=10654

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 61/122 (50%), Gaps = 10/122 (8%)
 Frame = +2

Query  69    RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVW  126
              ++ YK+L+     ++ T+ DGA   CGF+    A Q +P   ++   +T  H GPCEVW
Sbjct  2066  NASTYKSLKELAWDSQ-TLADGASNECGFSVVDGAAQDLP-AEVQWDFFTASHQGPCEVW  2239

Query  127   LDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
              D T V ++ NC   +P    NL Y  + C  S +L  YW+          WQVY  C P
Sbjct  2240  CDDTLVFENWNCAVDYPETPANLPYDKAKCASSSVLTSYWIALHTTP----WQVYTNCAP  2407

Query  185   LS  186
             L+
Sbjct  2408  LT  2413

>PHKE:scaffold_279 scf_22126_279.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_279.1:1:48404:1 
REF
Length=48404

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 48/103 (47%), Gaps = 7/103 (7%)
 Frame = -3

Query  89     DGADYYCGFTNAKAAPQPIPDG--TMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146
              D A   CG T+A A  Q  P     +      H G CEVWLD+  +  + +C   +   T
Sbjct  48051  DAAGSICGNTDANATAQTAPSNGQVILDISAVHIGSCEVWLDAALMANASDCWTAYTDNT  47872

Query  147    YNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACIPLSSS  188
                +DYS C GS C LRW WL T        W+++  C+ +  S
Sbjct  47871  IPVDYSKCTGSQCQLRWVWLATH----NDPWEIFDNCVNIVGS  47755

>PYIR:scaffold_46 pir_scaffold_46 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_46:1:69731:1 
REF
Length=69731

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 7/62 (11%)
 Frame = +2

Query  121   GPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
             GPCEVWLD  RV   +NC   F   P     +D+SSCKG CMLR+YWL      +E +WQ
Sbjct  2735  GPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLAL----HEPTWQ  2902

Query  178   VY  179
             VY
Sbjct  2903  VY  2908

>SADI:scaffold_22 supercont1.22 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.22:1:763575:1 
REF
Length=763575

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 48/89 (54%), Gaps = 15/89 (17%)
 Frame = -1

Query  121     GPCEVWLDSTRVLQSDNCHETFPGKT---YNLDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
               GPCEVWLD  RV Q D+C   FP K      +DYSSC GS CMLR+YWL      ++  W
Sbjct  134868  GPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLAL----HQPQW  134701

Query  177     QVYKA------CIPLSSS-ARRLEGAANE  198
               QVY        C P  +  +R+L   A +
Sbjct  134700  QVYSTFSLPFFCRPAHTVWSRKLRATARQ  134614

>PHPA:scaffold_460 NW_008649446.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.460, whole genome 
shotgun sequence
Length=3430

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -3

Query  60   TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
            +V+ F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  701  SVDAFKALKTANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAI  537

Query  118  THDGPCEVWLDSTRVLQSDNC  138
             H GPCE+WLD T+VL  D+C
Sbjct  536  VHVGPCEIWLDDTKVLYEDDC  474

>PYUU:scaffold_2012 scf1117875582012 dna:supercontig supercontig:pug:scf1117875582012:1:298282:1 
REF
Length=298282

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 66/141 (47%), Gaps = 18/141 (13%)
 Frame = -3

Query  70      SNGYKTLRAFMDGAKYTVT-----DGADYYCGFTNAKAAPQPIPDGTM-RSTGYTHDGPC  123
               +NG+K+LR ++   +  V       G    CGFT+    PQ IPD    R + + H GPC
Sbjct  207473  ANGFKSLREYIKKYQKVVPYDGRPAGGTLECGFTDPNGPPQMIPDQIAWRGSTFQHSGPC  207294

Query  124     EVWLDSTRVLQSDNCH--ETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               EV  D  RV+ + +C   E   GK    D + C G   L +YWL T  +     +Q+Y  
Sbjct  207293  EV*CDDERVMYAPSCKVWEATGGK-MTYDKAKCIGKKRLTFYWLATFNV----PFQLYTD  207129

Query  182     CIPLSSSARRLEGAANESAAI  202
               C PL  +      A N +A +
Sbjct  207128  CAPLQGTT-----AGNSTAVV  207081

>PYAP:scaffold_1339 pag1_scaffold_1339 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_1339:1:4440:1 
REF
Length=4440

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 72/184 (39%), Gaps = 26/184 (14%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYK-----------  74
             DAH  +L P   +TT+  +     +   +   F +    N  R S G+K           
Sbjct  1324  DAHAFLLNPKAQFTTNKMNYYAYVVDGNKVPPFSSYTTGNAERNSQGFKANYKKLNPKSL  1503

Query  75    ---TLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDG------TMRSTGYTHDGPCEV  125
                 LR         +  G    CGF+    AP P+P+        +++    H GPCE 
Sbjct  1504  KDFILRNQQRATGSDIPPGGTAECGFSKPNIAPLPLPNAIEFGNYNLQNRDGLHPGPCEA  1683

Query  126   WLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIP  184
             W D+  V+  +++C   F  K    D S C G     +YWL T F      +QVY  C P
Sbjct  1684  WCDNEIVIPFTEDCRTRF-NKPIPYDKSKCVGKKRFTFYWLATHFA----PFQVYIGCAP  1848

Query  185   LSSS  188
             +  S
Sbjct  1849  IGGS  1860

>PYVX:scaffold_1640 pve_scaffold_1640 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1640:1:2714:1 
REF
Length=2714

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 72/161 (45%), Gaps = 22/161 (14%)
 Frame = -2

Query  30   VVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTVTD  89
            V +LP P+  + N D      A+L  Q FK          ++ Y +L+      + T+  
Sbjct  703  VSVLPVPSGMSYNTDPASNTKAYL--QAFK----------ASSYTSLKDLAFKTQ-TLVS  563

Query  90   GADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTRVLQSDNCHETFPGKTY  147
             A   CGF+      Q +P  T++   +T  H GPCEVW D     Q DNC  ++P    
Sbjct  562  PASNECGFSVVDGTKQDLP-ATVQWDFFTASHQGPCEVWCDDVLAFQDDNCAVSYPETPA  386

Query  148  NLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
             L Y  S C+G+ +L   W+      +   WQVY  C PL+
Sbjct  385  ELPYDKSKCEGASVLMSIWIAL----HSPPWQVYTNCAPLT  275

>PYAR:scaffold_1613 par_scaffold_1613 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1613:1:7643:1 
REF
Length=7643

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = -3

Query  73    YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRV  132
             YK+L+A + G +      A+  CGFT    A +     T+  + + H GPCEVW D+T++
Sbjct  7440  YKSLKALIMGTQKVEAGTAE--CGFTIKDEAKRATLPSTIVHSSFFHPGPCEVWCDNTKL  7267

Query  133   LQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
               + +C   +      +D S C G+  L  YWL      +   WQVY  C+ L
Sbjct  7266  AYALDCQTAYKTSKIPIDTSKCAGADRLTLYWLAV----HGSPWQVYIDCVYL  7120

>PHPA:scaffold_8 NW_008648994.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.8, whole genome shotgun 
sequence
Length=1889443

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 83/196 (42%), Gaps = 31/196 (16%)
 Frame = -2

Query  26       DAHQVVLLPAPTYTTDNKDTKYAPL----AFLESQG--FKTVED-------FNGWRRSNG  72
                DAH  ++ P   +T +     +A L    A    QG  F    D       F    +++ 
Sbjct  1816851  DAHGTLVKPGLKFTGEGYGGNFAALVPMTALTPQQGDIFTNYPDAGLNAAAFGRAFKASK  1816672

Query  73       YKTLRAFM----DGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMRSTG-YTHDGPCEVW  126
                YK+L+ F+    D +K   T      CGFT+    P QP+PD      G   H GPCE+W
Sbjct  1816671  YKSLKEFLLTNQDMSKGRNTMPKTPECGFTDPTGGPVQPLPDQCEWYGGKMNHPGPCEIW  1816492

Query  127      LDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
                 D   VL  + NC +T+P   +    + C+G   L  YW+ T        WQVY  C   
Sbjct  1816491  CDDEIVLPFTVNCADTYPDGKFPYKKAMCEGKKRLTMYWMSTLL-----EWQVYIDC---  1816336

Query  186      SSSARRLEGAANESAA  201
                   A+  EG    SA+
Sbjct  1816335  ---AKIGEGGPPASAS  1816297

>PYIW:scaffold_1952 piw_scaffold_1952 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1952:1:6546:1 
REF
Length=6546

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 8/116 (7%)
 Frame = -1

Query  73    YKTLRAFMDGAKYTVTDGADYYCGFT---NAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
             +K+L   +   +    D  D  CG+T    AK A  P   G +  +G++H GPCE+W D+
Sbjct  4737  WKSLGELILANQKMYADTIDKQCGYTILDEAKRATMPA-SGEITFSGFSHPGPCELWCDN  4561

Query  130   TRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              ++  +++C  T+       D + C G+  L  YW+G +       WQVY  C+ L
Sbjct  4560  NKLASANDCSVTYKSGKVPFDAAKCAGANKLTIYWIGVQ----GTPWQVYTNCVYL  4405

 Score = 38.9 bits (89),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 49/136 (36%), Gaps = 37/136 (27%)
 Frame = +2

Query  26    DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFK-TVEDFNGWRRSNGYKTLRAFMDGAK  84
             +AH  V +P PT+ +   D+ +         G K T   +    ++ G K LR F++   
Sbjct  6152  EAHGYVAIPKPTWKSGKADSSWVEEFKSPWGGSKWTAAQYATTAKAKGVKDLRTFLEPH-  6328

Query  85    YTVTDGADYYCGFTNAKAAPQPIPD--GTMRSTGYTH-----------------------  119
                       CG  NA  A QPIP       S    H                       
Sbjct  6329  -------GPVCGKNNANGAAQPIPSDKKVHYSRAIVHPVRPSESVLLLFISVRGF*LARI  6487

Query  120   ---DGPCEVWLDSTRV  132
                 GPCE+WLD+T+V
Sbjct  6488  *S*QGPCEIWLDNTKV  6535

>SADI:scaffold_390 supercont1.390 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.390:1:1004:1 
REF
Length=1004

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 39/65 (60%), Gaps = 8/65 (12%)
 Frame = -1

Query  121  GPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKG-SCMLRWYWLGTRFLKNEHSW  176
            GPCEVWLD+ RV Q+D+C   F   P     +DYSSC G  CMLR+YW+       +  W
Sbjct  860  GPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSCAGDGCMLRFYWIALH----QPEW  693

Query  177  QVYKA  181
            QVY A
Sbjct  692  QVYSA  678

>PYVX:scaffold_341 pve_scaffold_341 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_341:1:29233:1 
REF
Length=29233

 Score = 63.2 bits (152),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 12/67 (18%)
 Frame = -1

Query  121    GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGSCMLRWYWLGTRFLKN  172
              GPCEVW D T VL  DNC + +PG   +        +DY+ C G C+LR+YWLG    +N
Sbjct  23710  GPCEVWFDDTMVLHGDNCEDEYPGGDVDTTDYSQMTVDYTQCSGDCVLRFYWLG---FQN  23540

Query  173    EHSWQVY  179
              E  WQ Y
Sbjct  23539  E-MWQAY  23522

 Score = 23.5 bits (49),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/102 (25%), Positives = 42/102 (41%), Gaps = 13/102 (13%)
 Frame = -2

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTL--RAFMDGA  83
              +AH  +  P+PT+  D     YA ++++    +   E  +G  +   +K L     M   
Sbjct  24072  EAHGYLYEPSPTWVND-----YANVSYVVGIDYYWEEVGSGGDQVGKFKELAEEKGMSVR  23908

Query  84     KYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-----STGYTH  119
                 +    D+ CG T      Q IP DG ++       G+TH
Sbjct  23907  DVLLEMAPDHPCGHTLEDGTAQDIPSDGLVQFMGNNGGGFTH  23782

>PYIW:scaffold_783 piw_scaffold_783 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_783:1:14176:1 
REF
Length=14176

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +2

Query  121    GPCEVWLDSTRVLQSDNCHETFPG--KTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178
              GPCE+++D TRV Q+D+C   F G   ++++D+S CKG CM+R+YWLG +   +   WQV
Sbjct  11333  GPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQV  11506

Query  179    Y  179
              Y
Sbjct  11507  Y  11509

>PYUU:scaffold_2031 scf1117875582031 dna:supercontig supercontig:pug:scf1117875582031:1:1316296:1 
REF
Length=1316296

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 88/196 (45%), Gaps = 28/196 (14%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYAPLAFL----ESQG--FKTVEDFNGWR------RSNGY  73
              DAH  +  P  T+T       ++ L  +    E  G  F T++     R      +++ Y
Sbjct  84071  DAHGTLAKPGLTFTGKAYAGDFSALVPMSKLKEPSGKRFATMDATANARVFATAFKASSY  83892

Query  74     KTLRAFM----DGAKYTVTDGADYYCGFTNAKAAP-QPIPDGTMRSTG-YTHDGPCEVWL  127
              KTL+ F+    D +K   ++     CGFT+    P Q +PD      G   H GPCEVW 
Sbjct  83891  KTLKDFILKNQDLSKGRFSNPKTAECGFTDPNKGPVQALPDKLEWYGGRMNHPGPCEVWC  83712

Query  128    DSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
              D+  V+  + +C  T+P    + + + C G   L  YW+ T        WQVY  C  + 
Sbjct  83711  DNEVVVPFTADCAATYPQGKISYNKAKCTGKSRLTLYWMSTLM-----EWQVYIDCAKI-  83550

Query  187    SSARRLEGAANESAAI  202
               + R+LEG   E AA+
Sbjct  83549  GNGRKLEG---EDAAL  83511

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 48/110 (44%), Gaps = 8/110 (7%)
 Frame = +2

Query  97     FTNAKAAP-QPIPDGTMRSTG-YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSS  153
              FT+    P Q +PD      G   H GPCEVW D+  V+  + +C  TFP      + + 
Sbjct  86537  FTDPNKGPVQALPDKLEWYGGQMNHPGPCEVWCDNEVVVPFTADCAATFPDGKIPYEKAK  86716

Query  154    CKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESAAIE  203
              C G   L  YW+ T        WQVY  C  + + A   E     SA+ E
Sbjct  86717  CTGKSRLTLYWMSTLM-----EWQVYIDCAKIGNGAVASEATTTPSASAE  86851

>PYIW:scaffold_5060 piw_scaffold_5060 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_5060:1:1596:1 
REF
Length=1596

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 63/138 (46%), Gaps = 15/138 (11%)
 Frame = +3

Query  52   FLESQGFKTVEDFNGWRRSNGYKTLRAFM----DGAKYTVTDGADYYCGFTNAKA-APQP  106
             L+SQ  K  +D     + + YKTL+ F+    D +K   ++     CGFT+    A Q 
Sbjct  249  MLQSQNAKAFDD---AFKVSTYKTLKEFILKNQDMSKGRFSNPKTPECGFTDPTGGAVQT  419

Query  107  IPDGTM-RSTGYTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYW  164
            +PD       G  H GPCEVW D+  V+  + NC  T+P      D + C G   L  YW
Sbjct  420  LPDQLEWYGGGMNHPGPCEVWCDNEIVVPYTANCVATYPQGKIKYDKAKCVGKNRLTLYW  599

Query  165  LGTRFLKNEHSWQVYKAC  182
            L T        WQVY  C
Sbjct  600  LSTIL-----EWQVYIDC  638

>PHKE:scaffold_376 scf_22126_376.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_376.1_contig_1:1:35422:1 
REF
Length=35422

 Score = 62.8 bits (151),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 59/119 (50%), Gaps = 24/119 (20%)
 Frame = +3

Query  73     YKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGT-MR------STGY--THDGPC  123
              Y +LRA ++     VTD     CG T    +P  +   T MR        G+  +H GPC
Sbjct  26532  YASLRALLEP---VVTD-----CGNTRIDISPFNVTGATEMRWQNDQEHKGFIDSHHGPC  26687

Query  124    EVWLDSTRVLQSDNCHETFPGKTYNL--DYSS-CKGSCMLRWYWLGTRFLKNEHSWQVY  179
              EVW+D  RVL +++C  TF      L  DY S CKG C   +YWL      +E SWQVY
Sbjct  26688  EVWIDKHRVLHNNDCRATFTSYPARLPVDYDSLCKGECSFTFYWLAL----HEPSWQVY  26852

>PYIR:scaffold_1966 pir_scaffold_1966 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1966:1:4262:1 
REF
Length=4262

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 7/62 (11%)
 Frame = +1

Query  121   GPCEVWLDSTRVLQSDNCHETF---PGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
             GPCE+WLD  RV   +NC   F   P     +D+SSCK +CMLR+YWL      +E +WQ
Sbjct  1795  GPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTWQ  1962

Query  178   VY  179
             VY
Sbjct  1963  VY  1968

>PYIR:scaffold_976 pir_scaffold_976 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_976:1:12025:1 
REF
Length=12025

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = -3

Query  119   HDGPCEVWLDSTRVLQSDNCHETFPGK--TYNLDYSSCKGSCMLRWYWLGT  167
             + GPCE+W+D+ RV +S +C + FP +  T   DYS C+G C+L +YWL T
Sbjct  5279  YQGPCEIWIDTKRVFESQDCAKVFPEELGTIKFDYSPCRGECLLTFYWLET  5127

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 21/84 (25%)
 Frame = +3

Query  72    GYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGY-----------THD  120
             GYK+LR  MD  KY  T      CG+T    AP  +    M S  +           +H 
Sbjct  6909  GYKSLRELMD--KYVPT------CGYTRTDIAPVDV--SRMSSMKFQNNEYKEGFLNSHH  7058

Query  121   GPCEVWLDSTRVLQSDNCHETFPG  144
             GPCE W+D+TRV   D+C ++FPG
Sbjct  7059  GPCEGWIDNTRVFHYDDCVKSFPG  7130

>PYAR:scaffold_266 par_scaffold_266 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_266:1:23117:1 
REF
Length=23117

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 72/163 (44%), Gaps = 16/163 (10%)
 Frame = +1

Query  26    DAHQVVLLPAPTYTTD--NKDTKYAPLAFLESQGFKTVEDFNGWRR----SNGYKTLR-A  78
             DAH  + +P   +     N ++ Y  +   +     ++ D+ G ++      GYKTLR  
Sbjct  8566  DAHTNMAVPVVKFPDGFYNGNSPYGRINSDKFSSAASIADYQGVQKIAKVMEGYKTLRQM  8745

Query  79    FMDGAKYTVTDG--ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSD  136
              M     +   G   +  CG T      QP+PD      G  H GPCEVW D+TR+  + 
Sbjct  8746  IMANVALSTISGHTGNKECGLTITTGEKQPLPDAIDFPWG--HPGPCEVWCDNTRIFYNG  8919

Query  137   NCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             +C     GK   +D + CKG  +++  ++G        +W+ Y
Sbjct  8920  DCQGNKVGKV-PVDMAKCKGVNIIQAMYVGVHV----SNWEAY  9033

>PYIR:scaffold_998 pir_scaffold_998 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_998:1:11681:1 
REF
Length=11681

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 55/118 (47%), Gaps = 8/118 (7%)
 Frame = -1

Query  71     NGYKTLRAFMDGAKYTVTDGADYYCGFT---NAKAAPQPIPDGTMRSTGYTHDGPCEVWL  127
              +G  TLR  +   +       D  CG+T    AK    P   G +  +G+TH GPCE+W 
Sbjct  10223  SGVTTLRDLIMKNQKMWAPTVDPKCGYTILDEAKRTTMPA-SGKITFSGFTHPGPCELWC  10047

Query  128    DSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
              D+ ++  +++C  T+P      D + C  +     YW+G +       WQVY  C+ L
Sbjct  10046  DNNKLAFANDCAATYPDAKVPFDAAKCANANQFTIYWIGVQ----GTPWQVYTNCVYL  9885

>PYIR:scaffold_2122 pir_scaffold_2122 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2122:1:3740:1 
REF
Length=3740

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 57/125 (46%), Gaps = 12/125 (10%)
 Frame = +2

Query  65    NGWRRSNGYKTLRAFM----DGAKYTVTDGADYYCGFTN-AKAAPQPIPDGTMRSTG-YT  118
             N ++  + YKT + F+    D +K    + +   CGFT+    A Q +PD      G   
Sbjct  1934  NAFKAQSQYKTFKDFIMKNQDMSKGRKKNPSSAECGFTDPTSGAVQALPDQLEWYGGQMN  2113

Query  119   HDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQ  177
             H GPCEVW D+  V+  + NC   FP      D + C G   L  YW+ T      + WQ
Sbjct  2114  HPGPCEVWCDNEVVIPFTANCQAAFPSGKMKYDKAKCVGKSRLTLYWMSTL-----NEWQ  2278

Query  178   VYKAC  182
             VY  C
Sbjct  2279  VYIDC  2293

>PHRA:scaffold_44
Length=415431

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 76/182 (42%), Gaps = 35/182 (19%)
 Frame = -3

Query  26     DAHQVVLLPAPTYTTDNKDTKYA---PLAFLESQG---FKTVED-------FNGWRRSNG  72
              DAH  +  PA  +T       +A   P+  L  Q    F    D       F    +++ 
Sbjct  72478  DAHGTLTQPALKFTGTGYGGNFAATVPMTALTPQSGDIFTNYPDASLNAAAFTRAFKASK  72299

Query  73     YKTLRAFM----DGAKYTVTDGADYYCGFTNAKAAPQ-PIPD------GTMRSTGYTHDG  121
              Y +L+ F+    D +K   T      CGFT+  + P  P+P       G M      HDG
Sbjct  72298  YSSLKEFLLTNQDMSKGRFTMPKTPECGFTDPTSGPVVPLPQELEWYGGKMN-----HDG  72134

Query  122    PCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180
              PCEVW D+  VL  + NC  T+P   +  + + C+G   L  YW+ T        WQVY 
Sbjct  72133  PCEVWCDNEIVLPFTANCAVTYPEGKFPYEKAKCEGKSRLTLYWMSTLL-----EWQVYI  71969

Query  181    AC  182
               C
Sbjct  71968  DC  71963

>PHCA:scaffold_3 PHYCAscaffold_3
Length=1611504

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 58/121 (48%), Gaps = 12/121 (10%)
 Frame = -1

Query  69      RSNGYKTLRAFM----DGAKYTVTDGADYYCGFTN-AKAAPQPIPDGTMRSTG-YTHDGP  122
               +++ Y +L+ F+    D +K   T      CGFT+    A QP+PD      G   HDGP
Sbjct  447993  KASKYTSLKEFLLDNQDMSKGRFTMPKTPECGFTDPTGGAVQPLPDQVEWYGGKMNHDGP  447814

Query  123     CEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKA  181
               CE+W D+  VL  + NC  T+P   +    + C+G   L  YW+ T        WQVY  
Sbjct  447813  CEIWCDNEIVLPFTANCAVTYPEGKFPYQKAKCEGKKRLTMYWMSTLM-----EWQVYID  447649

Query  182     C  182
               C
Sbjct  447648  C  447646

>PYVX:scaffold_1989 pve_scaffold_1989 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1989:1:1804:1 
REF
Length=1804

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 8/121 (7%)
 Frame = -1

Query  69    RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST-GYTHDGPCEVWL  127
              S+ Y +L+     A+ T+ DGA   CG++      Q +PD         +H GPCEVW 
Sbjct  1777  NSSSYTSLKDLAFDAQ-TLADGASNECGYSLVDGTAQDLPDEVQWDFFTSSHQGPCEVWC  1601

Query  128   DSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185
             D T   +  NC   +     NL Y  S C+G+ +L   W+          WQ+Y  C PL
Sbjct  1600  DDTLAFEDWNCAVDYTETPANLPYDKSKCEGASVLMSIWIALHTTP----WQIYTNCAPL  1433

Query  186   S  186
             +
Sbjct  1432  T  1430

>PLHA:NW_020189786.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2881, whole genome shotgun sequence
Length=924714

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = -1

Query  69      RSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP---------DGTMRSTGYTH  119
                ++ Y +LR  +D     V+D     CG T    AP  +          D   R    +H
Sbjct  124446  HNSSYSSLREMLDP---VVSD-----CGNTREDVAPVNVTNAKELLWQNDEEHRGFVDSH  124291

Query  120     DGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSS-CKGSCMLRWYWLGTRFLKNEHSW  176
                GPCEVW+D+ R L +D+C  TF     +L  D+++ C G C L++YWL      +E +W
Sbjct  124290  HGPCEVWIDNHRALFNDDCRATFTSYPAHLPIDFNALCDGQCHLKFYWLAL----HEAAW  124123

Query  177     QVY  179
               QVY
Sbjct  124122  QVY  124114

>PHIF:NW_003303307.1 Phytophthora infestans T30-4 supercont1.454 
genomic scaffold, whole genome shotgun sequence
Length=44621

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 58/126 (46%), Gaps = 6/126 (5%)
 Frame = +1

Query  70    SNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDS  129
             + GY +L  F+   +   +   D  CG+T  K + +      +  TG+TH GPCE+W D 
Sbjct  739   TKGYDSLGEFIAKNQELYSSDIDPDCGWTVYKDSARSALPTQLEYTGFTHPGPCEIWCDD  918

Query  130   TRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187
             T++L   +C   +P     + Y  S C  +  L  +W+G         WQ+Y  C+ L  
Sbjct  919   TKLLFDYDCWTKYPAIPAKIPYDKSKCANANRLTIFWIGIHGTP----WQIYTDCVWLKG  1086

Query  188   SARRLE  193
              + R E
Sbjct  1087  GSGRGE  1104

>PYAR:scaffold_55 par_scaffold_55 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_55:1:37862:1 
REF
Length=37862

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 64/140 (46%), Gaps = 16/140 (11%)
 Frame = -2

Query  61     VEDFNGWRRSNGYKTLRAF-MDGAKYTVTDGADYYCGFTNA--KAAPQPIPDGTM-----  112
              +E F     ++ YKTLR F M       +      CG T     + PQP+P+  +     
Sbjct  10549  MEAFAAAIGNSSYKTLREFVMKHQTMQDSKSISPECGRTKGVGGSVPQPLPEKYVVWQHG  10370

Query  113    RSTGYT--HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDY--SSCKGSCMLRWYWLGTR  168
               + G+T  H+GPCE+W D  RV    NC +T+      L Y  + C G   L+  WL   
Sbjct  10369  DNEGFTPSHEGPCELWCDDERVFSEKNCAKTYSQIPAKLPYERAKCVGKKRLQIVWLAL-  10193

Query  169    FLKNEHSWQVYKACIPLSSS  188
                 +E  WQVY  C  L+++
Sbjct  10192  ---HETRWQVYMNCAHLANA  10142

>PYAP:scaffold_10 pag1_scaffold_10 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_10:1:143185:1 
REF
Length=143185

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 66/149 (44%), Gaps = 19/149 (13%)
 Frame = +2

Query  61     VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGAD-----YYCGFTNAKAAPQPIPDGTMRST  115
               E F    +++ YK+L+ F+   + T  +G D       CGFT+  +  Q +PD      
Sbjct  54305  AEAFGRTFKASQYKSLKEFLMKHQ-TFNEGRDNMPRTLECGFTDPTSGVQQLPDQLEWYG  54481

Query  116    G-YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNE  173
              G   HDGPCEVW D   VL  + NC  T+P   +  D +   G   L  YW+ T      
Sbjct  54482  GKMNHDGPCEVWCDDEIVLPFTANCAATYPDGKFKYDKAK*VGKKRLTMYWMATLL----  54649

Query  174    HSWQVYKACIPLSSSARRLEGAANESAAI  202
                WQVY  C      A+  EG A  S  +
Sbjct  54650  -QWQVYIDC------AKIGEGGAPASNNV  54715

>PYIR:scaffold_1332 pir_scaffold_1332 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1332:1:8114:1 
REF
Length=8114

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (49%), Gaps = 5/90 (6%)
 Frame = +3

Query  95    CGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSS  153
             CGF++    PQ +PD     + + H GPCE W D+  V+  + NC +TF   +     + 
Sbjct  6984  CGFSDPAGTPQALPDKLQWGSSFIHPGPCEAWCDNEIVVPYTANCWKTFADGSVPYSKAK  7163

Query  154   CKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             C G   L +YWL      +   WQVY  C+
Sbjct  7164  CAGKKQLTFYWLAL----HSPPWQVYINCV  7241

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (49%), Gaps = 2/72 (3%)
 Frame = +1

Query  95    CGFTNAKAAPQPIPDGTMRSTG-YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYS  152
             CG++N    PQ +P     + G + H GPCE W D   V+  + NC +TF       + +
Sbjct  5014  CGYSNPAGTPQALPAEIQWAGGNFIHPGPCEAWCDDEIVVPYTANCWKTFSTGMVPYEKA  5193

Query  153   SCKGSCMLRWYW  164
              C G   L +YW
Sbjct  5194  KCSGKKQLTFYW  5229

>PYIR:scaffold_4757 pir_scaffold_4757 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_4757:1:807:1 
REF
Length=807

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 73/177 (41%), Gaps = 29/177 (16%)
 Frame = +3

Query  26   DAHQVVLLPAPTYTTDNKDT-------KYAPL--AFLESQGFKTVEDFNGWRRSNGYKTL  76
            DAH  +LLP   + T NK+        K  P   A+      +  E F     +  YKTL
Sbjct  90   DAHAFLLLPKTEFITPNKNLYAYTIPGKSVPPENAYFTGNAERNSEGFKKNYAAGNYKTL  269

Query  77   RAFM------DGAKYTVTDGADYYCGFTNAKAAPQPIPDGT------MRSTGYTHDGPCE  124
            + F+       G      +G    CGF+   A PQP+P+        +++    H GPCE
Sbjct  270  KDFIFKTQQPSGPYKDRPNGGTAECGFSIPTATPQPLPNQIEYGNYNLQNREGIHPGPCE  449

Query  125  VWLDSTRVLQ-SDNCHET-FPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             W D   V+  +++C +  F    Y  D   C G     +YW+ T F      +QVY
Sbjct  450  AWCDDEIVIPFTEDCRKILFKPIPYAKD--KCVGKSRFTFYWVATHF----PPFQVY  602

>PYVX:scaffold_622 pve_scaffold_622 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_622:1:17888:1 
REF
Length=17888

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 36/68 (53%), Gaps = 12/68 (18%)
 Frame = +1

Query  121   GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGSCMLRWYWLGTRFLKN  172
             GPCE+W D T  L+ DNC   +PG            +DYS CKG C+LR+YWLG +    
Sbjct  2119  GPCEIWFDDTLALRGDNCENEYPGGAVGSTDYSAIPVDYSLCKGDCVLRFYWLGFQ----  2286

Query  173   EHSWQVYK  180
                WQ Y 
Sbjct  2287  NAMWQSYS  2310

>PHRA:scaffold_14
Length=678508

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = +1

Query  118     THDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSW  176
                H GPCE+WLD      + NC  T+  KT  LDYS C  S C +RW WL T    +   W
Sbjct  385072  VHIGPCELWLDDILAANATNCWATYTDKTIPLDYSQCTSSQCRVRWVWLAT----HNDPW  385239

Query  177     QVYKACIPLSSSA  189
               +++  C+ +  +A
Sbjct  385240  EIFDNCVNVVGTA  385278

>PYIR:scaffold_2176 pir_scaffold_2176 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2176:1:3569:1 
REF
Length=3569

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 41/86 (48%), Gaps = 5/86 (6%)
 Frame = -2

Query  95    CGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDYSS  153
             CGF+N   APQP+PD       + H GPCEV+ D   V+  + +C  TF       D + 
Sbjct  2497  CGFSNPNGAPQPLPDKLQWEMNFEHPGPCEVYCDDELVVPYTTDCWATFSDSILPYDKAR  2318

Query  154   CKGSCMLRWYWLGTRFLKNEHSWQVY  179
             C G   L  Y+L   +      WQVY
Sbjct  2317  CIGKKQLTLYFLAVHY----PPWQVY  2252

>PYIR:scaffold_2066 pir_scaffold_2066 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2066:1:3915:1 
REF
Length=3915

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 10/126 (8%)
 Frame = +3

Query  75    TLRAFMDGAKYTVTDGADYYCGFT---NAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTR  131
             T+R  +   +    +G D  CG T    AK    P   G +  +G+TH GPCE+W D  +
Sbjct  990   TMRDLIMENQKVWVEGVDPVCGDTLLDEAKRTTMPA-SGKISFSGFTHPGPCELWCDDNK  1166

Query  132   VLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL--SSSA  189
             +  +++C   +P      D + C G+     YW+          WQVY  C+ L   S+ 
Sbjct  1167  LAFANDCATEYPDNKVPFDAAKCAGANRFTLYWIAVH----GTPWQVYTNCVYLKGGSAD  1334

Query  190   RRLEGA  195
               L+GA
Sbjct  1335  LALDGA  1352

>PHPA:scaffold_76 NW_008649062.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.76, whole genome shotgun 
sequence
Length=282732

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +1

Query  60     TVEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIP-DGTMR-STGY  117
              +VE F   + +N +K L+  MD    T   GAD  CGFT+    PQPIP DG    S   
Sbjct  43765  SVETFKSLKSANNFKDLKTLMDD---TSVYGAD--CGFTDPNGTPQPIPTDGKATFSRAL  43929

Query  118    THDGPCEVWLDSTRV  132
               H GPCE+WLD T+V
Sbjct  43930  VHVGPCEIWLDDTKV  43974

>PYIR:scaffold_2435 pir_scaffold_2435 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_2435:1:2828:1 
REF
Length=2828

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 54/115 (47%), Gaps = 11/115 (10%)
 Frame = +3

Query  95    CGFTNA-KAAPQPIPDGTMRSTG-YTHDGPCEVWLDSTRVLQ-SDNCHETFPGKTYNLDY  151
             CGFT   K+A Q +P+      G   H GPCEVW D+  V+  + +C  TFP    + + 
Sbjct  2148  CGFTAPDKSAVQALPNQLEWYGGKMNHPGPCEVWCDNEVVVPFTADCSATFPQGKISYNK  2327

Query  152   SSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEG---AANESAAIE  203
             + C G   L  YW+ T        WQVY  C  +    R LE    A   +AAIE
Sbjct  2328  AKCVGKNRLTLYWMSTLL-----EWQVYIDCAKIGGGKRSLEAIESANTTAAAIE  2477

>PYAR:scaffold_6810 par_scaffold_6810 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_6810:1:1098:1 
REF
Length=1098

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 72/168 (43%), Gaps = 15/168 (9%)
 Frame = +1

Query  26   DAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGY----KTLRAF-M  80
            DAH ++ +P P+Y        Y  +          +  + G ++        K LR+F M
Sbjct  460  DAHTMMAVPQPSYPPGFYQGMYPVMRINTDNLAPEIPWYLGVQKITAVMKNQKDLRSFIM  639

Query  81   DGAKYTVTDG--ADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNC  138
            + A    T G  A   CGF+ A    QP+P        + H GPCE+W D+T+V  + +C
Sbjct  640  NNAVVNKTLGSWATKECGFSLADGVKQPLPAAV--DFPWGHAGPCEIWCDNTKVFYNGDC  813

Query  139  HETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186
                 GK        C G+  ++  ++GT        W+VY  C P++
Sbjct  814  QGNNVGKVS--LAGKCNGAKRIQAMYVGTHLA----PWEVYMQCAPIA  939

>PYVX:scaffold_663 pve_scaffold_663 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_663:1:16605:1 
REF
Length=16605

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 62/172 (36%), Gaps = 22/172 (13%)
 Frame = -2

Query  26    DAHQVVLLPAPTYTTDNKD--------TKYAPL-------AFLESQGFKTVEDFNGWRRS  70
             +AH  +LLP   +TTD K+        TK  P        A   +  FK       W   
Sbjct  1760  EAHGFLLLPETKFTTDKKNFYATWVEPTKVPPESSYWTGDAEKNAANFKVNYAAGSWSSL  1581

Query  71    NGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRST---GYTHDGPCEVWL  127
               +      M  A      G    CGF+   A  QP+PD            H GPCE W 
Sbjct  1580  KDFILTNQVMTDAYENRPSGGTLECGFSIPDATAQPLPDHLEYGNYIKDIIHPGPCEAWC  1401

Query  128   DSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179
             D   V+        + G     D + C+G   L +YWL T F      +QVY
Sbjct  1400  DDEIVVAFQEDCRVYQGIDIPYDKTKCEGKSRLTFYWLATHF----SPFQVY  1257

>PHRA:scaffold_555
Length=10086

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 10/71 (14%)
 Frame = +3

Query  121   GPCEVWLDSTRVLQSDNCHETFPGKTYN--------LDYSSCKGS-CMLRWYWLGTR-FL  170
             GPCE+WLD T VL +D+C + F  + Y         +DYSSC  S CM R+YWL  +   
Sbjct  9786  GPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGST  9965

Query  171   KNEHSWQVYKA  181
               ++ WQ+Y A
Sbjct  9966  SGKYVWQIYSA  9998

>PYAP:scaffold_983 pag1_scaffold_983 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_983:1:9183:1 
REF
Length=9183

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 58/113 (51%), Gaps = 8/113 (7%)
 Frame = -3

Query  73    YKTLRAFMDGAKYTVTDGADYY--CGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDST  130
             Y++L+ F+ G +  +T G +    CGFT      +     T++ + + H GPCEVW D+T
Sbjct  3919  YESLKDFILGTQI-MTPGLNGSPECGFTIKDEKKRSPISSTVKHSSFFHPGPCEVWCDNT  3743

Query  131   RVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACI  183
             ++  + +C  T+ G +  +D S CKG+  L  YW       +   WQ Y  C+
Sbjct  3742  KLAYALDCQSTY-GSSIPIDASKCKGADRLTLYWTAV----HGSPWQNYIYCV  3599

>PYAR:scaffold_4631 par_scaffold_4631 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4631:1:2091:1 
REF
Length=2091

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 59/144 (41%), Gaps = 14/144 (10%)
 Frame = +2

Query  26    DAHQVVLLPAPTYTTDNKD--TKYAPLAFLESQGFKTVED--------FNGWRRSNGYKT  75
             DAH  + +P P    ++    T   P+A     G     D           ++    YKT
Sbjct  1028  DAHSKMTVPNPNSPINDSPSGTINGPMALKVPDGMHFDYDPPQNYAAFTKAFQSQTKYKT  1207

Query  76    LR--AFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYT--HDGPCEVWLDSTR  131
             LR   +++     V   +   CG +     PQ +P     +TG++  H GPCEVW D  R
Sbjct  1208  LRDLIYVNFIPINVEGTSTKECGRSAMTGPPQALPAFVEYATGFSDSHWGPCEVWCDDVR  1387

Query  132   VLQSDNCHETFPGKTYNLDYSSCK  155
             V Q DNC   +P K   L Y   K
Sbjct  1388  VFQEDNCRIKYPNKPAKLPYDKAK  1459

>PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 
genomic scaffold, whole genome shotgun sequence
Length=1926061

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 7/81 (9%)
 Frame = -1

Query  109      DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYNL--DYSS-CKGSCMLRWYWL  165
                D   R    +H GPCE+W+D  R L +D+C  TF     +L  DY + C G C L +YWL
Sbjct  1134169  DEEQRGFVESHHGPCEIWVDERRALHNDDCRATFTSYPAHLPVDYDALCDGECQLTFYWL  1133990

Query  166      GTRFLKNEHSWQVYKACIPLS  186
                      +E +WQVY     LS
Sbjct  1133989  AL----HEAAWQVYSKSQELS  1133939

>PYVX:scaffold_50 pve_scaffold_50 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_50:1:72629:1 
REF
Length=72629

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 8/67 (12%)
 Frame = +2

Query  121    GPCEVWLDSTRVLQSDNCHETFPG------KTYNLDYSSCK-GSCM-LRWYWLGTRFLKN  172
              GPCE+WLD T VL  D+C+ T+ G        + +DYSSC  G C  +R+YWL  + +  
Sbjct  42350  GPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDG  42529

Query  173    EHSWQVY  179
              +  WQVY
Sbjct  42530  DTVWQVY  42550

>PHCA:scaffold_5 PHYCAscaffold_5
Length=1593284

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 50/105 (48%), Gaps = 10/105 (10%)
 Frame = -3

Query  82      GAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRS--TGYTHDGPCEVWLDSTRVLQSDNCH  139
               G+  T+ D A   CG T+A A   P P   + +      H GPCE     T +  + +C 
Sbjct  567714  GSIKTLADAAGSTCGNTDASATAIPAPSNRVVTFDISAVHIGPCE---HDTLMENATDCW  567544

Query  140     ETFPGKTYNLDYSSCKGS-CMLRWYWLGTRFLKNEHSWQVYKACI  183
                T+  KT  LD+S C GS C +RW WL T        W+++  C+
Sbjct  567543  TTYADKTIPLDFSQCTGSQCQIRWIWLATH----NDPWEIFDNCV  567421

Lambda      K        H        a         alpha
   0.318    0.133    0.431    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 35684108964

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40