Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
PLHA:NW_020189861.11844377184541134517670.0
PHPA:scaffold_6325087125192335114252e-178
PHIF:NW_003303697.143090543195735114154e-177
PHSO:scaffold_12799766280080934813839e-173
PHRA:scaffold_5615021115125734913732e-171
PHCA:scaffold_8410026710131935113643e-170
PHKE:scaffold_98671456819735112814e-159
PYAP:scaffold_16220074206972205731e-79
PYUU:scaffold_2037130791813083431455083e-79
PYVX:scaffold_275154722242366502e-74
PYAR:scaffold_2916051165511784801e-65
PYIW:scaffold_96310491114083195557e-62
PYIR:scaffold_81013741018261514812e-52
ALLA:FR82410411308119162144341e-45
ALCA:scaffold_90858089631313991e-42
APAS:scaffold_127078947084091832741e-24
SAPA:scaffold_243945663949041202565e-23
SADI:scaffold_42041282044211032447e-22
APIN:scaffold_203997224000541182412e-21
PYAR:scaffold_2744363539341221391e-07
HYAP:scaffold_842731592734521171312e-06
PHRA:scaffold_13064796650861161293e-06
PYIR:scaffold_755849388221361293e-06
PHSO:scaffold_8252770825280011171293e-06
PYIW:scaffold_452134816621301283e-06
PHKE:scaffold_26215981162711161267e-06
PYVX:scaffold_518520055261361259e-06
APAS:scaffold_138595528598391151241e-05
PYUU:scaffold_20076874236876981101241e-05
PHCA:scaffold_133421623424641191231e-05
SAPA:scaffold_2071671719311081231e-05
APIN:scaffold_17945817948501081222e-05
PHPA:scaffold_891005711008461101213e-05
ALCA:scaffold_7870324706141151204e-05
PHIF:NW_003303587.154941552101081194e-05
SADI:scaffold_522150542153141081186e-05
PYAP:scaffold_12339116394241281142e-04
ALLA:FR82410366803671501431132e-04
PYAP:scaffold_1374095741055351132e-04
ALLA:FR824471575660521101123e-04
PYAR:scaffold_112420072102341114e-04
APAS:scaffold_224410694414311291114e-04
PYIR:scaffold_23118904192211121060.002
ALCA:scaffold_12674852678471551040.003
PHRA:scaffold_164368294372211521040.003
ALCA:scaffold_46415199155371251030.004
HYAP:scaffold_111953781195479341030.004
PYIR:scaffold_316929896541511030.004
HYAP:scaffold_797365540171361020.005
PHRA:scaffold_731851261856441911020.005
PYIR:scaffold_882413124214281020.005
PHIF:NW_003303740.1226907322693811261020.006
PYUU:scaffold_2023313543313638321010.008
PYAP:scaffold_21220888212951611000.008
PHPA:scaffold_11460130605941731000.009
PHKE:scaffold_20652675647143990.011
PYIW:scaffold_4522565233928990.012
PYUU:scaffold_12395163951989135990.012
PHPA:scaffold_3257842657855744990.013
PHSO:scaffold_4971188971655174980.017
PHCA:scaffold_20129612130145196970.019
PLHA:NW_020189964.1880323880679133970.021
ALCA:scaffold_1611154811162526970.022
PHCA:scaffold_27527809528201152970.023
PHIF:NW_003303691.136411336424745960.027
APIN:scaffold_378081978104683960.029
PHKE:scaffold_581971920051132950.032
ALLA:FR824067835658364527950.034
PYAR:scaffold_2221325713553128950.034
PHSO:scaffold_223100742310436135950.038
PHRA:scaffold_27488774901145950.039
PHKE:scaffold_129535065358025950.039
HYAP:scaffold_46109870110202132950.040
SADI:scaffold_1206412206708117950.041
PHIF:NW_003303669.1370035370499173950.041
SAPA:scaffold_18154485846140940.043
PLHA:NW_020187174.1307045307482164940.044
PHPA:scaffold_569444269467285940.048
PYVX:scaffold_3785146535575940.049
PLHA:NW_020189809.1779623779967139940.051
PHIF:NW_003303698.168150968173985940.053
PYVX:scaffold_12542645433524930.064
SAPA:scaffold_701617816438110930.069
PHCA:scaffold_106991089933885930.070
PHRA:scaffold_47980680168137930.071
PYAR:scaffold_951106411080558920.076
APAS:scaffold_47420825421157121920.078
APAS:scaffold_5939623939898110920.080
SADI:scaffold_3742157742474135920.087
PHPA:scaffold_71543419154352337920.089
SADI:scaffold_20296187296570138920.090
PYIW:scaffold_649153881549237910.095
PYAP:scaffold_610185821868334910.096
PHCA:scaffold_1810753810764237910.096
SAPA:scaffold_45943159439830910.10
PYIW:scaffold_38855505825110910.10
HYAP:scaffold_7222699922710337910.10
ALLA:FR824088103549103872126910.11
PHRA:scaffold_3837789737800137910.11
PHCA:scaffold_21737859173795131910.11
PHIF:NW_003303756.13548762354886637910.11
ALCA:scaffold_2659548964031910.11
PHCA:scaffold_984440684455256910.11
APIN:scaffold_2275885276244133910.12
ALLA:FR8245027653774531910.12
SADI:scaffold_66237681238079141900.13
ALLA:FR824075487424882227900.13
PYVX:scaffold_51342213715116900.13
PHIF:NW_003303755.113887921389124132900.15
PHKE:scaffold_69488904899437900.16
PHPA:scaffold_53120919121251132900.16
ALCA:scaffold_12166046882111900.17
PLHA:NW_020189293.11002284100242449900.17
ALLA:FR824181259082601536890.17
ALLA:FR824176424954260236890.17
APIN:scaffold_1187652087661534890.17
APAS:scaffold_4935978735988234890.18
SADI:scaffold_2736590336599834890.18
PYIR:scaffold_3100130417110880.18
APAS:scaffold_612406212422361890.19
APIN:scaffold_8307116307391110890.20
PYIR:scaffold_115562515572937890.20
SAPA:scaffold_3710664510675539890.20
ALCA:scaffold_34512865136326890.21
PYUU:scaffold_20341065680106579942890.21
PHPA:scaffold_4230401330415956880.22
PYVX:scaffold_291294142951233880.23
SAPA:scaffold_1951827651837134880.23
SAPA:scaffold_2835917836207126880.25
PHKE:scaffold_269155271566148880.25
PHRA:scaffold_22395163395495125880.26
SAPA:scaffold_4677465757840870.29
SADI:scaffold_1353737853748839870.31
PYAR:scaffold_11163823392737870.32
HYAP:scaffold_29314863165057870.35
PYAR:scaffold_37386941002114860.36
SADI:scaffold_157629876654127870.37
SADI:scaffold_6926514726523030860.39
PYVX:scaffold_44139331413374860.41
PYVX:scaffold_478296845154860.44
ALCA:scaffold_49388373901363860.47
PHIF:NW_003303710.175602175611632860.48
PYVX:scaffold_119016651958112850.49
SAPA:scaffold_2732818297354850.50
PHPA:scaffold_98619366203132850.52
SAPA:scaffold_6503388503738125850.55
ALCA:scaffold_1313697013708338850.59
PYIW:scaffold_12159088923456850.60
PYAP:scaffold_875436554639850.60
APIN:scaffold_59307816308091116850.62
PYUU:scaffold_2035259902260279133850.62
PHKE:scaffold_62641234497143850.63
PYIR:scaffold_12353513361436850.63
PHSO:scaffold_33934544393463932850.63
ALCA:scaffold_332372624070123850.66
PHRA:scaffold_66685686866332850.66
PHCA:scaffold_4234994835010354840.67
HYAP:scaffold_99215392163432840.69
ALCA:scaffold_55930009309833840.74
SADI:scaffold_77197743198066119840.76
PHKE:scaffold_90862038629832840.78
PLHA:NW_020190023.11843064184315932840.81
APAS:scaffold_151066084106618837840.85
PHIF:NW_003303737.152895252910151840.85
ALCA:scaffold_291686717295144840.85
PHPA:scaffold_25906579080651830.90
PYUU:scaffold_201131874731884836830.94
PYAR:scaffold_9956868700251830.98
PYUU:scaffold_1722762957646865831.0
PYAR:scaffold_2672250236342831.0
APIN:scaffold_1248684848695839831.1
PYAP:scaffold_115732857600115831.1
PYUU:scaffold_200680423580436345831.1
PYIR:scaffold_47543095440733821.2
APIN:scaffold_141143919114402337821.2
PLHA:NW_020187350.1369455369763117821.2
PHPA:scaffold_614510891451397117821.3
PHRA:scaffold_82787707897070821.3
PYIW:scaffold_784115751170347821.4
PHIF:NW_003303749.132805183280826117821.4
PLHA:NW_020188201.18276844657821.5
PHPA:scaffold_227786982779033127821.5
ALLA:FR8241072652926906136811.6
APAS:scaffold_21220973122108339811.6
PHCA:scaffold_72709047099932811.6
ALCA:scaffold_25249542509756811.6
APIN:scaffold_10173131173493129811.6
PHSO:scaffold_1335957235972153811.6
PYIW:scaffold_15113250336037811.7
PYAP:scaffold_747134581354130811.7
PYIW:scaffold_5255022515645811.7
SAPA:scaffold_6617983817999655811.8
PYAR:scaffold_28071028117150801.8
SADI:scaffold_1725322125337057811.9
ALLA:FR8242441318213532120802.0
PHRA:scaffold_152945452955536802.0
PYAR:scaffold_7996547676577802.1
PYIW:scaffold_651123721247336802.1
APAS:scaffold_41422062142216336802.1
SADI:scaffold_1061744861772394802.2
ALLA:FR824348123901248833802.2
PYAR:scaffold_571120431439792.4
PHCA:scaffold_1454789354807563802.5
SADI:scaffold_8755264755653155802.5
SADI:scaffold_794063794077147802.5
APIN:scaffold_71534495355041792.7
PHRA:scaffold_96295872967331792.7
PHKE:scaffold_306192211937955792.7
PYAP:scaffold_27840984391113792.8
PYAR:scaffold_405721202482134792.9
SAPA:scaffold_4023001223016157792.9
ALCA:scaffold_110676206784777792.9
SAPA:scaffold_2032127286793.0
SADI:scaffold_7214554814570359793.0
PHRA:scaffold_366157466172056793.1
APIN:scaffold_5436527236537337793.1
SAPA:scaffold_716223016238559793.2
HYAP:scaffold_322269942708031793.2
PHCA:scaffold_3013661813670732793.3
SADI:scaffold_25488924898433793.3
ALLA:FR824109260682621152793.4
APAS:scaffold_25221782227633793.5
SAPA:scaffold_5889578904933793.5
PYAP:scaffold_9266711680634783.5
PYAR:scaffold_1222028212334783.6
HYAP:scaffold_138113882114190120783.6
HYAP:scaffold_1033357333857114783.7
PYAP:scaffold_811108131092642783.7
HYAP:scaffold_312100531020558783.8
PHSO:scaffold_54809230480933136784.0
PHSO:scaffold_624500624522475784.1
PYIR:scaffold_9491719527124784.2
PHIF:NW_003303758.12232392223249336784.2
PYVX:scaffold_7221160511952140784.3
APAS:scaffold_189728697570118784.3
PHKE:scaffold_223517055186054784.3
PLHA:NW_020187139.114552814561732774.6
PYUU:scaffold_202513873113882632774.6
ALLA:FR8241972366424101147774.8
PYUU:scaffold_2032628516298848775.0
PHKE:scaffold_25540214284111775.1
PYIW:scaffold_735119471204232775.1
PHPA:scaffold_2310823310833436775.2
PYAR:scaffold_716429746460765.3
PHIF:NW_003303730.119346591934997118775.8
APIN:scaffold_1330688730705162775.9
PYAP:scaffold_2922348823790114766.1
SAPA:scaffold_476350276362742766.1
PYIR:scaffold_78480794817432766.2
ALLA:FR824049142726143022111766.3
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= PHALS_06478

Length=345
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  685        0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  553        2e-178
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  549        4e-177
PHSO:scaffold_1                                                       537        9e-173
PHRA:scaffold_56                                                      533        2e-171
PHCA:scaffold_84 PHYCAscaffold_84                                     530        3e-170
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  498        4e-159
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  225        1e-79 
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  200        3e-79 
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  254        2e-74 
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  189        1e-65 
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  218        7e-62 
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  189        2e-52 
ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:...  171        1e-45 
ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig sup...  158        1e-42 
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  110        1e-24 
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  103        5e-23 
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  98.6       7e-22 
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  97.4       2e-21 
PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:...  58.2       1e-07 
HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  55.1       2e-06 
PHRA:scaffold_130                                                     54.3       3e-06 
PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pi...  54.3       3e-06 
PHSO:scaffold_8                                                       54.3       3e-06 
PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:pi...  53.9       3e-06 
PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:Phy...  53.1       7e-06 
PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pv...  52.8       9e-06 
APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_a...  52.4       1e-05 
PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:p...  52.4       1e-05 
PHCA:scaffold_13 PHYCAscaffold_13                                     52.0       1e-05 
SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM151...  52.0       1e-05 
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  51.6       2e-05 
PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 ...  51.2       3e-05 
ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig sup...  50.8       4e-05 
PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 g...  50.4       4e-05 
SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_di...  50.1       6e-05 
PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:p...  48.5       2e-04 
ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:...  48.1       2e-04 
PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:p...  48.1       2e-04 
ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1...  47.8       3e-04 
PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:...  47.4       4e-04 
APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_a...  47.4       4e-04 
PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pi...  45.4       0.002 
ALCA:scaffold_1 AcNc2_CONTIG_1_length_398508 dna:supercontig supe...  44.7       0.003 
PHRA:scaffold_16                                                      44.7       0.003 
ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig s...  44.3       0.004 
HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:...  44.3       0.004 
PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pi...  44.3       0.004 
HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  43.9       0.005 
PHRA:scaffold_73                                                      43.9       0.005 
PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_...  43.9       0.005 
PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 ge...  43.9       0.006 
PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:p...  43.5       0.008 
PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:p...  43.1       0.008 
PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310...  43.1       0.009 
PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:Phy...  42.7       0.011 
PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_sc...  42.7       0.012 
PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:p...  42.7       0.012 
PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 ...  42.7       0.013 
PHSO:scaffold_4                                                       42.4       0.017 
PHCA:scaffold_20 PHYCAscaffold_20                                     42.0       0.019 
PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig:...  42.0       0.021 
ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig su...  42.0       0.022 
PHCA:scaffold_27 PHYCAscaffold_27                                     42.0       0.023 
PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 ge...  41.6       0.027 
APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inv...  41.6       0.029 
PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKe...  41.2       0.032 
ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:...  41.2       0.034 
PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:pa...  41.2       0.034 
PHSO:scaffold_2                                                       41.2       0.038 
PHRA:scaffold_27                                                      41.2       0.039 
PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:Phy...  41.2       0.039 
HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_4...  41.2       0.040 
SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_dicl...  41.2       0.041 
PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 ge...  41.2       0.041 
SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM1...  40.8       0.043 
PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig:...  40.8       0.044 
PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 u...  40.8       0.048 
PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pv...  40.8       0.049 
PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig:...  40.8       0.051 
PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 ge...  40.8       0.053 
PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_...  40.4       0.064 
SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM151...  40.4       0.069 
PHCA:scaffold_106 PHYCAscaffold_106                                   40.4       0.070 
PHRA:scaffold_4                                                       40.4       0.071 
PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:pa...  40.0       0.076 
APAS:scaffold_47 supercont1.47 dna:supercontig supercontig:Apha_a...  40.0       0.078 
APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_ast...  40.0       0.080 
SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_dicl...  40.0       0.087 
PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 u...  40.0       0.089 
SADI:scaffold_20 supercont1.20 dna:supercontig supercontig:Sap_di...  40.0       0.090 
PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:pi...  39.7       0.095 
PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:p...  39.7       0.096 
PHCA:scaffold_18 PHYCAscaffold_18                                     39.7       0.096 
SAPA:scaffold_45 supercont2.45 dna:supercontig supercontig:ASM151...  39.7       0.10  
PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:pi...  39.7       0.10  
HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  39.7       0.10  
ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:...  39.7       0.11  
PHRA:scaffold_38                                                      39.7       0.11  
PHCA:scaffold_2 PHYCAscaffold_2                                       39.7       0.11  
PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 gen...  39.7       0.11  
ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig s...  39.7       0.11  
PHCA:scaffold_9 PHYCAscaffold_9                                       39.7       0.11  
APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inv...  39.7       0.12  
ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1...  39.7       0.12  
SADI:scaffold_66 supercont1.66 dna:supercontig supercontig:Sap_di...  39.3       0.13  
ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:...  39.3       0.13  
PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_sc...  39.3       0.13  
PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 gen...  39.3       0.15  
PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKe...  39.3       0.16  
PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 ...  39.3       0.16  
ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig s...  39.3       0.17  
PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig:...  39.3       0.17  
ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1...  38.9       0.17  
ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1...  38.9       0.17  
APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_i...  38.9       0.17  
APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_a...  38.9       0.18  
SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_di...  38.9       0.18  
PYIR:scaffold_3100 pir_scaffold_3100 dna:supercontig supercontig:...  38.5       0.18  
APAS:scaffold_6 supercont1.6 dna:supercontig supercontig:Apha_ast...  38.9       0.19  
APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inv...  38.9       0.20  
PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_sc...  38.9       0.20  
SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM151...  38.9       0.20  
ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig su...  38.9       0.21  
PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:p...  38.9       0.21  
PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 ...  38.5       0.22  
PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pv...  38.5       0.23  
SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM151...  38.5       0.23  
SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154...  38.5       0.25  
PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig superc...  38.5       0.25  
PHRA:scaffold_22                                                      38.5       0.26  
SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM1...  38.1       0.29  
SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_di...  38.1       0.31  
PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:...  38.1       0.32  
HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  38.1       0.35  
PYAR:scaffold_3738 par_scaffold_3738 dna:supercontig supercontig:...  37.7       0.36  
SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_di...  38.1       0.37  
SADI:scaffold_69 supercont1.69 dna:supercontig supercontig:Sap_di...  37.7       0.39  
PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_...  37.7       0.41  
PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_...  37.7       0.44  
ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig su...  37.7       0.47  
PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 ge...  37.7       0.48  
PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:...  37.4       0.49  
SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM1...  37.4       0.50  
PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 ...  37.4       0.52  
SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154...  37.4       0.55  
ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig su...  37.4       0.59  
PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:...  37.4       0.60  
PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag...  37.4       0.60  
APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_i...  37.4       0.62  
PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:p...  37.4       0.62  
PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig superc...  37.4       0.63  
PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:...  37.4       0.63  
PHSO:scaffold_3                                                       37.4       0.63  
ALCA:scaffold_33 AcNc2_CONTIG_33_length_129266 dna:supercontig su...  37.4       0.66  
PHRA:scaffold_66                                                      37.4       0.66  
PHCA:scaffold_42 PHYCAscaffold_42                                     37.0       0.67  
HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_9...  37.0       0.69  
ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig su...  37.0       0.74  
SADI:scaffold_77 supercont1.77 dna:supercontig supercontig:Sap_di...  37.0       0.76  
PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKe...  37.0       0.78  
PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig:...  37.0       0.81  
APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_a...  37.0       0.85  
PHIF:NW_003303737.1 Phytophthora infestans T30-4 supercont1.22 ge...  37.0       0.85  
ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig su...  37.0       0.85  
PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 ...  36.6       0.90  
PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:p...  36.6       0.94  
PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:pa...  36.6       0.98  
PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:p...  36.6       1.0   
PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:pa...  36.6       1.0   
APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_i...  36.6       1.1   
PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag...  36.6       1.1   
PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:p...  36.6       1.1   
PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_...  36.2       1.2   
APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_i...  36.2       1.2   
PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig:...  36.2       1.2   
PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 u...  36.2       1.3   
PHRA:scaffold_82                                                      36.2       1.3   
PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:pi...  36.2       1.4   
PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 ge...  36.2       1.4   
PLHA:NW_020188201.1 Plasmopara halstedii genome assembly, contig:...  36.2       1.5   
PHPA:scaffold_2 NW_008648988.1 Phytophthora parasitica INRA-310 u...  36.2       1.5   
ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:...  35.8       1.6   
APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_ast...  35.8       1.6   
PHCA:scaffold_72 PHYCAscaffold_72                                     35.8       1.6   
ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig su...  35.8       1.6   
APIN:scaffold_10 supercont1.10 dna:supercontig supercontig:Apha_i...  35.8       1.6   
PHSO:scaffold_13                                                      35.8       1.6   
PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:...  35.8       1.7   
PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:p...  35.8       1.7   
PYIW:scaffold_525 piw_scaffold_525 dna:supercontig supercontig:pi...  35.8       1.7   
SAPA:scaffold_66 supercont2.66 dna:supercontig supercontig:ASM151...  35.8       1.8   
PYAR:scaffold_2807 par_scaffold_2807 dna:supercontig supercontig:...  35.4       1.8   
SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_di...  35.8       1.9   
ALLA:FR824244 dna:supercontig supercontig:ENA1:FR824244:1:48268:1...  35.4       2.0   
PHRA:scaffold_1                                                       35.4       2.0   
PYAR:scaffold_799 par_scaffold_799 dna:supercontig supercontig:pa...  35.4       2.1   
PYIW:scaffold_651 piw_scaffold_651 dna:supercontig supercontig:pi...  35.4       2.1   
APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_ast...  35.4       2.1   
SADI:scaffold_10 supercont1.10 dna:supercontig supercontig:Sap_di...  35.4       2.2   
ALLA:FR824348 dna:supercontig supercontig:ENA1:FR824348:1:31264:1...  35.4       2.2   
PYAR:scaffold_5711 par_scaffold_5711 dna:supercontig supercontig:...  35.0       2.4   
PHCA:scaffold_14 PHYCAscaffold_14                                     35.4       2.5   
SADI:scaffold_8 supercont1.8 dna:supercontig supercontig:Sap_dicl...  35.4       2.5   
SADI:scaffold_7 supercont1.7 dna:supercontig supercontig:Sap_dicl...  35.4       2.5   
APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_i...  35.0       2.7   
PHRA:scaffold_96                                                      35.0       2.7   
PHKE:scaffold_306 scf_22126_306.1 dna:supercontig supercontig:Phy...  35.0       2.7   
PYAP:scaffold_278 pag1_scaffold_278 dna:supercontig supercontig:p...  35.0       2.8   
PYAR:scaffold_4057 par_scaffold_4057 dna:supercontig supercontig:...  35.0       2.9   
SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM151...  35.0       2.9   
ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig s...  35.0       2.9   
SAPA:scaffold_203 supercont2.203 dna:supercontig supercontig:ASM1...  35.0       3.0   
SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_di...  35.0       3.0   
PHRA:scaffold_3                                                       35.0       3.1   
APIN:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_i...  35.0       3.1   
SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154...  35.0       3.2   
HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  35.0       3.2   
PHCA:scaffold_30 PHYCAscaffold_30                                     35.0       3.3   
SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_di...  35.0       3.3   
ALLA:FR824109 dna:supercontig supercontig:ENA1:FR824109:1:99844:1...  35.0       3.4   
APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_a...  35.0       3.5   
SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154...  35.0       3.5   
PYAP:scaffold_926 pag1_scaffold_926 dna:supercontig supercontig:p...  34.7       3.5   
PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:pa...  34.7       3.6   
HYAP:scaffold_138 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  34.7       3.6   
HYAP:scaffold_103 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  34.7       3.7   
PYAP:scaffold_811 pag1_scaffold_811 dna:supercontig supercontig:p...  34.7       3.7   
HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  34.7       3.8   
PHSO:scaffold_5                                                       34.7       4.0   
PHSO:scaffold_6                                                       34.7       4.1   
PYIR:scaffold_94 pir_scaffold_94 dna:supercontig supercontig:pir_...  34.7       4.2   
PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 gen...  34.7       4.2   
PYVX:scaffold_722 pve_scaffold_722 dna:supercontig supercontig:pv...  34.7       4.3   
APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_a...  34.7       4.3   
PHKE:scaffold_223 scf_22126_223.1 dna:supercontig supercontig:Phy...  34.7       4.3   
PLHA:NW_020187139.1 Plasmopara halstedii genome assembly, contig:...  34.3       4.6   
PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:p...  34.3       4.6   
ALLA:FR824197 dna:supercontig supercontig:ENA1:FR824197:1:60032:1...  34.3       4.8   
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  34.3       5.0   
PHKE:scaffold_255 scf_22126_255.1 dna:supercontig supercontig:Phy...  34.3       5.1   
PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:pi...  34.3       5.1   
PHPA:scaffold_23 NW_008649009.1 Phytophthora parasitica INRA-310 ...  34.3       5.2   
PYAR:scaffold_7164 par_scaffold_7164 dna:supercontig supercontig:...  33.9       5.3   
PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 ge...  34.3       5.8   
APIN:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_i...  34.3       5.9   
PYAP:scaffold_292 pag1_scaffold_292 dna:supercontig supercontig:p...  33.9       6.1   
SAPA:scaffold_4 supercont2.4 dna:supercontig supercontig:ASM15154...  33.9       6.1   
PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_...  33.9       6.2   
ALLA:FR824049 dna:supercontig supercontig:ENA1:FR824049:1:277804:...  33.9       6.3   
PHIF:NW_003303741.1 Phytophthora infestans T30-4 supercont1.18 ge...  33.9       6.3   
PYIR:scaffold_1853 pir_scaffold_1853 dna:supercontig supercontig:...  33.9       6.9   
PHPA:scaffold_16 NW_008649002.1 Phytophthora parasitica INRA-310 ...  33.9       6.9   
SAPA:scaffold_1 supercont2.1 dna:supercontig supercontig:ASM15154...  33.9       7.1   
PLHA:NW_020187532.1 Plasmopara halstedii genome assembly, contig:...  33.9       7.3   
PHCA:scaffold_90 PHYCAscaffold_90                                     33.5       8.0   
PHKE:scaffold_26 scf_22126_26.1 dna:supercontig supercontig:PhyKe...  33.5       8.1   
PHIF:NW_003303752.1 Phytophthora infestans T30-4 supercont1.7 gen...  33.5       8.3   
HYAP:scaffold_12 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1...  33.5       8.3   
PHRA:scaffold_67                                                      33.5       8.5   
HYAP:scaffold_77 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  33.5       8.6   
SADI:scaffold_37 supercont1.37 dna:supercontig supercontig:Sap_di...  33.5       8.6   
HYAP:scaffold_396 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  33.5       8.9   
PLHA:NW_020187331.1 Plasmopara halstedii genome assembly, contig:...  33.5       9.0   
PHPA:scaffold_135 NW_008649121.1 Phytophthora parasitica INRA-310...  33.5       9.3   
PHRA:scaffold_154                                                     33.5       9.4   
PHKE:scaffold_368 scf_22126_368.1 dna:supercontig supercontig:Phy...  33.5       9.6   
PHIF:NW_003303746.1 Phytophthora infestans T30-4 supercont1.13 ge...  33.5       9.6   
PYAP:scaffold_107 pag1_scaffold_107 dna:supercontig supercontig:p...  33.5       9.8   
PHRA:scaffold_141                                                     33.5       9.8   

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/345 (100%), Positives = 345/345 (100%), Gaps = 0/345 (0%)
 Frame = +1

Query  1        MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
                MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC
Sbjct  1844377  MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  1844556

Query  61       HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT
Sbjct  1844557  HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  1844736

Query  121      DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
                DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS
Sbjct  1844737  DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  1844916

Query  181      KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
                KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP
Sbjct  1844917  KEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  1845096

Query  241      TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE  300
                TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE
Sbjct  1845097  TLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE  1845276

Query  301      LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
                LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF
Sbjct  1845277  LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  1845411

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 19/117 (16%)
 Frame = +1

Query  19       QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
                +P +C GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  1586848  EPVACAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGK---PLAEVLVED  1587012

Query  79       IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
                ++  E           PFGF  V +      V   V+ +   +R KW+  A N + A
Sbjct  1587013  VQKWE---------GEPFGFMFVTNEQ----VPYYVYADNDRERTKWMN-ALNKINA  1587141

 Score = 41.6 bits (96),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 48/126 (38%), Gaps = 34/126 (27%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+    E ++  +   G  T+ K           
Sbjct  1586275  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYFSSEEKSKKY---GAVTVEK-----------  1586412

Query  83       EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                   +         F F      P        V+  ++ +R+KWL           +V+C 
Sbjct  1586413  ---VATWSGESHGFMFYTSKQIPYY------VYASSEAERSKWLRALKDFMVETEDVSCE  1586565

Query  132      ALKAKR  137
                    KR
Sbjct  1586566  GYLTKR  1586583

 Score = 41.2 bits (95),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
                SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  1586557  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYTDQQAYRDNQSA  1586685

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (43%), Gaps = 32/115 (28%)
 Frame = +2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
                P +  G+V K G   +SW+ RFLV  G+ L  AYY++                    ++ 
Sbjct  1063460  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN--------------------TDE  1063573

Query  80       EPHEYVIGVMGAA------DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                E H  ++G + AA      D   G  + G   R    +L +F +T+ + N+  E 
Sbjct  1063574  ENHAQLLGALTAAHIERLPDITNGLLIHGTEGR----QLKIFTDTKQECNRCFEA  1063726

 Score = 33.5 bits (75),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 2/35 (6%)
 Frame = +2

Query  23       CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                C G++ K G   KSW+ R+  L GS L  +YY+S+
Sbjct  1060886  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSK  1060984

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 553 bits (1425),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 284/351 (81%), Positives = 306/351 (87%), Gaps = 6/351 (2%)
 Frame = -1

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               MNILR+PE G TASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  251923  MNILRVPEHGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  251744

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
               HPP GE + PKGSFYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  251743  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  251564

Query  121     DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
               DRNKWLEVA NAL  KRQLTRQAIDQSVSPNKK LFGFSV  S QP MSPQKQMQTLA S
Sbjct  251563  DRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKS  251384

Query  181     KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
               K+ LL EALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  251383  KDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSP  251204

Query  241     TLHFFSDDTRPKVPLGDHP------HHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
               TLH FSDD+RPK   G         H SG +SPSRL PA + + DAG SDL+RLAQALGE
Sbjct  251203  TLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGGSDLERLAQALGE  251024

Query  295     LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
               LEVQAE+LN E+ HSSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  251023  LEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  250871

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 549 bits (1415),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 282/351 (80%), Positives = 308/351 (88%), Gaps = 6/351 (2%)
 Frame = -2

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLV+DGSNLQV+YYESRAAC
Sbjct  431957  MNILRVPEHGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAAC  431778

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
               HPP G+ + PKG FYLS+IEPHEYV+GVMGAAD+PFGFKMVGHAP+KG+VELDVFV+T  
Sbjct  431777  HPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLA  431598

Query  121     DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
               DRNKWLEVA NAL AKRQLTRQAIDQSVSP KK LFGFSV  S QP MSPQKQ+QTL+ S
Sbjct  431597  DRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKS  431418

Query  181     KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
               K+ LL +ALRE+EAAKLVGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  431417  KDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  431238

Query  241     TLHFFSDDTRPKVPLG------DHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
               TLH FSDD+RPK             H SG +SP+RL PA+EI+ DAGVSDL+RLAQALGE
Sbjct  431237  TLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGE  431058

Query  295     LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
               LEVQAELLN E+G SSQQIERIEHHL++VT RVEKQTKQA ATLSAGPRLF
Sbjct  431057  LEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  430905

>PHSO:scaffold_1
Length=13391543

 Score = 537 bits (1383),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 274/348 (79%), Positives = 298/348 (86%), Gaps = 3/348 (1%)
 Frame = -3

Query  1        MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
                MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNL V+YYESRAAC
Sbjct  2800809  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAAC  2800630

Query  61       HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                HPP GE + PKGSFYLS+IEPHEYV+GVMGAA++PFGFKMVGHAPRKG+VELDVFVET  
Sbjct  2800629  HPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLN  2800450

Query  121      DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
                DRNKWLEVA NAL AKRQLTRQAIDQSVSPN+K LFGF++  S QP MSPQKQMQTL  S
Sbjct  2800449  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKS  2800270

Query  181      KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
                ++ LL +ALR+IEAAK VGREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  2800269  RDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  2800090

Query  241      TLHFFSDDTRPKVPL--GDHPHHS-GSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEV  297
                TLH FSDD+RPK        P  S  S  P RL PA++   DAGVSDL+RLAQALGELEV
Sbjct  2800089  TLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEV  2799910

Query  298      QAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
                QAELLN E+G  +QQIERIEH LS+VT RVEKQTKQA A L +GPRLF
Sbjct  2799909  QAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  2799766

 Score = 42.0 bits (97),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 70/152 (46%), Gaps = 23/152 (15%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  5553311  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  5553150

Query  83       EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                      +  AD+ + F++      KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  5553149  ------IRLADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVAPP  5553015

Query  143      AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
                  +  ++  ++K    +V      +    KQ+
Sbjct  5553014  CYEMDLTATEEKAGSNAVTRHLNKIFITDKQI  5552919

 Score = 40.4 bits (93),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
                EGYVTKRGH  ++W++RF  L+G+ +   +
Sbjct  4067582  EGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  4067493

 Score = 40.0 bits (92),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21        TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                 T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  10838671  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  10838775

>PHRA:scaffold_56
Length=334739

 Score = 533 bits (1373),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 274/349 (79%), Positives = 301/349 (86%), Gaps = 4/349 (1%)
 Frame = +1

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVL+GSNLQ++YYESRAAC
Sbjct  150211  MNILRVPEIGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAAC  150390

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
               HPP  E + PKGSFYLS+IEPHEYV+GVMGAA +PFGFKM+GHAP+KG+VELDVFVETQ 
Sbjct  150391  HPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQG  150570

Query  121     DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
               DRNKWLEVA NAL AKRQLTRQAIDQSVS NKK LFGF V  S QP+M+PQKQMQTL  +
Sbjct  150571  DRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQN  150750

Query  181     KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
               K+ LL  ALR+IEAAKLVGREACNEIV QGEKLD IEQDL AIDRDLDFGDKLL RLKSP
Sbjct  150751  KDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSP  150930

Query  241     TLHFFSDDTRPK--VPLGDHPHHSGST--SPSRLIPAIEITRDAGVSDLQRLAQALGELE  296
               TLH FSDD+RPK     G  P  S  +  SPSRL PA+E   DAGVSDL+RLAQALGELE
Sbjct  150931  TLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELE  151110

Query  297     VQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
               VQAE+LN E+G S+QQIER+EH LS+VT RVEKQTKQA ATL AGP+LF
Sbjct  151111  VQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  151257

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 530 bits (1364),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 271/351 (77%), Positives = 296/351 (84%), Gaps = 6/351 (2%)
 Frame = -2

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               MNILR+PE GA  SGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV YYESRAAC
Sbjct  101319  MNILRVPEVGAATSGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAAC  101140

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
               HP  GE++ PKGSFYLS+IEPHEYV+GVMGAA +PFGFKMVGHAP+KG+VELDVFVET  
Sbjct  101139  HPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVG  100960

Query  121     DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
               DRNKWLEVA NAL AKRQLTRQAIDQSVSPNKK LFGFSV  S QP +SPQKQMQTL  +
Sbjct  100959  DRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKN  100780

Query  181     KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
               K+ LL +ALR+IEAAK +GREACNEIV QGEKLD IEQDLSAIDRDLDFGDKLL RLKSP
Sbjct  100779  KDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSP  100600

Query  241     TLHFFSDDTRPKVPLGDHPH------HSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
               TLH FS+D+RPK       +       SG +SP+RL  A E   D G SDL+RLAQALGE
Sbjct  100599  TLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGE  100420

Query  295     LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
               LE+QAELLN E+GHS+QQI+ IEHHLS VT RVEKQTKQA ATL AGPRLF
Sbjct  100419  LELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  100267

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 498 bits (1281),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 258/351 (74%), Positives = 290/351 (83%), Gaps = 6/351 (2%)
 Frame = -1

Query  1      MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
              MNILR+PE GATASGDKA+PTSCEGYVTKRGHFRKSWRVRFLVLDGS+LQV+Y+ESR AC
Sbjct  68197  MNILRVPEVGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSDLQVSYFESRTAC  68018

Query  61     HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
              HPP+GE+   KGSFYLSNI PHEYV+GVMGAAD+PFGFKMVGHAPRKG+VELDVFVET +
Sbjct  68017  HPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLS  67838

Query  121    DRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATS  180
              DRNKWLEVA NAL AKRQ+ RQAIDQSVSP KK +FGF +  S QP++ PQKQ+Q L  +
Sbjct  67837  DRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHN  67658

Query  181    KEGlllealreieaaklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSP  240
              KE LL EALRE+EAAK+VGREACNEIV QGEKLD +E DL AIDRDLDFGDKLL RLK+P
Sbjct  67657  KEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNP  67478

Query  241    TLHFFSDDTRPKVPLGDH------PHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGE  294
              TLH FSDDTRPK     +       H S  ++P  L  ++    DA  SDL+RLA ALGE
Sbjct  67477  TLHLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGE  67298

Query  295    LEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
              LE+QAELLN E+G S+QQI RIE  LS+VT RVEKQTKQA ATLSAGPRLF
Sbjct  67297  LELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAGPRLF  67145

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 225 bits (573),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 156/220 (71%), Gaps = 22/220 (10%)
 Frame = -1

Query  1      MNILRLPEPGATA----------SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
              MNILRLP  GAT+               +PTSCEGYVTKRGHFRKSWRVRFLVL+G++L 
Sbjct  20697  MNILRLPL-GATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLL  20521

Query  51     VAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV  110
              V+YY+S+           +PKGSFYLS++E HEY +GV+GA ++PFGFKMVGHAPRKG+V
Sbjct  20520  VSYYDSKEVARTAGA---VPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYV  20350

Query  111    ELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSP  170
              ELD+FVET  D NKWLEV  NAL A ++LTR    ++++P  K LFGFS      P  SP
Sbjct  20349  ELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAP--KSLFGFS------PATSP  20194

Query  171    QKQMQTLATSKEGlllealreieaaklVGREACNEIVNQG  210
              Q+QM+ +  +KE +L +A+ EIE+AKL+GR AC EI  QG
Sbjct  20193  QQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQG  20074

 Score = 95.9 bits (237),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 21/144 (15%)
 Frame = -2

Query  211    EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPS-R  269
              E+LD I Q+L+ ++ DLD+ DKLL  +K+P LH FS D R      D   ++G T PS R
Sbjct  20015  ERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDAR------DRAKNTGRTKPSSR  19854

Query  270    LIPAI--EITR------------DAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIER  315
                P+   E TR             A +SD++RLA  LGELE QA LLN E+   + Q+ER
Sbjct  19853  DTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVER  19674

Query  316    IEHHLSHVTERVEKQTKQAVATLS  339
              +   L+HV ERV+ QT++A A+++
Sbjct  19673  VGEQLAHVNERVKAQTRKANASIA  19602

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 200 bits (508),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 116/145 (80%), Gaps = 4/145 (3%)
 Frame = -1

Query  1        MNILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
                MNILR+P+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQV+Y+ESR A
Sbjct  1308343  MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  1308164

Query  60       CHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQ  119
                 H P    T+PKGSFY+S++E HEY IGVMG  ++PFGFK+VGHAP KG++ELD+FVE+ 
Sbjct  1308163  AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  1307993

Query  120      TDRNKWLEVACNALKAKRQLTRQAI  144
                 D NKWLEV  NAL A ++LTR+ +
Sbjct  1307992  PDVNKWLEVVQNALDAAKKLTRKGM  1307918

 Score = 119 bits (298),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 123/223 (55%), Gaps = 40/223 (18%)
 Frame = -3

Query  153      KKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQG--  210
                K +FGF         +SPQ Q++ LA +KE LL EALREIE AKL+GREA NEIV+QG  
Sbjct  1307822  KSMFGFGAS------ISPQLQVKKLAATKEELLREALREIEGAKLIGREAVNEIVSQGGT  1307661

Query  211      ----------------------EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDD  248
                                      EKLD +E DL  ++ DLD  DKLL  LKSP LH FS+D
Sbjct  1307660  SSFHNQLSASAKTKLLVSIGAVEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSND  1307481

Query  249      TRPKVPLGDHPHHSGSTSPSRLIPAI---------EITRDAG-VSDLQRLAQALGELEVQ  298
                 R K         S S   S     +         +IT   G ++DL+ LA AL ELE Q
Sbjct  1307480  NRQKKGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQ  1307301

Query  299      AELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAG  341
                A L+N+E+  S++QI RIE  L+ V +RV+ QTK+A AT+ AG
Sbjct  1307300  ANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  1307172

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 175/236 (74%), Gaps = 14/236 (6%)
 Frame = +2

Query  19    QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
             +PTSCEGYVTKRGHFRKSWRVR+LVLDG++L+VAY+ES+ A    NG ++  KG FYLS+
Sbjct  1547  RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ--NGAAS--KGEFYLSS  1714

Query  79    IEPHEYVIGVMGAA---DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
             I+ H YV G MGA    ++PFGFKMVGHAP+KG+ ELD+FVET  D  KWLEVA NAL++
Sbjct  1715  IDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  1894

Query  136   KRQLTRQAI-DQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreiea  194
                ++R+A  D   S   K LFGFS  +      SPQ+Q++ ++ SK+ LL +ALRE+E 
Sbjct  1895  AAAMSRKAAGDGGGSATTKSLFGFSTTT------SPQQQLKAMSVSKDELLKDALRELEG  2056

Query  195   aklVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTR  250
             AKL+GREAC E+V QGEKLD IE +L  I+ DLD+GDKLL RLKSP LH  + D R
Sbjct  2057  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR  2224

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  293   GELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345
             GELE QA LLN E+  S+QQI RIE  L+ V +RV++QTKQA + +  G  +F
Sbjct  2415  GELEAQATLLNGEAVRSTQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  2573

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 189 bits (480),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 132/178 (74%), Gaps = 11/178 (6%)
 Frame = +1

Query  33     FRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAA  92
              FRKSWRVR+LVL+G++L V+Y++S+     P      PKGSFYLS++E HEYV+GV+GA 
Sbjct  16051  FRKSWRVRYLVLNGADLCVSYFDSKDVARTPGAS---PKGSFYLSSVEKHEYVVGVLGAQ  16221

Query  93     DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNK  152
               +PFGFKMVGHAPRKG+VELD+FVE++ D  KWLEV  +AL A ++LTR  +  + S   
Sbjct  16222  KKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAAS--T  16395

Query  153    KKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQG  210
              K LFGFS      P  SPQKQ+Q L+ SKE LL +A+ EIE+AKL+GREAC EIV QG
Sbjct  16396  KSLFGFS------PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQG  16551

 Score = 84.7 bits (208),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 79/134 (59%), Gaps = 11/134 (8%)
 Frame = +3

Query  210    GEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPSR  269
               EKLD IE +L  +D DLD+GDKLL  LKSP L+ FS D R K      P HS   S   
Sbjct  16620  AEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSAS--PAHSPVKSKQS  16793

Query  270    LIPAIE--------ITRDAG-VSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHL  320
               + +          + R +G +SD++RLA  LGELE QA LLN E+   + Q+ER+   L
Sbjct  16794  ALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDAL  16973

Query  321    SHVTERVEKQTKQA  334
              +H+ ERV+ QTK+A
Sbjct  16974  AHINERVQNQTKKA  17015

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 143/319 (45%), Positives = 190/319 (60%), Gaps = 60/319 (19%)
 Frame = -3

Query  70     PKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVA  129
              PKGSF++S++E HEY +GVMG  ++PFGFK+VGHAP+KG++ELD+FVET  D NKW+EV 
Sbjct  11408  PKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVV  11229

Query  130    CNALKAKRQLTRQ--AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGllle  187
               NAL A ++ TR   A D S + N   +FGFS        +SPQ Q++ LA +KE LL +
Sbjct  11228  QNALDAAKKHTRTPGAADSSTTKN---MFGFSA------TVSPQLQVKKLAATKEELLRD  11076

Query  188    alreieaaklVGREACNEIVNQG--------------------------EKLDVIEQDLS  221
              ALREIE AKL+GREA ++I  QG                           KL++IE DL 
Sbjct  11075  ALREIEGAKLIGREAVSDIKGQGGLWS*VAVVCGGYPGSRLITSCW*CPGKLNMIEDDLG  10896

Query  222    AIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTS----------PSRLI  271
               ++ DLD G KLL+ +K P LH FS+D R K     + HHSGS S          PS   
Sbjct  10895  KVESDLDHGGKLLNHMKRPMLHLFSNDNRSK----PNAHHSGSHSDHKDGHSGAHPSSGG  10728

Query  272    PAIEITRDAG---------VSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSH  322
               + E    A          +SDL+RL  ALGELE QA  +N+E+  S++QI R+E  L+ 
Sbjct  10727  SSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTA  10548

Query  323    VTERVEKQTKQAVATLSAG  341
              V +RV+ QTK+A AT+ AG
Sbjct  10547  VNDRVQAQTKKATATMKAG  10491

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 44/57 (77%), Gaps = 4/57 (7%)
 Frame = -2

Query  1      MNILRLPEPGATAS----GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
              MNILR+P+     S    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ AY
Sbjct  11802  MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAY  11632

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 189 bits (481),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 113/151 (75%), Gaps = 10/151 (7%)
 Frame = +1

Query  1       MNILRLPEPGATASG------DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
               MNILR+P+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQVAYY
Sbjct  101374  MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  101553

Query  55      ESRAACHPPNGEST----MPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV  110
               ESR A    +        +PKGSFY+S++E HEY +GVMG  ++PFGFK+VGHAP+KG++
Sbjct  101554  ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  101733

Query  111     ELDVFVETQTDRNKWLEVACNALKAKRQLTR  141
               ELD+FVE+  D NKW+EV  NAL A ++ +R
Sbjct  101734  ELDIFVESLGDLNKWVEVVQNALDAAKKRSR  101826

 Score = 40.0 bits (92),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 55/94 (59%), Gaps = 15/94 (16%)
 Frame = +2

Query  144     IDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREAC  203
               +D S +   K +FGFS  +S      PQ Q++ LA +KE LL +ALREIE AKL+GREA 
Sbjct  101939  VDNSTT---KTMFGFSASAS------PQLQVKKLAATKEDLLRDALREIEGAKLIGREAV  102091

Query  204     NEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRL  237
               NEIV QG  L      L+ I R + +   L+  L
Sbjct  102092  NEIVVQGGAL------LACIIRPIAYCWLLITDL  102175

 Score = 102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 20/147 (14%)
 Frame = +3

Query  211     EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPS--  268
               EKLD++E DL  ++ DLD  DKLL  +K P LH FS D R K      PH  G++  +  
Sbjct  102210  EKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQS----PHTGGASGHTDR  102377

Query  269     --------------RLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIE  314
                                  I   R+  +SDL++LA ALGELE QA L+N+E+  S++QI 
Sbjct  102378  ASHGQTPGTTNGGTAGGQQIHGQRNDALSDLEKLALALGELEEQANLMNAEAVKSTEQIA  102557

Query  315     RIEHHLSHVTERVEKQTKQAVATLSAG  341
               R+E  L+ V +RV+ QTK+A AT+ AG
Sbjct  102558  RVEQRLTAVNDRVQTQTKKANATMKAG  102638

>ALLA:FR824104 dna:supercontig supercontig:ENA1:FR824104:1:105594:1 
REF
Length=105594

 Score = 171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 133/214 (62%), Gaps = 34/214 (16%)
 Frame = +1

Query  20     PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
              PTSCEGYVTKRGHFRKSWRVR+LV+ G N+QV+YYES+ +    N     PKGSF L + 
Sbjct  11308  PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNA---TPKGSFILQSA  11478

Query  80     EPHEYVIGVM---GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
              E HEY I  M      ++PFGFKMVGHAP++G++ELDVFV++ +D ++WL+V  N LKA 
Sbjct  11479  EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  11658

Query  137    RQLTRQAIDQSVSPNK--------------------KKLFGFSVPSSTQPVMSPQKQMQT  176
              + + R+A    ++ NK                    K + GFS   +T      ++Q+Q 
Sbjct  11659  KCMAREAF---MAGNKIFSLLRQ*DLTSFFVEMDTTKSVLGFSYIGTT-----SKQQIQV  11814

Query  177    LATSKEGlllealreieaaklVGREACNEIVNQG  210
              L + K   + EAL++IE AK  G  AC+EIV+QG
Sbjct  11815  LKSKKCDYIHEALQQIEMAKSAGNAACDEIVSQG  11916

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +2

Query  283    SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGP  342
              +D+++LA AL +LEVQA+L+NSE+  S++QI RIE  LS + +R++ QT Q V T S   
Sbjct  12266  NDIEKLAMALKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQ-VITSSGKQ  12442

Query  343    RLF  345
               LF
Sbjct  12443  NLF  12451

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  211    EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFS  246
              E+L  +EQ+LS I  DL+  +KL+  ++ P  +FFS
Sbjct  11967  EQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS  12074

>ALCA:scaffold_90 AcNc2_CONTIG_90_length_79489 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_90_length_79489:1:79489:1 
REF
Length=79489

 Score = 158 bits (399),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 6/131 (5%)
 Frame = +3

Query  17    KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
             +  PTSCEGYVTKRGHFRKSWRVR+LV+ G  +QV+YYES+ +    N     PKGSF L
Sbjct  8580  RYTPTSCEGYVTKRGHFRKSWRVRYLVICGVTMQVSYYESKDSYKNRNAT---PKGSFIL  8750

Query  77    SNIEPHEYVIGVM---GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
              N+E HEY I  M      +RPFGFKMVGHAP++G+VELDVFV++ ++ ++WL+V  N L
Sbjct  8751  QNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQWLDVINNGL  8930

Query  134   KAKRQLTRQAI  144
             KA +++ R+A 
Sbjct  8931  KANKRMAREAF  8963

 Score = 34.3 bits (77),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  211   EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFS  246
             E+L  +EQ+LS I+ DL+  +KL+  ++ P  +FFS
Sbjct  9251  EQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFS  9358

 Score = 25.4 bits (54),  Expect(3) = 1e-42, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 5/60 (8%)
 Frame = +1

Query  153   KKLFGFSVPSSTQPVMSPQKQMQTLATSKEGlllealreieaaklVGREACNEIVNQGEK  212
             K + GFS   +T      ++Q++ L + K   + EAL++IE AK  G  AC+EIV QG K
Sbjct  9040  KGVLGFSFAGTT-----SKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGGK  9204

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%), Gaps = 1/63 (2%)
 Frame = +3

Query  283   SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAGP  342
             +DL++LA AL ELEVQA+L+NSE+  S+ QI RIE  LS + +R++ QT Q VA+ S   
Sbjct  9552  NDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS-SGKK  9728

Query  343   RLF  345
              LF
Sbjct  9729  NLF  9737

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 99/183 (54%), Gaps = 31/183 (17%)
 Frame = -1

Query  17      KAQPTSCEGYVTKRG--------------------HFRKSWRVRFLVLDGSNLQVAYYES  56
               K   TSCEGYVTKRG                    H  KSW+ R++VL+G  L V+YY+S
Sbjct  708409  KIHQTSCEGYVTKRGMLVHAVESSVWANKATTTLGHLMKSWKRRYMVLNGDTLLVSYYDS  708230

Query  57      RAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV  116
               +   +   G    PKGSF LS  E  +  +   GA+ +PFGFK +GH P +G+ E  V+V
Sbjct  708229  KEI-YTSKGH---PKGSFVLSECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYV  708068

Query  117     ETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQT  176
               E+Q D+ KWL VA NAL  K    ++++ Q +    +++ G  +P ++  +  P++ M  
Sbjct  708067  ESQIDQTKWLNVAHNAL-GKNSSPQKSMSQRI----EEITGPLLPCASVQLNCPRRDMIH  707903

Query  177     LAT  179
               + T
Sbjct  707902  ITT  707894

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 103 bits (256),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 8/120 (7%)
 Frame = -2

Query  31      GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMG  90
               GH  KSWR R++VLDG  L+V+YY+S+        +    KGSF L+ IE H+Y     G
Sbjct  394904  GHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIEKHDY--SDEG  394740

Query  91      AADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA-IDQSVS  149
                  +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL   + +T QA +DQ  S
Sbjct  394739  GGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTPQASVDQRAS  394566

 Score = 28.1 bits (61),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
 Frame = -1

Query  21      TSCEGYVTKRG  31
               TSCEGYVTKRG
Sbjct  394983  TSCEGYVTKRG  394951

 Score = 40.4 bits (93),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 42/73 (58%), Gaps = 2/73 (3%)
 Frame = -2

Query  259     PHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEH  318
               P H  S+ P+    A   T DAG  +L +L++ L  LEV A  +++E   +++QI+RI+ 
Sbjct  394067  PTHKKSSGPAS--KAGGATTDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQK  393894

Query  319     HLSHVTERVEKQT  331
                +    ER+ +Q+
Sbjct  393893  KMVEADERIVEQS  393855

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -3

Query  211     EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFF  245
               E LD+ E ++  ++ +LD GD ++ ++ SP  ++F
Sbjct  394306  EMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYF  394202

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 98.6 bits (244),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 5/103 (5%)
 Frame = +2

Query  31      GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMG  90
               GH  KSWR R++VLDG  L+V+Y++S+        +    KGSF L+ IE H+Y     G
Sbjct  204128  GHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAEIEKHDY--SDEG  204292

Query  91      AADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
                  +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL
Sbjct  204293  GGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  204421

 Score = 28.5 bits (62),  Expect(2) = 7e-22, Method: Compositional matrix adjust.
 Identities = 11/11 (100%), Positives = 11/11 (100%), Gaps = 0/11 (0%)
 Frame = +1

Query  21      TSCEGYVTKRG  31
               TSCEGYVTKRG
Sbjct  204049  TSCEGYVTKRG  204081

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 70/155 (45%), Gaps = 29/155 (19%)
 Frame = +1

Query  211     EKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGST----S  266
               E LD+ E ++  +  +LD GD ++ ++ SP  ++FS     K   G     S  +    +
Sbjct  204727  EMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSHLPQT  204906

Query  267     PSRLIPAIEITR-------------------------DAGVSDLQRLAQALGELEVQAEL  301
               P   I A+ + R                         DAG  +L +L++ L  LEV A  
Sbjct  204907  PMATILAMTLLRAHCL*NSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANT  205086

Query  302     LNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336
               +++E   +++QI+RI+  +    ERV +Q+ +  A
Sbjct  205087  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  205191

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 39/77 (51%), Gaps = 10/77 (13%)
 Frame = -2

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH--  82
                G++ K+G   K+W+ RF+VL   +L   Y+E+          +  PKGSF +  IE    
Sbjct  1371042  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT-----PTLKPKGSFQVLAIERASD  1370884

Query  83       -EYVIGVMGAADRPFGF  98
                 ++ +   G+ +R F F
Sbjct  1370883  LQHGLVAKGSGNRVFKF  1370833

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (62%), Gaps = 7/42 (17%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE-----SRAAC  60
                EGY+ K+GH  K+WR R+  L  ++L  AYY+     SRA C
Sbjct  1238308  EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDVRTTSSRAFC  1238189

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 97.4 bits (241),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 72/118 (61%), Gaps = 7/118 (6%)
 Frame = +2

Query  31      GHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMG  90
               GH  K+W+ R++VL G  L VAYY+S+   +  NG    PKGSF LS  E  +  +   G
Sbjct  399722  GHMMKTWKRRYMVLHGDTLLVAYYDSKEI-YKSNGP---PKGSFVLSECEKQD--LSDEG  399883

Query  91      AADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSV  148
                + +PFGFK +GH P +G+ E  VFVETQ D+ KWL VA NAL  K    +++I Q +
Sbjct  399884  GSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNAL-GKTTSPQKSISQRI  400054

 Score = 28.5 bits (62),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +1

Query  17      KAQPTSCEGYVTKRG  31
               K   TSCEGYVTKRG
Sbjct  399631  KIHQTSCEGYVTKRG  399675

 Score = 38.9 bits (89),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 40/79 (51%), Gaps = 4/79 (5%)
 Frame = +2

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               M++L L     ++  +K   TSC GY+ KRG    + + R+++L  + L   YY++    
Sbjct  941441  MDVLVLDTTNTSSQNNKR--TSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKTNPEL  941608

Query  61      HPPNGESTMPKGSFYLSNI  79
               +        P+GS +L N+
Sbjct  941609  NKGWFGKEKPRGSLHLGNV  941665

>PYAR:scaffold_2744 par_scaffold_2744 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2744:1:4396:1 
REF
Length=4396

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 60/122 (49%), Gaps = 22/122 (18%)
 Frame = +2

Query  13    ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
             A+ +  +P +C GY+TK+GH RKSW+ R+ VL GS+  V+YY      + P G+   P  
Sbjct  3635  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGK---PLA  3799

Query  73    SFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
                + +++  +           PFGF  +        +   V+ + + +R KW+    NA
Sbjct  3800  EVVIEDVQRWD---------GEPFGFMFMTSEQ----IPYYVYADNERERTKWM----NA  3928

Query  133   LK  134
             L+
Sbjct  3929  LR  3934

 Score = 40.4 bits (93),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +2

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
             CEG++TKRGH   +W++R+ VL G+ L+
Sbjct  3080  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  3163

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 29/43 (67%), Gaps = 5/43 (12%)
 Frame = +2

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
             +CEGY+T+RGH   S R  + VL+G++L     Q AY ++++A
Sbjct  3362  TCEGYLTRRGHLVPSQRHAYYVLNGTSLRHYADQQAYRDNQSA  3490

>HYAP:scaffold_84 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_84:1:283758:1 
REF
Length=283758

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 56/117 (48%), Gaps = 19/117 (16%)
 Frame = -2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               +P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G    P     + +
Sbjct  273452  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGR---PLAEVLVED  273288

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
               ++  +           PFGF  + +      V   V+ +   +RNKW+  A N L A
Sbjct  273287  VQSWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERNKWMN-ALNKLNA  273159

 Score = 42.7 bits (99),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 49/126 (39%), Gaps = 34/126 (27%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               CEGY+TKRGH   +W+ R+  L G+ L+    E ++  +   G  T+ K           
Sbjct  274025  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSGEEKSKKY---GAVTVEK-----------  273888

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                  +         F F      P        V+  ++++R++WL           EV+C 
Sbjct  273887  ---VATWSGEAHGFMFYTTKQIP------YYVYASSESERSRWLRALKDFMVETEEVSCE  273735

Query  132     ALKAKR  137
                   KR
Sbjct  273734  GYLTKR  273717

 Score = 42.7 bits (99),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
               SCEGY+TKRGH   S R+ + VL+G++L     Q AY E+++A
Sbjct  273743  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  273615

>PHRA:scaffold_130
Length=94934

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 19/116 (16%)
 Frame = +2

Query  19     QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  64796  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGK---PLAEVLVED  64960

Query  79     IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              ++  +           PFGF  + +      V   V+ +   +RNKW+  A N L 
Sbjct  64961  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERNKWMN-ALNKLN  65086

 Score = 42.7 bits (99),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 51/126 (40%), Gaps = 34/126 (27%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  64223  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  64372

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                     G A   F F      P        V+  ++ +R++WL           +V+C 
Sbjct  64373  S------GEA-HGFMFYTTKQIPYY------VYASSEGERSRWLRALKEFMVETEDVSCE  64513

Query  132    ALKAKR  137
                  KR
Sbjct  64514  GYLTKR  64531

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = +2

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  64505  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  64633

>PYIR:scaffold_755 pir_scaffold_755 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_755:1:16342:1 
REF
Length=16342

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (48%), Gaps = 26/136 (19%)
 Frame = -3

Query  19    QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
             +P SC GY+TK+GH RKSW+ R+ +L G NL +AYY      +   G +        L+ 
Sbjct  8822  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRA--------LAE  8673

Query  79    IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
             +     V  V      PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  8672  VT----VEDVQKWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  8538

Query  139   LTRQAIDQSVSPNKKK  154
             LT  A ++  S  KK+
Sbjct  8537  LTTVA-EEPTSLEKKR  8493

 Score = 42.0 bits (97),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 51/126 (40%), Gaps = 34/126 (27%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
             CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  9395  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFAGEDKGKRY----------GSVTVAKVAPW  9246

Query  83    EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                    G A   F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  9245  S------GEA-HGFMFYTTKQIPYY------VYAASEAERSKWLRALKEFVVEPEEVSCE  9105

Query  132   ALKAKR  137
                 +R
Sbjct  9104  GYLTRR  9087

 Score = 40.4 bits (93),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = -3

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
             SCEGY+T+RGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  9113  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  8985

>PHSO:scaffold_8
Length=3549547

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 19/117 (16%)
 Frame = +1

Query  19       QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
                +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  2527708  EPVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGK---PLAEVLVED  2527872

Query  79       IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
                ++  +           PFGF  +        V   V+ +   +RNKW+  A N L A
Sbjct  2527873  VQKWD---------GEPFGFMFMTTEQ----VPYYVYADNDRERNKWMN-ALNKLNA  2528001

 Score = 42.7 bits (99),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 35/126 (28%), Positives = 52/126 (41%), Gaps = 34/126 (27%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +      
Sbjct  2527135  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTV------  2527266

Query  83       EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                E V    G A   F F      P        V+  ++++R++WL           EV+C 
Sbjct  2527267  EKVATWSGEA-HGFMFYTTKQIP------YYVYASSESERSRWLRVLKEYMVETEEVSCE  2527425

Query  132      ALKAKR  137
                    KR
Sbjct  2527426  GYLTKR  2527443

 Score = 40.0 bits (92),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  22       SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
                SCEGY+TKRGH   S R+ + VL+G++L+
Sbjct  2527417  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  2527503

>PYIW:scaffold_452 piw_scaffold_452 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_452:1:18197:1 
REF
Length=18197

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 63/130 (48%), Gaps = 25/130 (19%)
 Frame = -3

Query  19    QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
             +P SC GY+TK+GH RKSW+ R+ +L G NL +AY+      +   G+   P     + +
Sbjct  1662  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGK---PLAEVTVED  1498

Query  79    IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
             ++  +           PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  1497  VQKWD---------GEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  1378

Query  139   LTRQAIDQSV  148
             LT  A + +V
Sbjct  1377  LTTVAEEPTV  1348

 Score = 42.4 bits (98),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 50/126 (40%), Gaps = 34/126 (27%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
             CEG++TKRGH   +W+ R+ VL G+ L+    E +   +          GS  ++ + P 
Sbjct  2235  CEGFLTKRGHVFTTWKTRYFVLRGNVLEYFSGEDKGKRY----------GSVTVAKVAPW  2086

Query  83    EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                    G A   F F      P        V+  ++ +R+KWL           EV C 
Sbjct  2085  S------GEA-HGFMFYTTKQVP------YYVYASSEAERSKWLRALKEFVVEPEEVGCE  1945

Query  132   ALKAKR  137
                 +R
Sbjct  1944  GYLTRR  1927

 Score = 40.4 bits (93),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 29/42 (69%), Gaps = 5/42 (12%)
 Frame = -3

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
             CEGY+T+RGH   S R+ + VL+G++L     Q AY E+++A
Sbjct  1950  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  1825

>PHKE:scaffold_262 scf_22126_262.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_262.1:1:50665:1 
REF
Length=50665

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 19/116 (16%)
 Frame = +3

Query  19     QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              +P +C GY+TK+GH RKSW+ R+ +L GS   ++YY      +   G++        L+ 
Sbjct  15981  EPVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKA--------LAE  16130

Query  79     IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              +     V  V      PFGF  +        V   V+ +   +RNKW+  A N L 
Sbjct  16131  V----LVEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWMN-ALNKLN  16271

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 51/126 (40%), Gaps = 34/126 (27%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +      
Sbjct  15408  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVMV------  15539

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
              E V    G A   F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  15540  EKVATWSGEA-HGFMFYTTKQIPYY------VYASSEAERSKWLRALKEFMVETEEVSCE  15698

Query  132    ALKAKR  137
                  KR
Sbjct  15699  GYLTKR  15716

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = +3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  15690  SCEGYLTKRGHLVPSQRMAYYVLNGASLRHYADQQAYRDNQSA  15818

>PYVX:scaffold_518 pve_scaffold_518 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_518:1:21302:1 
REF
Length=21302

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 27/136 (20%)
 Frame = +1

Query  19    QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
             +P +C GY+TK+GH RKSW+ R+ +L G++  ++Y+      +   G++        L+ 
Sbjct  5200  EPVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKA--------LAE  5349

Query  79    IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
             +     V  V      PFGF  +        V   V+ +   +RNKW+    NAL   R+
Sbjct  5350  VT----VEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNDRERNKWM----NAL---RK  5484

Query  139   LTRQAIDQSVSPNKKK  154
             L   A+D+     KK+
Sbjct  5485  L--NAVDEEPEAEKKR  5526

 Score = 40.8 bits (94),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
             CEGY+TKRGH   +W+ R+  L G+ L+  Y+ S
Sbjct  4624  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  4719

 Score = 40.4 bits (93),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 5/43 (12%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
             SCEGY+TKRGH   S R+ + VL G+ L     Q AY E+++A
Sbjct  4909  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  5037

>APAS:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.13:1:1183921:1 
REF
Length=1183921

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 55/115 (48%), Gaps = 20/115 (17%)
 Frame = -2

Query  13      ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
               A+    QP +C G++TK+GH RKSW+ R+ VL G+ L  AYY    A +  +G+   P G
Sbjct  859839  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGK---PLG  859675

Query  73      SFYLSNIEPHEYVIGVMGAAD-RPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
                         E  +  + A D  P GF  + +      V   VF +   D+ KWL
Sbjct  859674  ----------EVTVREVSAWDGEPSGFMFITNDS----VPYYVFADNDRDQAKWL  859552

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -3

Query  15      GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
               G   QP +C GY+TK+GH RKSW+ R+ VL GS L  +YY
Sbjct  855170  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY  855057

 Score = 40.8 bits (94),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 13/64 (20%)
 Frame = -1

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
               C GY+TKRGH   +W++R+ VL   +  ++YYE          + +M K  G  +L+ + 
Sbjct  855844  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYE----------DESMAKKLGQVHLAKVA  855698

Query  81      PHEY  84
               P EY
Sbjct  855697  PWEY  855686

 Score = 38.1 bits (87),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 51/120 (43%), Gaps = 28/120 (23%)
 Frame = -3

Query  13      ASGDKAQPTS--CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMP  70
               AS D + P+     GY+TKRGH   +W+ RF VL     +++YY           +  M 
Sbjct  860504  ASMDSSAPSGILASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYY----------ADEGMK  860358

Query  71      K--GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
               K  G  +L  + P        G A+   GF    +      +   V+  T ++R +WL+ 
Sbjct  860357  KKLGEVHLEKVSPWS------GEAN---GFMFYTNKQ----IAYYVYASTNSERRRWLDA  860217

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = -2

Query  26      YVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               Y+TKRGH   S+R+R+ VL GS ++  YY    A
Sbjct  860103  YLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  860008

>PYUU:scaffold_2007 scf1117875582007 dna:supercontig supercontig:pug:scf1117875582007:1:931704:1 
REF
Length=931704

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = -2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               +P SC GY+TK+GH RKSW+ R+ +L G NL ++YY      +   G+   P     + +
Sbjct  687698  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGK---PLAEVAVED  687534

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
               ++  +           PFGF  +        V   V+ +   +RNKW+  
Sbjct  687533  VQKWD---------GEPFGFMFMTSEQ----VPYYVYADNDRERNKWMNA  687423

 Score = 41.2 bits (95),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 48/126 (38%), Gaps = 34/126 (27%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               CEG++TKRGH   +W+ R+ VL G  L+  Y+           E     GS  ++ + P 
Sbjct  688271  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGE--------EKNKKYGSVTVAKVAP-  688125

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                            F F      P        V+  ++ +R+KWL           EV+C 
Sbjct  688124  ------WSGEAHGFMFYTTKQIP------YYVYAASEAERSKWLRALKEFVVEPEEVSCE  687981

Query  132     ALKAKR  137
                   +R
Sbjct  687980  GYLTRR  687963

 Score = 40.4 bits (93),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
               SCEGY+T+RGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  687989  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA  687861

>PHCA:scaffold_13 PHYCAscaffold_13
Length=1060349

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 55/119 (46%), Gaps = 18/119 (15%)
 Frame = +3

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               +P SC GY+TK+GH RKSW+ R+ +L G    ++YY      +   G+   P     + +
Sbjct  342162  EPVSCAGYLTKQGHKRKSWKKRYFILRGHT--ISYYSDYDMANNAKGK---PLAEVMVED  342326

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKR  137
               ++  +           PFGF  + +      V   V+ +   +R+KW+      ++ +R
Sbjct  342327  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERSKWMNALNKLMQWRR  342464

 Score = 42.0 bits (97),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 2/34 (6%)
 Frame = +3

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
               CEGY+TKRGH   +W+ R+  L G+ L+  YY S
Sbjct  341589  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSS  341684

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
               SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  341871  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  341999

>SAPA:scaffold_20 supercont2.20 dna:supercontig supercontig:ASM15154v2:supercont2.20:1:492046:1 
REF
Length=492046

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 48/108 (44%), Gaps = 21/108 (19%)
 Frame = +1

Query  19     QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              +P SC GY+TK+GH RKSW+ R+ VL G  L  AYY             +M K S     
Sbjct  71671  KPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYAD---------YDSMNKQSLAEVG  71817

Query  79     IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
              +E      G        FGF+ +        V   VF E+  +R KW+
Sbjct  71818  VEDVALWDG------EQFGFQFITTEQ----VPYYVFAESDRERQKWM  71931

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (47%), Gaps = 22/137 (16%)
 Frame = +3

Query  17     KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
              K  P +C G++TK+GH RKSW+ R+ VL G+ L  +YY    A +   G++        L
Sbjct  67059  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANTRAGKA--------L  67208

Query  77     SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAK  136
              S++   +  +G        F F  + + P        VF + + D+ KW+     A+ A 
Sbjct  67209  SDVSLKD--VGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGAD  67364

Query  137    RQLTRQAIDQSVSPNKK  153
                L  + ID+   P KK
Sbjct  67365  -TLAIETIDE---PEKK  67403

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 62/152 (41%), Gaps = 31/152 (20%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
              C GY+TKRGH   +W+ RF VL    + + YY           + +M K  G  +L  + 
Sbjct  70994  CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY----------ADESMAKKLGQVHLVKVA  71140

Query  81     PHEYVIGVM---------GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
              P EYV             G+ +  FGF M     R   V   V+     +R KWL     
Sbjct  71141  PWEYVSATTANSILKSTRGSDEMKFGF-MFFTTKR---VAYYVYANVNAERQKWLL----  71296

Query  132    ALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSS  163
              AL+    +T  A D      K+   GFS  SS
Sbjct  71297  ALQDLYVVTSNATDCEGYLTKRTP-GFSFLSS  71389

 Score = 37.7 bits (86),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 43/106 (41%), Gaps = 24/106 (23%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK-GSFYLSNIEPH  82
               GY+TKRGH   +W+ RF  L  S  +++YY         N E    K G  ++S + P 
Sbjct  66433  SGYLTKRGHVITNWKTRFFALR-SQGRLSYY---------NDEGMGKKLGEVHVSKVSPW  66582

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                           F F+          +   V+  + T+R +WL+ 
Sbjct  66583  S-------GETNGFMFQTTKQ------ISYYVYASSNTERARWLQA  66681

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 30/69 (43%), Gaps = 20/69 (29%)
 Frame = +3

Query  9      PGATASGDKAQPTSCEGY------------------VTKRGHFRKSWRVRFLVLDGSNLQ  50
              PGA      A+P  CEGY                  +TKRGH   S+R+R+ V+ GS   
Sbjct  66675  PGARRLLHCARPVDCEGYTAPSTTHPPHYSCTSSRYLTKRGHLVPSYRLRYFVMCGS--V  66848

Query  51     VAYYESRAA  59
              V YY    A
Sbjct  66849  VKYYSDETA  66875

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 18/108 (17%)
 Frame = -3

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               QP +C G++TK+GH RKSW+ R+ VL G+ L  AYY    A    N   + P G   +  
Sbjct  794850  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDAS---NMRHSRPLGEVTVRE  794686

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
               +   +           P GF  V +      V   VF + + D+ KWL
Sbjct  794685  VSTWD---------GEPGGFMFVTN----DNVPYYVFADNERDQAKWL  794581

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -2

Query  15      GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
               G   QP +C GY+TK+GH RKSW+ R+ VL G+ L  +YY
Sbjct  790123  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY  790010

 Score = 42.4 bits (98),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 13/64 (20%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIE  80
               C GY+TKRGH   +W++RF VL   +  ++YYE          + +M K  G  +L+ + 
Sbjct  790792  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYE----------DESMSKKLGQVHLAKVA  790646

Query  81      PHEY  84
               P EY
Sbjct  790645  PWEY  790634

 Score = 37.0 bits (84),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 44/106 (42%), Gaps = 26/106 (25%)
 Frame = -3

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK--GSFYLSNIEPH  82
               GY+TKRGH   +W+ RF VL     +++YY           +  M K  G  +L  + P 
Sbjct  795474  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYY----------ADEGMKKKLGEVHLEKVSPW  795328

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                      G A+   GF           +   V+  T ++R +WLE 
Sbjct  795327  S------GEAN---GFMFYTSKQ----IAYYVYASTNSERRRWLEA  795229

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  26      YVTKRGHFRKSWRVRFLVLDGSNLQ  50
               Y+TKRGH   S+R+R+ VL G++++
Sbjct  795132  YLTKRGHLVPSYRMRYFVLSGASMK  795058

>PHPA:scaffold_89 NW_008649075.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.89, whole genome shotgun 
sequence
Length=179567

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 18/110 (16%)
 Frame = +2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  100571  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGK---PLAEVLVED  100735

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
               ++  +           PFGF  + +      V   V+ +   +R KW+  
Sbjct  100736  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERTKWMNA  100846

 Score = 42.7 bits (99),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 51/126 (40%), Gaps = 34/126 (27%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  99998   CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAPW  100147

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                      G A   F F      P        V+  ++ +R++WL           +V+C 
Sbjct  100148  S------GEA-HGFMFYTTKQIPYY------VYASSEAERSRWLRALKDFMVETEDVSCE  100288

Query  132     ALKAKR  137
                   KR
Sbjct  100289  GYLTKR  100306

 Score = 41.2 bits (95),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = +2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
               SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  100280  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  100408

>ALCA:scaffold_78 AcNc2_CONTIG_78_length_85802 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_78_length_85802:1:85802:1 
REF
Length=85802

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 56/115 (49%), Gaps = 18/115 (16%)
 Frame = +1

Query  12     TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
              T + +  +P +C GY+TK+GH RKSW+ R+ +L G N+ ++YY+     +   G++    
Sbjct  70324  TTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANNAKGKA----  70485

Query  72     GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
                  L+ ++    V  V       FGF  +        V   V+ + + +R KW+
Sbjct  70486  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQ----VPYYVYADNERERKKWM  70614

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 50/125 (40%), Gaps = 34/125 (27%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
              EGY+TKRGH   +W+ RF VL G+ L+  YY S         E T   GS  ++ + P  
Sbjct  69772  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  69921

Query  84     YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACNA  132
                    G A   F F      P        V+  ++ ++ KWL           EV C  
Sbjct  69922  ------GEA-HGFMFYTTKQIPYY------VYAASEAEKTKWLRALREFYVEPDEVTCEG  70062

Query  133    LKAKR  137
                 +R
Sbjct  70063  YLTRR  70077

 Score = 37.0 bits (84),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 5/43 (12%)
 Frame = +1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              +CEGY+T+RGH   S RV + VL G+ L     Q AY ++ +A
Sbjct  70051  TCEGYLTRRGHLVPSQRVCYYVLSGTYLRHYADQQAYRDNDSA  70179

>PHIF:NW_003303587.1 Phytophthora infestans T30-4 supercont1.172 
genomic scaffold, whole genome shotgun sequence
Length=191572

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 51/108 (47%), Gaps = 18/108 (17%)
 Frame = -1

Query  19     QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              +P SC GY+TK+GH RKSW+ R+ +L G+   ++YY      +   G+   P     + +
Sbjct  55210  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGK---PLAEVLVED  55046

Query  79     IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
              ++  +           PFGF  + +      V   V+ +   +R KW+
Sbjct  55045  VQKWD---------GEPFGFMFMTNEQ----VPYYVYADNDRERTKWM  54941

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 49/126 (39%), Gaps = 34/126 (27%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
              CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  55783  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAP-  55637

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                           F F      P        V+  ++ +R++WL           EV+C 
Sbjct  55636  ------WSGEAHGFMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVETEEVSCE  55493

Query  132    ALKAKR  137
                  KR
Sbjct  55492  GYLTKR  55475

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 5/43 (12%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              SCEGY+TKRGH   S R+ + VL+G++L     Q AY ++++A
Sbjct  55501  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  55373

>SADI:scaffold_52 supercont1.52 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.52:1:383575:1 
REF
Length=383575

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 21/108 (19%)
 Frame = +2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               +P SC GY+TK+GH RKSW+ R+ VL G+ L  +YY         +   +M K S     
Sbjct  215054  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYY---------SDYDSMNKQSLAEVG  215200

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
               +E      G        FGF+ +        V   VF E+  +R KW+
Sbjct  215201  VEDVALWDG------EQFGFQFITTEQ----VPYYVFAESDRERQKWM  215314

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 62/138 (45%), Gaps = 24/138 (17%)
 Frame = +1

Query  17      KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
               K  P +C G++TK+GH RKSW+ R+ VL G+ L  +Y+    A +   G++        +
Sbjct  210508  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKAL---SEVSV  210672

Query  77      SNIEPHE-YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
                ++ P +  V G M        F  + + P        VF + + D+ KW+     ALK 
Sbjct  210673  KDVAPWDGEVCGFM--------FVTLENVP------YYVFADNERDQAKWM----TALKK  210798

Query  136     KRQLTRQAIDQSVSPNKK  153
                  L    ++    P KK
Sbjct  210799  AVGLDAPTLETPDEPEKK  210852

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 51/136 (38%), Gaps = 29/136 (21%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               C GY+TKRGH   +W+ RF VL    +          C+  +       G  +L  + P 
Sbjct  214379  CAGYLTKRGHVVTNWKTRFFVLRPHAI---------LCYYADDSMVKKLGQVHLVKVAPW  214531

Query  83      EYVIGVMGAA---------DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-------  126
               EY     G +         +  FGF M     R  +    V+     +R +WL       
Sbjct  214532  EYFSATTGNSVLKSARGSDEMKFGF-MFFTTKRVAYY---VYANVNAERQRWLLALQDLY  214699

Query  127     EVACNALKAKRQLTRQ  142
                V  NA   +  LT++
Sbjct  214700  VVTSNATDCEGYLTKR  214747

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 6/53 (11%)
 Frame = +1

Query  11      ATASGDKA---QPTSCEG-YVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               +TA G +A   +P+SC   Y+TKRGH   S+R+R+ V+ GS   V YY    A
Sbjct  210172  STAKGKRACYHRPSSCSCRYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  210324

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 43/106 (41%), Gaps = 24/106 (23%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK-GSFYLSNIEPH  82
                GY+TKRGH   +W+ RF  L  S  +++YY         N E    K G  ++S + P 
Sbjct  209892  SGYLTKRGHVITNWKTRFFALR-SQGRLSYY---------NDEGMGKKLGEVHVSKVSPW  210041

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                            F F+          +   V+  + T+R +WL+ 
Sbjct  210042  S-------GETNGFMFQTTKQ------ISYYVYASSNTERARWLKA  210140

>PYAP:scaffold_123 pag1_scaffold_123 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_123:1:61624:1 
REF
Length=61624

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = -1

Query  13     ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
              A+ +  +P +C GY+TK+GH RKSW+ R+ VL G++  + Y+      +   G++     
Sbjct  39424  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKA-----  39266

Query  73     SFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
                 L+ +     V  V      PFGF  +        V   V+ + + +R KW+    NA
Sbjct  39265  ---LAEV----IVEDVQRWDGEPFGFMFMTSEQ----VPYYVYADNERERGKWM----NA  39131

Query  133    LKAKRQLT  140
              L   R+LT
Sbjct  39130  L---RKLT  39116

 Score = 40.8 bits (94),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
              +CEG++TKRGH   +W++R+ VL G+ L+
Sbjct  39982  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE  39896

 Score = 36.6 bits (83),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 29/43 (67%), Gaps = 5/43 (12%)
 Frame = -1

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              +CEG++T+RGH   S R  + VL+G++L     Q AY ++++A
Sbjct  39697  TCEGFLTRRGHLVPSQRFAYYVLNGTSLRHYADQQAYRDNQSA  39569

>ALLA:FR824103 dna:supercontig supercontig:ENA1:FR824103:1:105777:1 
REF
Length=105777

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/143 (26%), Positives = 67/143 (47%), Gaps = 27/143 (19%)
 Frame = -3

Query  12     TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
              T + +  +P +C GY+TK+GH RKSW+ R+ +L G N+ ++YY+     +   G++    
Sbjct  67150  TLTTNVVEPVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYDLANHVKGKA----  66989

Query  72     GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
                  L+ ++    V  V       FGF  +        V   V+ + + +R KW      
Sbjct  66988  ----LAEVQ----VEDVQKWDGEAFGFMFMTTEQ----VPYYVYADNERERKKW------  66863

Query  132    ALKAKRQLTRQAIDQSVSPNKKK  154
               + A R+L+   +D+     KK+
Sbjct  66862  -MSALRKLS--TLDEDTETEKKR  66803

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 51/125 (41%), Gaps = 34/125 (27%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
              EGY+TKRGH   +W+ RF VL G+ L+  YY S         E T   GS  ++ + P  
Sbjct  67702  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE--------EKTKRYGSVVVAKVAPWS  67553

Query  84     YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACNA  132
                    G A   F F      P        V+  ++T++ KWL           EV C  
Sbjct  67552  ------GEA-HGFMFYTTKQIP------YYVYAASETEKAKWLRALREFYVEPDEVTCEG  67412

Query  133    LKAKR  137
                 +R
Sbjct  67411  YLTRR  67397

 Score = 36.6 bits (83),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 5/43 (12%)
 Frame = -3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNL-----QVAYYESRAA  59
              +CEGY+T+RGH   S RV + VL G+ L     Q AY ++ +A
Sbjct  67423  TCEGYLTRRGHLVPSQRVCYYVLSGTCLRHYADQQAYRDNDSA  67295

>PYAP:scaffold_137 pag1_scaffold_137 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_137:1:57116:1 
REF
Length=57116

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 2/35 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
              EGYVTKRGH  ++W++RF  L+G+NL  +YYE++ 
Sbjct  40957  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKV  41055

>ALLA:FR824471 dna:supercontig supercontig:ENA1:FR824471:1:18709:1 
REF
Length=18709

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 56/110 (51%), Gaps = 11/110 (10%)
 Frame = +2

Query  25    GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
             GY+ KRG   KS+R R++ L+G+ L  +YY+ + +        T P+GS  L N+     
Sbjct  5756  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTS---  5920

Query  85    VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              +  + +    +G  +V  +        ++  E +++ ++WL+  CNA++
Sbjct  5921  -LQPLESKTEKYGIVLVTTSR-----TWELVAENESEYHRWLKELCNAVE  6052

>PYAR:scaffold_1124 par_scaffold_1124 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1124:1:10220:1 
REF
Length=10220

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 27/34 (79%), Gaps = 2/34 (6%)
 Frame = -1

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             EGYVTKRGH  ++W+ RF  L+G+NL  +YYE++
Sbjct  2102  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK  2007

>APAS:scaffold_22 supercont1.22 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.22:1:940546:1 
REF
Length=940546

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 54/129 (42%), Gaps = 8/129 (6%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGY+ KR  + K W   + VL G  L     +  A  HP N  S +  G F  S+    +
Sbjct  441431  EGYLMKRSDWLKHWETYYFVLHGRVLYCYLSDEEAKLHPEN--SKIKHGKFTFSDNLILD  441258

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
                VI V       F F+       KG  ++ +  +T+  +  W+ +AC+ +     L  Q 
Sbjct  441257  EVITVQSRLTYEFVFE-----SDKG-KQIHLRAKTEASKQMWMHMACHGIVDTEMLRNQV  441096

Query  144     IDQSVSPNK  152
               +    +P +
Sbjct  441095  LHMRRTPQR  441069

 Score = 37.0 bits (84),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (3%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+    +
Sbjct  436343  EGYLMKRSDWLKHWETYYFVLHGRVLCCYMSEDNARVHPEN--SRIKDGRFTFSDKVVLD  436170

Query  84      YVIGVMGAADRP  95
                VI +    D P
Sbjct  436169  KVIDIRTHFDMP  436134

>PYIR:scaffold_231 pir_scaffold_231 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_231:1:38748:1 
REF
Length=38748

 Score = 45.4 bits (106),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = -1

Query  23     CEGYVTKRGHFR-KSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEP  81
              CEGYV  R HF   +WR RF VL+ + L + Y ++ AA      +  + K    ++  + 
Sbjct  19221  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQKALEKHDL-IAVKKW  19048

Query  82     HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
              H      +G     FGF++   A   G++E  V +E +  + KWL    NA+
Sbjct  19047  HPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIEDE--QTKWLAAITNAV  18904

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 33/69 (48%), Gaps = 8/69 (12%)
 Frame = -1

Query  9      PGATASGDKA---QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
              PG   SG +A   +    EGY+ KRGH   S R R+ VL  + L+  Y+ +      P  
Sbjct  22089  PGDDDSGSEAGSNRQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNP--  21922

Query  66     ESTMPKGSF  74
               +  P GSF
Sbjct  21921  -AIRPHGSF  21898

>ALCA:scaffold_1 AcNc2_CONTIG_1_length_398508 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_1_length_398508:1:398508:1 
REF
Length=398508

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 68/155 (44%), Gaps = 40/155 (26%)
 Frame = +2

Query  34      RKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVM--  89
               RKSWRVRF VL  DG+   +AYY  R       G+  M KG      I+ +E +IG+   
Sbjct  267485  RKSWRVRFFVLYTDGT---LAYYRKR-------GDVKM-KGY-----IKLNEGIIGIQYI  267616

Query  90      --GAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQS  147
                    +R + F++     RKGF  L    +TQ +   W+ V    L++ RQL        
Sbjct  267617  DAWKTNRAYSFEI-----RKGFYRLLCHAQTQLEAEVWVSV----LRSTRQL--------  267745

Query  148     VSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKE  182
                +P  K  F  + P      ++  + +     +++
Sbjct  267746  -APPDKTEFDLTAPEERMASIAVARHLNKFFVTRK  267847

>PHRA:scaffold_16
Length=604796

 Score = 44.7 bits (104),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 71/152 (47%), Gaps = 23/152 (15%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  436829  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  436990

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                     +  AD+ + F++      KGF +L  +  +Q +   W+     AL++ R++T  
Sbjct  436991  ------VRVADKAYVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVTPP  437125

Query  143     AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
                 +  ++  ++K    +V      +    KQ+
Sbjct  437126  CYETDLTATEEKAGSNAVTRHLNKIFITDKQI  437221

>ALCA:scaffold_464 AcNc2_CONTIG_464_length_18313 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_464_length_18313:1:18313:1 
REF
Length=18313

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 31/125 (25%), Positives = 60/125 (48%), Gaps = 12/125 (10%)
 Frame = -2

Query  10     GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM  69
              GA A   K    +  GY+ KRG   KS+R R++ L G+ L  +YY+ + +        T 
Sbjct  15537  GAKAC-QKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREENKTY  15367

Query  70     PKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVA  129
               +GS +L ++      +  + +    +G  +V  +        ++ VE + + ++WL+  
Sbjct  15366  LRGSIHLESVTS----LQPLESKTEKYGVVLVTTSR-----TWELVVENEIEYHRWLKEL  15214

Query  130    CNALK  134
              CNA++
Sbjct  15213  CNAVE  15199

>HYAP:scaffold_1 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_1:1:1234263:1 
REF
Length=1234263

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 0/34 (0%)
 Frame = +1

Query  24       EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                EGYVTKRGH  ++W++RF  L+G+ L    Y  R
Sbjct  1195378  EGYVTKRGHLVRNWKMRFFTLEGNLLSCT*YRDR  1195479

>PYIR:scaffold_316 pir_scaffold_316 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_316:1:31968:1 
REF
Length=31968

 Score = 44.3 bits (103),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 39/151 (26%), Positives = 63/151 (42%), Gaps = 32/151 (21%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
             EGYV K+G +   W  R+LVLDG+ L   YY ++         +   +G   +S + P  
Sbjct  9298  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  9459

Query  84    YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
             Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  9460  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVE-----------MMQAA  9570

Query  144   IDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
             ID+ V   K  L G SV   T P+ +   Q+
Sbjct  9571  IDEGV---KHSLNGSSVDPETLPIQNSPTQV  9654

>HYAP:scaffold_797 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_797:1:5354:1 
REF
Length=5354

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 54/136 (40%), Gaps = 16/136 (12%)
 Frame = +1

Query  16    DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
             D A   S  G++ KRGH RK+W+ R+ VLD S L+   Y + ++C    GE  +     +
Sbjct  3655  DDAFLDSMSGWLRKRGHVRKNWKARYFVLDKSILR---YYTDSSCTKLKGEVLL-----F  3810

Query  76    LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGF-VELDVFVETQTDRNKWLEVACNALK  134
                   H   + V G  D  F  ++       G    L +      DR  W+    +AL 
Sbjct  3811  HPQTRVHYVDVHVAGGRDASFAIQV-------GLDYTLLLHAAQLCDRENWMYCIEDALL  3969

Query  135   AKRQLTRQAIDQSVSP  150
              +     Q +     P
Sbjct  3970  CRDSYYTQGLTSGPGP  4017

>PHRA:scaffold_73
Length=254763

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 42/191 (22%), Positives = 74/191 (39%), Gaps = 33/191 (17%)
 Frame = +2

Query  6       LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
               L +  A+     A     EGYV K+G +   W  R+L+LDG+ L   YY S+        
Sbjct  185126  LVDSSASTPAAIAHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN  185299

Query  66      ESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKW  125
                    +G   +S + P  Y         +  GF +      +G     +   T+ +++ W
Sbjct  185300  ----LRGRMIISKVRPENY--------GKAHGFLL----ETQGHKHFHLCCATELEKDMW  185431

Query  126     LEVACNALKAKRQLTR--------QAIDQSVSPNKKKLFGFS-------VPSSTQPVMSP  170
               +E+   A++   + T+        +A+    SP +  L GF        +  S+ P   P
Sbjct  185432  VEMMQAAIEEGVRHTQSSMSMEGMEALQMQSSPTQVDLRGFYLAFRQLLISHSSSPQFFP  185611

Query  171     QKQMQTLATSK  181
               +     + TS 
Sbjct  185612  KLSRDVVLTSN  185644

>PYIR:scaffold_88 pir_scaffold_88 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_88:1:55984:1 
REF
Length=55984

 Score = 43.9 bits (102),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
               EGYVTKRGH  ++W+ RF  L+G+NL 
Sbjct  24131  WEGYVTKRGHLVRNWKNRFFTLEGNNLS  24214

>PHIF:NW_003303740.1 Phytophthora infestans T30-4 supercont1.19 
genomic scaffold, whole genome shotgun sequence
Length=2398068

 Score = 43.9 bits (102),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 49/126 (39%), Gaps = 34/126 (27%)
 Frame = +2

Query  23       CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                CEGY+TKRGH   +W+ R+  L G+ L+  YY S         E +   G+  +  + P 
Sbjct  2269073  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE--------EKSKKYGAVTVEKVAP-  2269219

Query  83       EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL-----------EVACN  131
                             F F      P        V+  ++ +R++WL           EV+C 
Sbjct  2269220  ------WSGEAHGFMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVETEEVSCE  2269363

Query  132      ALKAKR  137
                    KR
Sbjct  2269364  GYLTKR  2269381

>PYUU:scaffold_2023 scf1117875582023 dna:supercontig supercontig:pug:scf1117875582023:1:1683196:1 
REF
Length=1683196

 Score = 43.5 bits (101),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +1

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
                EGYVTKRGH  ++W+ RF  L+G+NL    +
Sbjct  313543  WEGYVTKRGHLVRNWKNRFFTLEGTNLSCKQW  313638

>PYAP:scaffold_212 pag1_scaffold_212 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_212:1:44434:1 
REF
Length=44434

 Score = 43.1 bits (100),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 68/161 (42%), Gaps = 33/161 (20%)
 Frame = +2

Query  13     ASGDKAQPTSC------EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
              ASG    PT        EGYV K+G +   W  R+LVLDG+ L   YY ++      +G 
Sbjct  20888  ASGATDAPTGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEAR--SGR  21055

Query  67     STMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWL  126
              +   +G   +S + P  Y     G A   F  + +GH          +   T+ +++ W+
Sbjct  21056  NL--RGRMIISKVRPENY-----GKA-HGFLLETMGHK------HFHLCCSTELEKDMWV  21193

Query  127    EVACNALK--AKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQ  165
              E+   A+    K +L R  I  +   N +       PS TQ
Sbjct  21194  EMMQAAIDEGVKHKLERSLISSADVANAQ-------PSPTQ  21295

>PHPA:scaffold_114 NW_008649100.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.114, whole genome 
shotgun sequence
Length=97882

 Score = 43.1 bits (100),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 70/173 (40%), Gaps = 33/173 (19%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
              EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   +S + P  
Sbjct  60130  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIISKVRPEN  60291

Query  84     YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK-----AKRQ  138
              Y         +  GF +      +G     +   T+ +++ W+E+   A++     A  +
Sbjct  60292  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  60435

Query  139    LT---RQAIDQSVSPNKKKLFGFS-------VPSSTQPVMSPQKQMQTLATSK  181
              L+    +A+    SP +  L GF        +  S+ P   P+     + TS 
Sbjct  60436  LSMEGMEALQMQTSPTQVDLRGFYFAFRQLLISHSSSPQFFPKLSRDVVLTSN  60594

>PHKE:scaffold_206 scf_22126_206.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_206.1:1:61978:1 
REF
Length=61978

 Score = 42.7 bits (99),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 34/143 (24%), Positives = 62/143 (43%), Gaps = 18/143 (13%)
 Frame = -1

Query  10    GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM  69
             G +++ D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +
Sbjct  5647  GTSSAFDDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEVLL  5477

Query  70    PKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT--DRNKWLE  127
                  +      H   + V    D  F  ++    P     E  + ++     DR  W+ 
Sbjct  5476  -----FHPQTRVHYVDVHVASGRDASFAVQV---GP-----EYTLLLQAAQLRDRENWIY  5336

Query  128   VACNALKAKRQLTRQAIDQSVSP  150
                +AL  +     Q ++++  P
Sbjct  5335  CIEDALLCRDSYHPQGVNRNPGP  5267

>PYIW:scaffold_4 piw_scaffold_4 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_4:1:82745:1 
REF
Length=82745

 Score = 42.7 bits (99),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQV  51
              EGYVTKRGH  ++W+ RF  L+G+NL  
Sbjct  52256  EGYVTKRGHLVRNWKNRFFTLEGNNLSC  52339

>PYUU:scaffold_1239 scf1117875581239 dna:supercontig supercontig:pug:scf1117875581239:1:719819:1 
REF
Length=719819

 Score = 42.7 bits (99),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 55/135 (41%), Gaps = 20/135 (15%)
 Frame = -1

Query  18     AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS  77
              A     EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +S
Sbjct  51989  AHEVHWEGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL----RGRMIIS  51828

Query  78     NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK--A  135
               + P  Y         +  GF +      KG     +   T+ +++ W+E+   A+    
Sbjct  51827  KVRPENY--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAIDEGV  51684

Query  136    KRQLTRQAIDQSVSP  150
              K  +   ++D  V P
Sbjct  51683  KHSVNGNSMDSDVVP  51639

>PHPA:scaffold_32 NW_008649018.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.32, whole genome shotgun 
sequence
Length=687390

 Score = 42.7 bits (99),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 6/44 (14%)
 Frame = +2

Query  9       PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDG  46
               P + +SGD A  +        EGYVTKRGH  ++W++RF  L+G
Sbjct  578426  PDSMSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG  578557

>PHSO:scaffold_4
Length=7609242

 Score = 42.4 bits (98),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 70/174 (40%), Gaps = 34/174 (20%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   +S + P  
Sbjct  971188  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIISKVRPEN  971349

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK------AKR  137
               Y         +  GF +      +G     +   T+ +++ W+E+   A++      A  
Sbjct  971350  Y--------GKAHGFLL----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGAHS  971493

Query  138     QLT---RQAIDQSVSPNKKKLFGFS-------VPSSTQPVMSPQKQMQTLATSK  181
               +++    +A+    SP +  L GF        +  S+ P   P+     + TS 
Sbjct  971494  RVSMEGMEALQMQASPTQVDLRGFYFAFRQLLISHSSSPQFFPKLSRDVVLTSN  971655

>PHCA:scaffold_20 PHYCAscaffold_20
Length=899172

 Score = 42.0 bits (97),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 41/196 (21%), Positives = 73/196 (37%), Gaps = 33/196 (17%)
 Frame = -2

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               M+ L +    A+           EGYV K+G +   W  R+L+LDG+ L   YY S+   
Sbjct  130145  MDDLLVDSSSASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  129972

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                         +G   +S + P  Y         +  GF +      +G     +   T+ 
Sbjct  129971  RSARN----LRGRMIISKVRPENY--------GKAHGFLL----ETQGHKHFHLCCSTEL  129840

Query  121     DRNKWLEVACNALK--------AKRQLTRQAIDQSVSPNKKKLFGFS-------VPSSTQ  165
               +++ W+E+   A++        +      +A+    SP +  L GF        +  S+ 
Sbjct  129839  EKDMWVEMMQAAIEEGVRHGHSSISAEGMEALQMQTSPTQVDLRGFYFAFRQLLISHSSS  129660

Query  166     PVMSPQKQMQTLATSK  181
               P   P+     + TS 
Sbjct  129659  PQFFPKLSRDVVLTSN  129612

>PLHA:NW_020189964.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3060, whole genome shotgun sequence
Length=3267112

 Score = 42.0 bits (97),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 56/133 (42%), Gaps = 14/133 (11%)
 Frame = -3

Query  12      TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
               T++ D A   S  G++ KRGH  K+W+ R+ VL  S L+   Y S A C    GE  +  
Sbjct  880679  TSAFDDAFLDSMSGWLRKRGHVCKNWKDRYFVLHKSVLR---YYSDACCTKLKGEVLLFH  880509

Query  72      GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
                   +  ++ H     V G  D  F  + VG         L +  E  +DR  W+    +
Sbjct  880508  PQTCVHYVDVH-----VTGGRDASFAIQ-VGSE-----YTLLLQAERLSDRENWMYCIED  880362

Query  132     ALKAKRQLTRQAI  144
               AL  +     Q +
Sbjct  880361  ALLCRDSYQNQQV  880323

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 6/43 (14%)
 Frame = +2

Query  11     ATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGS  47
               T  GD+A  +        EGYVTKRGH  ++W++RF  L+G+
Sbjct  73928  VTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEGN  74056

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (52%), Gaps = 5/62 (8%)
 Frame = -3

Query  4        LRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPP  63
                L+L   G  +  D ++P   EG +TKR  + K WR R+ VL G+ L    Y  RA   P 
Sbjct  2721683  LQLQMEGDYSHCDLSEPDF-EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAKGEPA  2721519

Query  64       NG  65
                +G
Sbjct  2721518  HG  2721513

 Score = 33.5 bits (75),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 29/56 (52%), Gaps = 2/56 (4%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
               EGY+ KRGH   S R R+ VL  + L  +YY +      PN  +T  +  F+  +I
Sbjct  613916  EGYLMKRGHKIPSMRKRYCVLVRNEL--SYYVTHDDSKNPNSGATTNRLGFFHVDI  614077

>ALCA:scaffold_16 AcNc2_CONTIG_16_length_171156 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_16_length_171156:1:171156:1 
REF
Length=171156

 Score = 42.0 bits (97),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNL  49
               EGYVTKRGH  ++W++RF  L+G+ L
Sbjct  111625  EGYVTKRGHLVRNWKMRFFTLEGNRL  111548

>PHCA:scaffold_27 PHYCAscaffold_27
Length=705730

 Score = 42.0 bits (97),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 71/152 (47%), Gaps = 23/152 (15%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  527809  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  527970

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                     +  AD+ + F++      KGF +L  +  +Q +   W+    +AL++ R++   
Sbjct  527971  ------IRVADKAYVFQI-----EKGFYKLMCYCCSQFEAELWV----SALRSVRRVAPP  528105

Query  143     AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174
                 +  ++  ++K    +V      +    KQ+
Sbjct  528106  CYEVDLTATEEKAGSNAVTRLLNKIFITDKQI  528201

>PHIF:NW_003303691.1 Phytophthora infestans T30-4 supercont1.68 
genomic scaffold, whole genome shotgun sequence
Length=714584

 Score = 41.6 bits (96),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 6/45 (13%)
 Frame = -1

Query  9       PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGS  47
               P + +SGD A  +        EGYVTKRGH  ++W++RF  L+G+
Sbjct  364247  PESMSSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEGN  364113

>APIN:scaffold_3 supercont1.3 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.3:1:3119476:1 
REF
Length=3119476

 Score = 41.6 bits (96),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 44/83 (53%), Gaps = 8/83 (10%)
 Frame = -3

Query  2       NILRLPEPGATASGDK-AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               NI R+      A+  K +      G++ K+G    SW+ RFLVL G N  ++YY+ +   
Sbjct  781046  NINRVGRRAGAATMQKDSSVNEWRGWIQKQGSVVPSWKKRFLVLSGQN--ISYYD-KDVS  780876

Query  61      HPPNGESTMPKGSFYLSNIEPHE  83
               +P   E    KGSF L+ ++P++
Sbjct  780875  NPRAKE----KGSFVLAGVQPNK  780819

>PHKE:scaffold_58 scf_22126_58.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_58.1:1:127707:1 
REF
Length=127707

 Score = 41.2 bits (95),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 63/132 (48%), Gaps = 23/132 (17%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
              G++TK+GH  KSW+ RF VL  DG+     YY+++       G   +  G   + +++  
Sbjct  20051  GWLTKQGHMWKSWKTRFFVLFSDGT---FVYYKNKGR-KKIKGCMQLNDGVVSIQHVD--  19890

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                    +  A++P+ F++      KGF  L  +  +Q +   W+     AL++ R++   
Sbjct  19889  ------VRVAEKPYVFQI-----EKGFYRLLCYCCSQFEAELWV----TALRSVRRVAPP  19755

Query  143    AIDQSVSPNKKK  154
                +  ++  ++K
Sbjct  19754  CFEMDLTATEEK  19719

>ALLA:FR824067 dna:supercontig supercontig:ENA1:FR824067:1:183579:1 
REF
Length=183579

 Score = 41.2 bits (95),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
               EGYVTKRGH  ++W++RF  L+G+ L
Sbjct  83565  WEGYVTKRGHLVRNWKMRFFTLEGNRL  83645

>PYAR:scaffold_222 par_scaffold_222 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_222:1:24584:1 
REF
Length=24584

 Score = 41.2 bits (95),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 55/128 (43%), Gaps = 29/128 (23%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
              EGYV K+G +   W  R+LVLDG+ L   YY S+      +G +   +G   +S + P  
Sbjct  13257  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEAR--SGRNL--RGRMIISKVRPEN  13418

Query  84     YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
              Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  13419  Y--------GKAHGFLI----ETKGHKLFHLCCSTELEKDMWVE-----------MMQAA  13529

Query  144    IDQSVSPN  151
              ID+ V  N
Sbjct  13530  IDEGVKHN  13553

>PHSO:scaffold_2
Length=11587142

 Score = 41.2 bits (95),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 55/135 (41%), Gaps = 14/135 (10%)
 Frame = +2

Query  16       DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
                D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  2310074  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCSKLKGEVLL-----F  2310229

Query  76       LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135
                      H   + V G  D  F  ++    P      L +      DR  W+    +AL  
Sbjct  2310230  HPQTRVHYVDVHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDALLC  2310391

Query  136      KRQLTRQAIDQSVSP  150
                +     Q + +   P
Sbjct  2310392  RDSYHPQGMTEGPEP  2310436

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)
 Frame = +2

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
                G+V K+G   K+W+ RF+VL G   Q+ YY++ A   P    +   KGSF +  +E
Sbjct  5990327  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVDP----TVKAKGSFQVITVE  5990473

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 59/117 (50%), Gaps = 21/117 (18%)
 Frame = +1

Query  25        GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYL---S  77
                 G + KRG   K+++ R++ LDGS L  AYY  +   H      + + +  KG   L   S
Sbjct  10658899  GVLRKRGEGIKAFKKRYMELDGSVL--AYYRKKPEKHGIPLSRDEKKSYEKGFIDLDRVS  10659072

Query  78        NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                 +++P       + +   P+GF +V  A  + +V   +  E++++ ++W++  C  +K
Sbjct  10659073  SVQP-------IDSKSEPYGFLLVTTA--RTWV---LAAESESEYHRWVKALCGVVK  10659207

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 30/57 (53%), Gaps = 8/57 (14%)
 Frame = +3

Query  4        LRLPEPGATASGDKAQPTSCEGYVTKRGHF--------RKSWRVRFLVLDGSNLQVA  52
                ++LPE     +    + T  +GY+ K+G          RK+W+ R+ +L+G+NL  A
Sbjct  3365325  VQLPEQKVIEAAQDKEETVLQGYLIKQGGGGNVLNPLGRKNWKQRYFILNGANLIYA  3365495

>PHRA:scaffold_27
Length=538834

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 6/45 (13%)
 Frame = -2

Query  9      PGATASGDKAQPT------SCEGYVTKRGHFRKSWRVRFLVLDGS  47
              P ++ SGD A  +        EGYVTKRGH  ++W++RF  L+G+
Sbjct  49011  PPSSLSGDHAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEGN  48877

>PHKE:scaffold_129 scf_22126_129.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_129.1:1:86867:1 
REF
Length=86867

 Score = 41.2 bits (95),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = +1

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGS  47
               EGYVTKRGH  ++W++RF  L+G+
Sbjct  53506  WEGYVTKRGHLVRNWKMRFFTLEGN  53580

>HYAP:scaffold_46 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_46:1:421953:1 
REF
Length=421953

 Score = 41.2 bits (95),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 64/132 (48%), Gaps = 23/132 (17%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  109870  GWLTKQGHLWKSWKTRFFVLFADGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  110031

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                     +  A++ + F++      KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  110032  ------IRVAEKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVA----ALRSVRRVAPP  110166

Query  143     AIDQSVSPNKKK  154
                 +  ++  ++K
Sbjct  110167  CYEMDLTSTEEK  110202

>SADI:scaffold_1 supercont1.1 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.1:1:1813439:1 
REF
Length=1813439

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 53/117 (45%), Gaps = 26/117 (22%)
 Frame = -1

Query  14      SGDKA--QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
               SG++A   P +  GYV K+G F K+W+ R++VL    L   YY S  A       +T P+
Sbjct  206708  SGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERA-------TTKPR  206556

Query  72      GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRK-GFV-----ELDVFVETQTDR  122
               G F          V G+  A D P G    G   R+  F      E D + +T ++R
Sbjct  206555  GFF---------RVTGIAYAPDLPHGLIADGTGTRRLKFTLADNDECDAWYDTLSER  206412

>PHIF:NW_003303669.1 Phytophthora infestans T30-4 supercont1.90 
genomic scaffold, whole genome shotgun sequence
Length=500880

 Score = 41.2 bits (95),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 39/173 (23%), Positives = 70/173 (40%), Gaps = 33/173 (19%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+L+LDG+ L   YY S+             +G   ++ + P  
Sbjct  370499  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIINKVRPEN  370338

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK-----AKRQ  138
               Y         +  GF +      +G     +   T+ +++ W+E+   A++     A  +
Sbjct  370337  Y--------GKAHGFLI----ETQGHKHFHLCCTTELEKDMWVEMMQAAIEEGVRHAHSR  370194

Query  139     LT---RQAIDQSVSPNKKKLFGFS-------VPSSTQPVMSPQKQMQTLATSK  181
               L+    +A+    SP +  L GF        +  S+ P   P+     + TS 
Sbjct  370193  LSMEGMEALQLQTSPTQVDLRGFYFAFRQLLISHSSSPQFFPKLSRDVVLTSN  370035

>SAPA:scaffold_181 supercont2.181 dna:supercontig supercontig:ASM15154v2:supercont2.181:1:64981:1 
REF
Length=64981

 Score = 40.8 bits (94),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 61/140 (44%), Gaps = 20/140 (14%)
 Frame = -3

Query  2     NILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
              +L   E  A+  G  K +     G + KRGH RK+W  RF VL  ++L+  YY+   + 
Sbjct  5846  KVLHPQESSASVGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYKKPRS-  5676

Query  61    HPPNGESTMPKGSFYLSNIEPHEYVIGV--MGAADRPFGFKMVGHAPRKGFV--------  110
               PN  ST      YL        +I V    A  RP+ F  V    R+  V        
Sbjct  5675  --PNHSSTWNTDKRYLRGELRLTDLIHVESSSADHRPYCF--VATFVRQANVLWLYHAHS  5508

Query  111   ELDVFVETQT--DRNKWLEV  128
              +D +++  +  DR+KW+ +
Sbjct  5507  TIDYYIQANSDDDRDKWIRL  5448

>PLHA:NW_020187174.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_253, whole genome shotgun sequence
Length=912309

 Score = 40.8 bits (94),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 24/164 (15%)
 Frame = -1

Query  1       MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
               M+ L +    A+ +         EGYV K+G +   W  R+L+LDG+ L   YY S+   
Sbjct  307482  MDDLAMNSSVASTTAFMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEA  307309

Query  61      HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                         +G   +  + P  Y         +  GF +   + +    +  +   T+ 
Sbjct  307308  RSARN----MRGRMTVYKVRPENY--------GKAHGFLLETQSHK----QFHLCCATEL  307177

Query  121     DRNKWLEVACNALK--AKRQLTRQAIDQ----SVSPNKKKLFGF  158
               +++ W+E+   A++  A+++ +R +++      +SP +  L GF
Sbjct  307176  EKDMWVEMMHAAVEEGARQRNSRLSVEGMEILQISPTQVDLRGF  307045

>PHPA:scaffold_5 NW_008648991.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.5, whole genome shotgun 
sequence
Length=2147012

 Score = 40.8 bits (94),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 8/85 (9%)
 Frame = -2

Query  16      DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  694672  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYADSSCTKLKGEVLL-----F  694517

Query  76      LSNIEPHEYVIGVMGAADRPFGFKM  100
                     H   + V G  D  F  ++
Sbjct  694516  HPQTRVHYVDVHVAGGRDASFAIQV  694442

>PYVX:scaffold_378 pve_scaffold_378 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_378:1:27273:1 
REF
Length=27273

 Score = 40.8 bits (94),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 38/75 (51%), Gaps = 6/75 (8%)
 Frame = +1

Query  6     LPEPGATASGDKA-QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPN  64
             + E   T +GD A      EGY+ KRGH   S R R+ VL G+  +V Y+ ++     PN
Sbjct  5146  MAENAVTPAGDDAGSAVLMEGYLVKRGHLMPSMRKRYCVLVGN--KVTYFATQDDSRNPN  5319

Query  65    GESTMPKGSFYLSNI  79
               S    GSF ++ +
Sbjct  5320  APS---NGSFNVATV  5355

>PLHA:NW_020189809.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2904, whole genome shotgun sequence
Length=1431973

 Score = 40.8 bits (94),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 64/139 (46%), Gaps = 28/139 (20%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN--IE  80
               G++ K+GH  KSW+ RF VL  DG+   V YY+        N      KG  +L++  + 
Sbjct  779623  GWLKKQGHMWKSWKARFFVLFSDGT---VVYYK--------NKSRKKIKGYMHLNDGVVS  779769

Query  81      PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140
                    I V G A   + F++      KGF  L     +Q D   W+     AL++ R++ 
Sbjct  779770  VQHVDIRVAGKA---YVFQI-----EKGFYRLLCHCSSQIDAELWV----TALRSVRKVA  779913

Query  141     RQAIDQSVSPNKKKLFGFS  159
                   + +++  ++K  GF+
Sbjct  779914  PPCFEMNLTAREEKA-GFN  779967

>PHIF:NW_003303698.1 Phytophthora infestans T30-4 supercont1.61 
genomic scaffold, whole genome shotgun sequence
Length=734189

 Score = 40.8 bits (94),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 8/85 (9%)
 Frame = +2

Query  16      DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
               D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  681509  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDSSCAKLKGEVLL-----F  681664

Query  76      LSNIEPHEYVIGVMGAADRPFGFKM  100
                     H   + V G  D  F  ++
Sbjct  681665  HPQTRVHYVDVHVAGGRDASFAIQV  681739

>PYVX:scaffold_12 pve_scaffold_12 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_12:1:106792:1 
REF
Length=106792

 Score = 40.4 bits (93),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGS  47
              EGYVTKRGH  ++W++RF  L+G+
Sbjct  54264  EGYVTKRGHLVRNWKMRFFTLEGN  54335

>SAPA:scaffold_70 supercont2.70 dna:supercontig supercontig:ASM15154v2:supercont2.70:1:179816:1 
REF
Length=179816

 Score = 40.4 bits (93),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 49/110 (45%), Gaps = 23/110 (21%)
 Frame = -2

Query  19     QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              +P  C GY+ K+G   K+WR R+  +DG + Q++Y ++  A  PP G             
Sbjct  16438  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDADGA--PPKG-------------  16307

Query  79     IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV  128
                   +V+ V     RPF   +   + R+    L V   TQ + + WL V
Sbjct  16306  ---FGHVVDVCVNTKRPFALYIHLASGRR----LAVAGSTQAEADTWLAV  16178

 Score = 37.0 bits (84),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 7/55 (13%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
              G+V K+G   KSW+ RFLV+ G +  V YY+   + H PN      KGS  L ++
Sbjct  17178  GFVFKQGALIKSWKKRFLVVQGRH--VTYYDR--SVHEPNPR---EKGSLVLVDV  17035

>PHCA:scaffold_106 PHYCAscaffold_106
Length=144267

 Score = 40.4 bits (93),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 8/85 (9%)
 Frame = +3

Query  16     DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y + ++C    GE  +     +
Sbjct  99108  DDAFLDSMSGWLRKRGHVRKNWKARYFVLERSVLR---YYTDSSCTKLKGEVLL-----F  99263

Query  76     LSNIEPHEYVIGVMGAADRPFGFKM  100
                    H   + V G  D  F  ++
Sbjct  99264  HPQTRVHYVDVHVAGGRDASFAIQV  99338

>PHRA:scaffold_4
Length=963095

 Score = 40.4 bits (93),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 55/137 (40%), Gaps = 18/137 (13%)
 Frame = +3

Query  16     DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y +  +C    GE  +     +
Sbjct  79806  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEVLL-----F  79961

Query  76     LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT--DRNKWLEVACNAL  133
                    H   + V G  D  F  ++    P     E  + ++     DR  W+    +AL
Sbjct  79962  HPQTRVHYVDVHVAGGRDASFAIQV---GP-----EYTLLLQAAQLRDRENWMYCIEDAL  80117

Query  134    KAKRQLTRQAIDQSVSP  150
                +     Q +     P
Sbjct  80118  LCRDSYHPQGMTSGPGP  80168

 Score = 40.0 bits (92),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 55/137 (40%), Gaps = 18/137 (13%)
 Frame = +2

Query  16     DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
              D A   S  G++ KRGH RK+W+ R+ VL+ S L+   Y +  +C    GE  +     +
Sbjct  85112  DDAFLDSMSGWLRKRGHVRKNWKARYFVLEKSVLR---YYTDPSCAKLKGEVLL-----F  85267

Query  76     LSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT--DRNKWLEVACNAL  133
                    H   + V G  D  F  ++    P     E  + ++     DR  W+    +AL
Sbjct  85268  HPQTRVHYVDVHVAGGRDASFAIQV---GP-----EYTLLLQAAQLRDRENWMYCIEDAL  85423

Query  134    KAKRQLTRQAIDQSVSP  150
                +     Q +     P
Sbjct  85424  LCRDSYHPQGMTSGPGP  85474

>PYAR:scaffold_951 par_scaffold_951 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_951:1:11721:1 
REF
Length=11721

 Score = 40.0 bits (92),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 33/58 (57%), Gaps = 3/58 (5%)
 Frame = -2

Query  1      MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
              +N L L  P A+   D    + C G++ K GH RK+W++R+ VL+ S L+  YY   A
Sbjct  10805  LNGLYLDHPTASPFDDTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YYADEA  10641

>APAS:scaffold_47 supercont1.47 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.47:1:501135:1 
REF
Length=501135

 Score = 40.0 bits (92),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 49/121 (40%), Gaps = 27/121 (22%)
 Frame = -2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM----PKGSFYLSNIE  80
               G + KRGH RK+W +RF VL    L+  YY       PP   ST     P+   YL    
Sbjct  421157  GILLKRGHVRKNWLMRFFVLTSGALR--YYRK-----PPGSRSTTWSVDPR---YLRGEL  421008

Query  81      PHEYVIGV--------MGAADRPFGFKMVGHAPRKGF-----VELDVFVETQTDRNKWLE  127
               P   +I V         G   R + F +     R  F     V   V   T+ +R+KWL 
Sbjct  421007  PLADIIHVESDDSSPQRGQQPRTYRFTITVLRHRILFLLRRPVRFHVQAATEDERDKWLR  420828

Query  128     V  128
               +
Sbjct  420827  I  420825

>APAS:scaffold_5 supercont1.5 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.5:1:1915940:1 
REF
Length=1915940

 Score = 40.0 bits (92),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 18/110 (16%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+LVLDG++L   YY S+          T  +G   ++ + P  
Sbjct  939623  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEAR----TGTNLRGRMIITKVLPEN  939784

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               Y     G A   F  + +GH          +   T+ +++ W+E+   A+
Sbjct  939785  Y-----GKA-HGFLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  939898

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 31/131 (24%), Positives = 53/131 (40%), Gaps = 31/131 (24%)
 Frame = -1

Query  10      GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM  69
               G  A+         EG V K+G +   W  R+LVLDG+ L+  YY      H        
Sbjct  947165  GIAATSGGMHAVHWEGQVRKKGDWLPRWESRYLVLDGTVLR--YYSK----HEDARMGKN  947004

Query  70      PKGSFYLSNIEP-------HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDR  122
                +G   L+++ P       H +V+  +G               RK F    +  +T+ ++
Sbjct  947003  LRGKMTLTHVSPEFHKKKEHTFVVETVG---------------RKVFY---MSCDTELEK  946878

Query  123     NKWLEVACNAL  133
               + W+E+   A+
Sbjct  946877  DMWVEMMQAAI  946845

>SADI:scaffold_3 supercont1.3 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.3:1:1523884:1 
REF
Length=1523884

 Score = 40.0 bits (92),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (43%), Gaps = 29/135 (21%)
 Frame = -1

Query  15      GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
               G  A     EGYV K+G +   W  R+LVLDG++L   YY ++      +G +   +G  
Sbjct  742474  GPPAHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGRNL--RGRM  742313

Query  75      YLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                ++ + P  Y         +  GF +      KG     +   T+ +++ W+E       
Sbjct  742312  IITRVLPENY--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVE-------  742190

Query  135     AKRQLTRQAIDQSVS  149
                   + + AID+ +S
Sbjct  742189  ----MMQAAIDEGIS  742157

 Score = 34.3 bits (77),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 48/115 (42%), Gaps = 17/115 (15%)
 Frame = -2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               Q    EG+V K+G +   W  R+LVLDG+ L   YY  +   H       + +G   L+ 
Sbjct  746169  QEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQ---HDARSGKNL-RGRMVLTY  746008

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               + P            +  GF +      KG     +   T+ +++ W+E+   AL
Sbjct  746007  VGPDF-------KGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  745876

>PHPA:scaffold_7 NW_008648993.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.7, whole genome shotgun 
sequence
Length=2078921

 Score = 40.0 bits (92),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  1543523  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  1543419

>SADI:scaffold_20 supercont1.20 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.20:1:765613:1 
REF
Length=765613

 Score = 40.0 bits (92),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 34/138 (25%), Positives = 56/138 (41%), Gaps = 15/138 (11%)
 Frame = -3

Query  18      AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS  77
               A  T  EGY+ KR  + K W   + VL G  L        A   P N  S +  G+F  +
Sbjct  296570  AVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN--SKIKHGAFSFT  296397

Query  78      NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV--ETQTDRNKWLEVACNALKA  135
               +    ++V+ + G     F F+     P        VF+  +TQ  +  W+ +A   +  
Sbjct  296396  SHVILQHVVSIHGHGAFDFIFETSSGKP--------VFLRAKTQAMKTLWMAMAAQGIHD  296241

Query  136     KRQLTR---QAIDQSVSP  150
                R  +R     +D ++ P
Sbjct  296240  TRIDSRGRVGLVDTTIRP  296187

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (4%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+
Sbjct  293215  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SKIKDGRFTFSD  293057

>PYIW:scaffold_649 piw_scaffold_649 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_649:1:15641:1 
REF
Length=15641

 Score = 39.7 bits (91),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              T  EGYV K+GH  +SWR R+ +L G+    +YY S+
Sbjct  15492  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  15388

>PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_610:1:19546:1 
REF
Length=19546

 Score = 39.7 bits (91),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
              T  EGY+ K+GH  +SWR R+ +L G+     ++
Sbjct  18683  TDWEGYIWKQGHVVRSWRYRYAILSGTTFSCKWW  18582

>PHCA:scaffold_18 PHYCAscaffold_18
Length=984210

 Score = 39.7 bits (91),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  107642  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  107538

 Score = 33.5 bits (75),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (48%), Gaps = 0/46 (0%)
 Frame = +3

Query  6       LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV  51
               L   G  ++G         G + KRG F K+W  R LVL  S LQV
Sbjct  901731  LSSTGGVSAGVNGSEVILSGALNKRGQFFKAWMPRHLVLSRSALQV  901868

>SAPA:scaffold_45 supercont2.45 dna:supercontig supercontig:ASM15154v2:supercont2.45:1:290975:1 
REF
Length=290975

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 2/30 (7%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
              G++ K GH RKSW+ RF VLDGS LQ  YY
Sbjct  94315  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  94398

>PYIW:scaffold_388 piw_scaffold_388 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_388:1:19611:1 
REF
Length=19611

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 48/110 (44%), Gaps = 18/110 (16%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
             EGYV K+G +   W  R+LVLDG+ L   YY ++         +   +G   +S + P  
Sbjct  5825  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEAR----SARNLRGRMIISKVRPEN  5664

Query  84    YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
             Y         +  GF +      KG     +   T+ +++ W+E+   A+
Sbjct  5663  Y--------GKAHGFLI----ETKGHKHFHLCCSTELEKDMWVEMMQAAI  5550

>HYAP:scaffold_72 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_72:1:329297:1 
REF
Length=329297

 Score = 39.7 bits (91),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  226999  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  227103

>ALLA:FR824088 dna:supercontig supercontig:ENA1:FR824088:1:131184:1 
REF
Length=131184

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 51/126 (40%), Gaps = 18/126 (14%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +  + P  
Sbjct  103872  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  103711

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
               Y         +  GF +      KG     +   T+ +++ W+E+   A++     +  A
Sbjct  103710  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNA  103567

Query  144     IDQSVS  149
                   VS
Sbjct  103566  SHSFVS  103549

>PHRA:scaffold_38
Length=442185

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  378001  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  377897

>PHCA:scaffold_2 PHYCAscaffold_2
Length=1925921

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +1

Query  23       CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
                 EGYVTKRGH  ++W+ RF  L+G+ +   +
Sbjct  1737859  WEGYVTKRGHLVRNWKSRFFTLEGNLVSCTW  1737951

>PHIF:NW_003303756.1 Phytophthora infestans T30-4 supercont1.3 
genomic scaffold, whole genome shotgun sequence
Length=5458067

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  3548866  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  3548762

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               G+V K+G   K+W+ RF+VL G   Q+ YY++ +  +P    +  PKGSF +  +E
Sbjct  238426  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT-SKLNP----TVKPKGSFQVITVE  238572

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 53/124 (43%), Gaps = 34/124 (27%)
 Frame = +2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS----N  78
               C G++ K G   KSW+ R+  L GS L  +YY+S              KGS   S    +
Sbjct  233927  CVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS-------------EKGSLLRSVSVVS  234061

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA--K  136
               IEPH  V           G  +  H+ RK  ++ D    +  + ++WL     A+    +
Sbjct  234062  IEPHPTV---------SLGLVVSTHSGRKLIMQAD----SNEEFDRWLSAIQGAVAGENE  234202

Query  137     RQLT  140
               R+LT
Sbjct  234203  RKLT  234214

>ALCA:scaffold_265 AcNc2_CONTIG_265_length_35910 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_265_length_35910:1:35910:1 
REF
Length=35910

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV  51
             T  EGY+ KRGH  +SWR RF VL G+ L  
Sbjct  9548  TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSC  9640

>PHCA:scaffold_9 PHYCAscaffold_9
Length=1114135

 Score = 39.7 bits (91),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               G+V K+G   K+W+ RF+VL G   Q+ YY++ A  +P    +T  KGSF +  +E
Sbjct  844406  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVNP----TTKAKGSFQVITVE  844552

>APIN:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.2:1:2980645:1 
REF
Length=2980645

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 65/133 (49%), Gaps = 21/133 (16%)
 Frame = -1

Query  17      KAQPTS---CEGYV-TKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKG  72
               ++QP+S    EG+V  +R HF  +W+  + VL G  L  A Y++R       G+ T  + 
Sbjct  276244  QSQPSSEIFLEGFVHLRRSHFGAAWKEHYCVLKGPWL--ATYDTREDFATAPGKPTSKRE  276071

Query  73      SFYLSNIEPHEYVIGV-MGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKW---LEV  128
                 ++ +     +  GV  G A   F  + +      GFVE   +V+   D+ +W   L+ 
Sbjct  276070  VVFVGD-----WYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQT  275924

Query  129     ACNALKAKRQLTR  141
               A ++LKA + +TR
Sbjct  275923  AVSSLKADQLVTR  275885

>ALLA:FR824502 dna:supercontig supercontig:ENA1:FR824502:1:15894:1 
REF
Length=15894

 Score = 39.7 bits (91),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -2

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQV  51
             T  EGY+ KRGH  +SWR RF VL G+ L  
Sbjct  7745  TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSC  7653

>SADI:scaffold_66 supercont1.66 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.66:1:301975:1 
REF
Length=301975

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 62/141 (44%), Gaps = 22/141 (16%)
 Frame = +3

Query  2       NILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
                +L   E  A+  G  K +     G + KRGH RK+W  RF VL  ++L+  YY+   + 
Sbjct  237681  KVLHPQESSASMGGAKKKEEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYKKPRSP  237854

Query  61      H---PPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV-------  110
               H     N +    +G   L+++   E      GA  RP+ F  V    R+  V       
Sbjct  237855  HISSTWNTDKRYLRGELRLADLIHVE----SSGADHRPYCF--VATFVRQANVLWLYHAH  238016

Query  111     -ELDVFVETQT--DRNKWLEV  128
                 +D  ++  +  DR+KW+ +
Sbjct  238017  STIDYHIQANSDDDRDKWIRL  238079

>ALLA:FR824075 dna:supercontig supercontig:ENA1:FR824075:1:147583:1 
REF
Length=147583

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +1

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNL  49
               EGYV KRGH  ++W++RF  L+G+ L
Sbjct  48742  WEGYVIKRGHLVRNWKMRFFTLEGNRL  48822

>PYVX:scaffold_5 pve_scaffold_5 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_5:1:126063:1 
REF
Length=126063

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 51/116 (44%), Gaps = 18/116 (16%)
 Frame = -2

Query  18     AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLS  77
              A     EGYV K+G +   W  R+L+LDG+ L   YY S+      +G +   +G   LS
Sbjct  13715  AHEVHWEGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEAR--SGRNL--RGRMQLS  13554

Query  78     NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               + P  Y         +  GF +      +G     +   T+ +++ W+E+   A+
Sbjct  13553  RVRPENY--------GKAHGFLI----ETRGHKSFHLCCTTELEKDMWVEMMQAAI  13422

>PHIF:NW_003303755.1 Phytophthora infestans T30-4 supercont1.4 
genomic scaffold, whole genome shotgun sequence
Length=5137561

 Score = 39.3 bits (90),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 65/132 (49%), Gaps = 23/132 (17%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  1389124  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  1388963

Query  83       EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                   I V G A   + F++      KGF +L  +  +Q +   W+     AL++ R+++  
Sbjct  1388962  ---IRVAGKA---YVFQI-----EKGFYKLLCYCCSQFEAELWVA----ALRSVRRVSPP  1388828

Query  143      AIDQSVSPNKKK  154
                  +  ++  ++K
Sbjct  1388827  CYEMDLTATEEK  1388792

>PHKE:scaffold_69 scf_22126_69.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_69.1:1:116444:1 
REF
Length=116444

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -2

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              T  EGY+ K+GH  +SWR R+ VL G  +  +YY S+
Sbjct  48994  TDWEGYIWKQGHVVRSWRYRYAVLSG--VTFSYYVSK  48890

>PHPA:scaffold_53 NW_008649039.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.53, whole genome shotgun 
sequence
Length=442537

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 34/132 (26%), Positives = 65/132 (49%), Gaps = 23/132 (17%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVL--DGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               G++TK+GH  KSW+ RF VL  DG+    AYY+++       G   +  G   + +++  
Sbjct  120919  GWLTKQGHMWKSWKTRFFVLFSDGT---FAYYKNKGR-KKIKGCMQLNDGVVSVQHVD--  121080

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                  I V G A   + F++     +KGF +L  +  +Q +   W+     AL++ R++   
Sbjct  121081  ---IRVAGKA---YVFQI-----QKGFYKLLCYCCSQFEAELWVA----ALRSVRRVAPP  121215

Query  143     AIDQSVSPNKKK  154
                 +  ++  ++K
Sbjct  121216  CYEMDLTATEEK  121251

>ALCA:scaffold_121 AcNc2_CONTIG_121_length_67320 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_121_length_67320:1:67320:1 
REF
Length=67320

 Score = 39.3 bits (90),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 18/111 (16%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
             EGYV K+G +   W  R+LVLDG+ L   YY ++             +G   +  + P  
Sbjct  6604  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL----RGKMMIVKVRPEN  6765

Query  84    YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
             Y         +  GF +      KG     +   T+ +++ W+E+   A++
Sbjct  6766  Y--------GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIE  6882

>PLHA:NW_020189293.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2386, whole genome shotgun sequence
Length=2296535

 Score = 39.3 bits (90),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
 Frame = -2

Query  9        PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                P  + + D    T  EGY+ K+GH  +SWR R+ VL G+    +YY S+
Sbjct  1002424  PDLSNAFDDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  1002284

>ALLA:FR824181 dna:supercontig supercontig:ENA1:FR824181:1:68077:1 
REF
Length=68077

 Score = 38.9 bits (89),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = +3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              T  EGY+ K+GH  +SWR R+ VL G+     Y  S
Sbjct  25908  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKYSSS  26015

>ALLA:FR824176 dna:supercontig supercontig:ENA1:FR824176:1:68905:1 
REF
Length=68905

 Score = 38.9 bits (89),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 0/36 (0%)
 Frame = -3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              T  EGY+ K+GH  +SWR R+ VL G+     Y  S
Sbjct  42602  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCKYSSS  42495

>APIN:scaffold_11 supercont1.11 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.11:1:1510989:1 
REF
Length=1510989

 Score = 38.9 bits (89),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 26/34 (76%), Gaps = 2/34 (6%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  876520  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  876615

>APAS:scaffold_49 supercont1.49 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.49:1:457786:1 
REF
Length=457786

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 26/34 (76%), Gaps = 2/34 (6%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               EG+V K+GH  ++W+VR+  L+G+ L  +YYE++
Sbjct  359787  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  359882

>SADI:scaffold_27 supercont1.27 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.27:1:696964:1 
REF
Length=696964

 Score = 38.9 bits (89),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  365903  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  365998

>PYIR:scaffold_3100 pir_scaffold_3100 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_3100:1:1877:1 
REF
Length=1877

 Score = 38.5 bits (88),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 49/110 (45%), Gaps = 18/110 (16%)
 Frame = +1

Query  11   ATASGDKAQPTSCEGYVTKRGHFRKS--WRVRFLVLDGSNLQVAYY--ESRAACHPPNGE  66
            ATA   +++ T+CE ++ +R    +S  W +RF     + +Q+A++  ++ +A  PP   
Sbjct  130  ATAQNTRSRRTNCETFLAERSRTTRSDFWCLRFCTASTTAIQMAWHS*KTTSALPPPTQR  309

Query  67   STMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV  116
              +P+    L      E +               + H PR+ FV L  FV
Sbjct  310  MRLPRSQRQLHQRLRDERL--------------RLPHLPRQNFVALGEFV  417

>APAS:scaffold_6 supercont1.6 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.6:1:1791376:1 
REF
Length=1791376

 Score = 38.9 bits (89),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 37/61 (61%), Gaps = 7/61 (11%)
 Frame = -3

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
                +G++ K+G    SW+ R+LVL G N  ++Y++ +   +P   E    KGSF L+ ++P+
Sbjct  124223  WQGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKE----KGSFVLAGVQPN  124065

Query  83      E  83
               +
Sbjct  124064  K  124062

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (52%), Gaps = 7/62 (11%)
 Frame = +1

Query  16       DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
                D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S  +      E T P+G   
Sbjct  1738996  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTS-----SEETFPRGVIS  1739154

Query  76       LS  77
                LS
Sbjct  1739155  LS  1739160

>APIN:scaffold_8 supercont1.8 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.8:1:1936381:1 
REF
Length=1936381

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 18/110 (16%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+LVLDG++L   YY S+       G++   +G   ++ + P  
Sbjct  307391  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEAR--TGKNL--RGRMIITRVLPEN  307230

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               Y     G A   F  + +GH          +   T+ +++ W+E+   A+
Sbjct  307229  Y-----GKA-HGFLIETMGHK------HFHLCCTTELEKDMWVEMMQAAI  307116

 Score = 35.4 bits (80),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 60/145 (41%), Gaps = 25/145 (17%)
 Frame = +3

Query  10      GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY----ESRAACHPPNG  65
               G  A+         EG V K+G +   W  R+LVLDG+ L+  YY    ++R   H    
Sbjct  285126  GIAATAGGMHSVHWEGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARLGKH----  285287

Query  66      ESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKW  125
                    +G   L+++ P      +    +  F  +  G   RK F    +  +T+ +++ W
Sbjct  285288  ----LRGKLILTHVSPE-----IHKKKEHTFAVETTG---RKMFF---MSCDTELEKDMW  285422

Query  126     LEVACNALKAKRQLTRQAIDQSVSP  150
               +E+   A+       RQ  ++   P
Sbjct  285423  VEMIQAAISEAAAPQRQHANRHGQP  285497

>PYIR:scaffold_1 pir_scaffold_1 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1:1:175201:1 
REF
Length=175201

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  155625  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  155729

>SAPA:scaffold_37 supercont2.37 dna:supercontig supercontig:ASM15154v2:supercont2.37:1:335642:1 
REF
Length=335642

 Score = 38.9 bits (89),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +1

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A
Sbjct  106645  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  106755

>ALCA:scaffold_34 AcNc2_CONTIG_34_length_127434 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_34_length_127434:1:127434:1 
REF
Length=127434

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNL  49
              EGYV KRGH  ++W++RF  L+G+ +
Sbjct  51363  EGYVIKRGHLVRNWKMRFFTLEGNRV  51286

>PYUU:scaffold_2034 scf1117875582034 dna:supercontig supercontig:pug:scf1117875582034:1:1169325:1 
REF
Length=1169325

 Score = 38.9 bits (89),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 2/42 (5%)
 Frame = +2

Query  16       DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                D    T  EGY+ K+GH  +SWR R+ +L G+    +YY S+
Sbjct  1065680  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  1065799

>PHPA:scaffold_42 NW_008649028.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.42, whole genome shotgun 
sequence
Length=594358

 Score = 38.5 bits (88),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 7/56 (13%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               G+V K+G   K+W+ RF+VL G   Q+ YY++          +  PKGSF +  +E
Sbjct  304013  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDTSKLV-----PTVKPKGSFQVITVE  304159

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 48/121 (40%), Gaps = 32/121 (26%)
 Frame = +3

Query  17      KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
               + +   C G++ K G   KSW+ R+  L GS L  +YY+S              KGS   
Sbjct  298470  RNESQGCVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKS-------------EKGSLLR  298604

Query  77      S----NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
               S    N+EPH  V           G  +     RK    L V  E+  + NKWL     A
Sbjct  298605  SVSVINVEPHPSV---------SLGLTVSTVGGRK----LIVQAESNGEFNKWLNAIQEA  298745

Query  133     L  133
               +
Sbjct  298746  V  298748

>PYVX:scaffold_291 pve_scaffold_291 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_291:1:31219:1 
REF
Length=31219

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -1

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAY  53
              T  EGY+ K+GH  +SWR R+ VL G+     +
Sbjct  29512  TDWEGYIWKQGHVVRSWRYRYAVLSGTTFSCKW  29414

>SAPA:scaffold_19 supercont2.19 dna:supercontig supercontig:ASM15154v2:supercont2.19:1:569072:1 
REF
Length=569072

 Score = 38.5 bits (88),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 28/34 (82%), Gaps = 2/34 (6%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               EG+V+K+GH  ++W++R+  L+ SNL ++YYES+
Sbjct  518276  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESK  518371

>SAPA:scaffold_2 supercont2.2 dna:supercontig supercontig:ASM15154v2:supercont2.2:1:1567649:1 
REF
Length=1567649

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 31/126 (25%), Positives = 56/126 (44%), Gaps = 29/126 (23%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGYV K+G +   W  R+LVLDG++L   YY ++      +G +   +G   ++ + P  
Sbjct  835917  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEAR--SGRNL--RGRMIITRVLPEN  836078

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
               Y         +  GF +      KG     +   T+ +++ W+E           + + A
Sbjct  836079  Y--------GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVE-----------MMQAA  836189

Query  144     IDQSVS  149
               ID+ +S
Sbjct  836190  IDEGIS  836207

 Score = 34.7 bits (78),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 49/115 (43%), Gaps = 17/115 (15%)
 Frame = +1

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               Q    EG+V K+G +   W  R+LVLDG+ L   YY  +   H       + +G   L+ 
Sbjct  832294  QEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQ---HDARSGKNL-RGRMVLTY  832455

Query  79      IEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               + P          + +  GF +      KG     +   T+ +++ W+E+   AL
Sbjct  832456  VGPDF-------KSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTAL  832587

>PHKE:scaffold_269 scf_22126_269.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_269.1_contig_1:1:49737:1 
REF
Length=49737

 Score = 38.5 bits (88),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 28/48 (58%), Gaps = 3/48 (6%)
 Frame = +2

Query  9      PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              PG  A G +  P +  G+V K G   +SW+ RFLV  G+ L  AYY++
Sbjct  15527  PGTGAMG-RTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN  15661

 Score = 37.4 bits (85),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 7/56 (13%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
              G+V K+G   K+W+ RF+VL G   Q+ YY++ A   P    +   KGSF +  +E
Sbjct  17525  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT-AKVSP----TVKAKGSFQVITVE  17671

 Score = 33.5 bits (75),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 0/43 (0%)
 Frame = +1

Query  8      EPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
              E G   +G +     CEG++ K G   K+W+ R++ L    L+
Sbjct  11314  EEGEYGAGQRYSTAVCEGWLDKLGQHSKTWKKRYVALSNGMLE  11442

>PHRA:scaffold_22
Length=569032

 Score = 38.5 bits (88),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 22/125 (18%)
 Frame = +3

Query  18      AQPTS-CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKG  72
               A PT    G + KRG   K+++ R++ LDGS L  AYY  +   H      + +    KG
Sbjct  395163  AVPTKLVSGVLRKRGEGFKAFKKRYMELDGSTL--AYYRKKPEKHGIPLSRDEKKGCEKG  395336

Query  73      SFYL---SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVA  129
               +  L   S+++P       M     PFGF +V  A  + +V   +  E++ + ++W++  
Sbjct  395337  NIDLEKVSSLQP-------MDNKSEPFGFLLVTTA--RTWV---LAAESEVEYHRWIKAL  395480

Query  130     CNALK  134
               C  +K
Sbjct  395481  CGVVK  395495

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -2

Query  61     HPPNGESTMPKGSFYLSNIEPHEYVIGVMGA  91
              +PP  E  +P G  +L NI PH Y IG+MGA
Sbjct  15735  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  15649

>SAPA:scaffold_467 supercont2.467 dna:supercontig supercontig:ASM15154v2:supercont2.467:1:7718:1 
REF
Length=7718

 Score = 38.1 bits (87),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 2/40 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
             T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A 
Sbjct  7465  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAA  7578

>SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.13:1:908568:1 
REF
Length=908568

 Score = 38.1 bits (87),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               T  EGY+ K+GH  ++WR R+ VL G+     YY S+ A
Sbjct  537378  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  537488

>PYAR:scaffold_1116 par_scaffold_1116 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1116:1:10258:1 
REF
Length=10258

 Score = 38.1 bits (87),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = +1

Query  21    TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             T  EGY+ K+GH  ++WR R+ +L G+    +YY S+
Sbjct  3823  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISK  3927

>HYAP:scaffold_29 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_29:1:564789:1 
REF
Length=564789

 Score = 38.1 bits (87),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 2/57 (4%)
 Frame = +1

Query  1      MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              M+ + +    A+ S         EGYV K+G +   W  R+L+LDG  L   YY S+
Sbjct  31486  MDDMLMDSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  31650

>PYAR:scaffold_3738 par_scaffold_3738 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_3738:1:2918:1 
REF
Length=2918

 Score = 37.7 bits (86),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 15/114 (13%)
 Frame = +1

Query  25    GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH--PPNGES--TMPKGSFYLSNIE  80
             GY+ KRG   +S++ R++ L+GS L  AYY+ +   +  P + E   +  +G+  L  + 
Sbjct  694   GYLRKRGEHNRSYKRRYMELNGSVL--AYYKKKPEKNGIPLSREDKKSCERGAIDLDRVT  867

Query  81    PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                  I  + A   PFG  +V            +  E+  D  +WL+  C+ +K
Sbjct  868   S----IQPIDAKSEPFGINLVTTNR-----TWSIAAESDQDYQRWLKSLCSVVK  1002

>SADI:scaffold_15 supercont1.15 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.15:1:848687:1 
REF
Length=848687

 Score = 38.1 bits (87),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 50/127 (39%), Gaps = 33/127 (26%)
 Frame = +2

Query  13     ASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG-------  65
              A  D AQP   EG +TKR  + K WR R+ VL G+ L    Y  RA    P+G       
Sbjct  76298  AVADLAQPDF-EGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGMIDLSEC  76462

Query  66     ----------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVGHAPRK  107
                              E   P+ ++Y+   + E  +  IG +G A   F     G     
Sbjct  76463  LTVKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---D  76633

Query  108    GFVELDV  114
              G+ E DV
Sbjct  76634  GYDEEDV  76654

>SADI:scaffold_69 supercont1.69 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.69:1:294325:1 
REF
Length=294325

 Score = 37.7 bits (86),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 2/30 (7%)
 Frame = +1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
               G++ K GH RK+W+ RF VLDGS LQ  YY
Sbjct  265147  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  265230

>PYVX:scaffold_44 pve_scaffold_44 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_44:1:74626:1 
REF
Length=74626

 Score = 37.7 bits (86),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 9/74 (12%)
 Frame = +1

Query  9      PGATASGDKAQPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
              P A  +G K      +  G+V K+G   ++W+ RF+VL G   Q+ YY++ A   P    
Sbjct  13933  PTAARAGRKMSLEDADHAGWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT-ARLTP----  14091

Query  67     STMPKGSFYLSNIE  80
              S   KGSF L  +E
Sbjct  14092  SVKAKGSFTLITVE  14133

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 27/45 (60%), Gaps = 2/45 (4%)
 Frame = +1

Query  12     TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              T+   + +  +  G+V K G   +SW+ RFLV  G++L  AYY++
Sbjct  12040  TSMARRGEQVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYYKN  12168

>PYVX:scaffold_47 pve_scaffold_47 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_47:1:73819:1 
REF
Length=73819

 Score = 37.7 bits (86),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 2/54 (4%)
 Frame = +1

Query  7     PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
             P+  AT S D  +   C G++ K+G    SW+ R+  L GS L+  YY+S    
Sbjct  8296  PDALATNSLDGGKLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKSETGA  8451

>ALCA:scaffold_49 AcNc2_CONTIG_49_length_115235 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_49_length_115235:1:115235:1 
REF
Length=115235

 Score = 37.7 bits (86),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 4/63 (6%)
 Frame = +2

Query  3      ILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
              I+ +       S D+ Q  + EG +TKR  + K WR R+ +L G+ L    Y S++    
Sbjct  38837  IMSIKNDEENLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKSKNDA  39004

Query  63     PNG  65
              P+G
Sbjct  39005  PHG  39013

>PHIF:NW_003303710.1 Phytophthora infestans T30-4 supercont1.49 
genomic scaffold, whole genome shotgun sequence
Length=1170383

 Score = 37.7 bits (86),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
               GY+ K+G F KSWR RF +L      + YY S
Sbjct  756116  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  756021

>PYVX:scaffold_1190 pve_scaffold_1190 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1190:1:6005:1 
REF
Length=6005

 Score = 37.4 bits (85),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 48/112 (43%), Gaps = 14/112 (13%)
 Frame = -1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEP  81
             S  G++ K GH RK+W+ R+ VL+ S L+    ESR+      GE  +     +      
Sbjct  1958  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL---KGEVLL-----FHPATRV  1803

Query  82    HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
             H   I + G  D  F  + VG         L +  E  +DR  W+    +AL
Sbjct  1802  HYVDIHLSGGRDNTFAIQ-VGSD-----YTLLLQAERLSDRENWMYCIEDAL  1665

>SAPA:scaffold_273 supercont2.273 dna:supercontig supercontig:ASM15154v2:supercont2.273:1:15865:1 
REF
Length=15865

 Score = 37.4 bits (85),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 29/54 (54%), Gaps = 4/54 (7%)
 Frame = -2

Query  14    SGDKAQPT--SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
             SG++A P      GYV K+G F K+W+ RF+VL    L   YY S  A   P G
Sbjct  2973  SGNEAPPGPPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAMAKPRG  2818

>PHPA:scaffold_98 NW_008649084.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.98, whole genome shotgun 
sequence
Length=151830

 Score = 37.4 bits (85),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F KSWR RF +L      + YY S
Sbjct  62031  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  61936

>SAPA:scaffold_6 supercont2.6 dna:supercontig supercontig:ASM15154v2:supercont2.6:1:961754:1 
REF
Length=961754

 Score = 37.4 bits (85),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 49/125 (39%), Gaps = 33/125 (26%)
 Frame = +3

Query  15      GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG---------  65
                D AQP   EG +TKR  + K WR R+ VL G+ L    Y  RA    P+G         
Sbjct  503388  ADLAQP-DFEGELTKRSVWLKEWRARYFVLKGNKL----YFCRAQGEAPHGVIDLSECLT  503552

Query  66      --------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGF  109
                             E   P+ ++Y+   + E  +  IG +G A   F     G     G+
Sbjct  503553  VKSAEEKTNKRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGY  503723

Query  110     VELDV  114
                E DV
Sbjct  503724  DEEDV  503738

>ALCA:scaffold_13 AcNc2_CONTIG_13_length_192192 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_13_length_192192:1:192192:1 
REF
Length=192192

 Score = 37.4 bits (85),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 2/38 (5%)
 Frame = -3

Query  21      TSCEGYVTKRGHFRKSWRVRFLVLDGS--NLQVAYYES  56
               T  EGY+ K+GH  +SWR R+ VL G+  +  VA+ +S
Sbjct  137083  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQS  136970

>PYIW:scaffold_1215 piw_scaffold_1215 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1215:1:10379:1 
REF
Length=10379

 Score = 37.4 bits (85),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (59%), Gaps = 7/56 (13%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
             G+V K+G   ++W+ RFLVL G   Q+ YY++ A+  P     T  KGSF +  +E
Sbjct  9234  GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT-ASLTPK----TKEKGSFQVITVE  9088

>PYAP:scaffold_87 pag1_scaffold_87 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_87:1:70840:1 
REF
Length=70840

 Score = 37.4 bits (85),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
             EGY+ K+G   K W+ R+ V DG  L  +YY SR    P
Sbjct  5436  EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSRRDSKP  5546

>APIN:scaffold_59 supercont1.59 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.59:1:326880:1 
REF
Length=326880

 Score = 37.4 bits (85),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 50/116 (43%), Gaps = 24/116 (21%)
 Frame = -1

Query  17      KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
               +A   S EG++ KRG   K+W+ R+  L+G  L+  Y E         G    PKG    
Sbjct  308091  RASMRSFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME---------GPGAKPKG----  307957

Query  77      SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNA  132
                    +  V+GV    + P+    +   P +    LDV  E+  ++  W++   +A
Sbjct  307956  -----YGMVVGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQRILDA  307816

 Score = 33.5 bits (75),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 5/60 (8%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPN-----GESTMPKGSFYLSNI  79
               GY+T +  F  +W+  F  L G  L VA +E  AA              MP  SF LS I
Sbjct  305835  GYMTIQTGFFGTWKTCFFTLQGIELSVADHEGMAASRSDTIAFVAASRGMPSSSFGLSRI  305656

 Score = 33.5 bits (75),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = -1

Query  10      GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               G  +S D A  T+CEG++ K+G   K+W+ R+  L G  L     +S  A
Sbjct  307590  GIQSSLDTA--TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVA  307447

>PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:pug:scf1117875582035:1:696189:1 
REF
Length=696189

 Score = 37.4 bits (85),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 61/133 (46%), Gaps = 19/133 (14%)
 Frame = -2

Query  19      QP-TSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
               QP  +  GYV  R HF  + WR RF+VL G++   AY    ++    + E    K +   
Sbjct  260279  QPRIALNGYVRVRHHFLGAIWRERFMVLHGTS---AYLYPDSSAATEDDEQLERKKALEK  260109

Query  77      SNI----EPHEYVIGVMGAA---DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEV-  128
                N+    + H   +   G+A      +GF++   A   G++E    V T+ ++ +W++  
Sbjct  260108  HNLVAIAKWHPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE--CIVATEQEQTQWMKTI  259941

Query  129     --ACNALKAKRQL  139
                 A  AL A  QL
Sbjct  259940  SDAVTALSASSQL  259902

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 3/56 (5%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
               EGY+ KRGH   S R R+ VL      + YY +      P   S  P GSF +  +
Sbjct  263024  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNP---SVAPHGSFRVDTV  262866

>PHKE:scaffold_626 scf_22126_626.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_626.1_contig_1:1:14504:1 
REF
Length=14504

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 31/143 (22%), Positives = 58/143 (41%), Gaps = 26/143 (18%)
 Frame = +1

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
             EG+V K+G +   W  R+L+LDG+ L   YY S+             +G   +  + P  
Sbjct  4123  EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARN----LRGRMIIVKVRPEN  4284

Query  84    YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK-----AKRQ  138
             Y         +  GF +      +G     +   T+ +++ W+E+   A++         
Sbjct  4285  Y--------GKAHGFLI----ETQGHKHFHLCCSTELEKDMWVEMMQAAIEEGVRHGPNS  4428

Query  139   LTRQAIDQ---SVSPNKKKLFGF  158
             ++ + +D      SP +  L GF
Sbjct  4429  MSLEGMDALALQASPTQVDLRGF  4497

>PYIR:scaffold_1235 pir_scaffold_1235 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1235:1:9021:1 
REF
Length=9021

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)
 Frame = -2

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             S EGY+ K+    +SW+  + VL+G  +  AYYESR
Sbjct  3614  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESR  3513

>PHSO:scaffold_3
Length=10773376

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
                GY+ K+G F KSWR RF +L      + YY S
Sbjct  3934639  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  3934544

 Score = 33.5 bits (75),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 2/34 (6%)
 Frame = -1

Query  24       EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                EG++ K+G   K W+ R+ V DG  L  +YY SR
Sbjct  2073133  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR  2073038

>ALCA:scaffold_33 AcNc2_CONTIG_33_length_129266 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_33_length_129266:1:129266:1 
REF
Length=129266

 Score = 37.4 bits (85),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 51/123 (41%), Gaps = 12/123 (10%)
 Frame = +2

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
              EGY+ KR  + K W   + VL G  L   Y     A H P+ +S +  G  ++ +     
Sbjct  23726  EGYLQKRSDWLKHWETFYFVLKGRYL-YCYLSEEDARHQPD-KSRIKNGKLFVFS-----  23884

Query  84     YVIGVMGAAD----RPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQL  139
              + I VM A D     P    M  HA              QT++  +LE   N+ +A +Q+
Sbjct  23885  HRITVMKAWDVEDPLPVNTAMSNHARSTAPNSFSFRFTLQTEKGHYLEFRTNS-QASKQM  24061

Query  140    TRQ  142
                Q
Sbjct  24062  WLQ  24070

>PHRA:scaffold_66
Length=301783

 Score = 37.4 bits (85),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F KSWR RF +L      + YY S
Sbjct  68663  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  68568

>PHCA:scaffold_42 PHYCAscaffold_42
Length=526029

 Score = 37.0 bits (84),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 3/54 (6%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR-AACHPPNGESTMPKGSFYL  76
               EGY+ KRGH   S R R+ VL G+ L  +YY +   + +P  G  T P G+F++
Sbjct  350103  EGYLMKRGHKIPSMRKRYCVLIGNEL--SYYVTHDDSKNPGGGAMTNPLGNFHI  349948

>HYAP:scaffold_99 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_99:1:256057:1 
REF
Length=256057

 Score = 37.0 bits (84),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F KSWR RF +L      ++YY S
Sbjct  21634  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  21539

>ALCA:scaffold_55 AcNc2_CONTIG_55_length_103441 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_55_length_103441:1:103441:1 
REF
Length=103441

 Score = 37.0 bits (84),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              GY+ K+G F KSWR RF +L      +AYY S+
Sbjct  93098  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASK  93000

>SADI:scaffold_77 supercont1.77 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.77:1:267713:1 
REF
Length=267713

 Score = 37.0 bits (84),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 53/119 (45%), Gaps = 16/119 (13%)
 Frame = -3

Query  37      WRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVI-----GVMGA  91
               W+ R+ VL  S L + YYES  A    + +  +P  S +  + +PH + +     G++G+
Sbjct  198066  WKRRYCVLQESALAIFYYESEEAAAEGSLKGKIPYCSVHDWDGKPHGFQVDTPYRGILGS  197887

Query  92      ADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSP  150
                     +       R       V+ ++  +RNKW+     A++A+     +  D  ++P
Sbjct  197886  CTCT*FYTPTNKCFR-------VYCDSDDERNKWM----TAMQAQLDNAPEVADGELAP  197743

>PHKE:scaffold_90 scf_22126_90.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_90.1:1:106827:1 
REF
Length=106827

 Score = 37.0 bits (84),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F KSWR RF +L      + YY S
Sbjct  86298  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  86203

>PLHA:NW_020190023.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3120, whole genome shotgun sequence
Length=2481951

 Score = 37.0 bits (84),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = -3

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
                GY+ K+G F KSWR RF +L      + YY S
Sbjct  1843159  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  1843064

>APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.15:1:1122121:1 
REF
Length=1122121

 Score = 37.0 bits (84),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                T  EGYV K+GH  ++WR R+ +L G+     YY S+
Sbjct  1066084  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1066188

>PHIF:NW_003303737.1 Phytophthora infestans T30-4 supercont1.22 
genomic scaffold, whole genome shotgun sequence
Length=2337630

 Score = 37.0 bits (84),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 1/51 (2%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
               EGY+ KRGH   S R R+ VL G+ L   Y     + +P  G +T P G+F
Sbjct  529101  EGYLMKRGHKIPSMRKRYCVLIGNELTY-YVTHDDSKNPGGGATTNPLGNF  528952

>ALCA:scaffold_29 AcNc2_CONTIG_29_length_140563 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_29_length_140563:1:140563:1 
REF
Length=140563

 Score = 37.0 bits (84),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 56/144 (39%), Gaps = 47/144 (33%)
 Frame = -2

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH---PPNGESTMP---------K  71
              +G++ KRGH +K+W+ RF  ++   LQ  + E+R       P NG    P         K
Sbjct  17295  DGFLWKRGHLKKNWKKRFFRVENGQLQY-FTENRKLMKGAIPLNGTVVSPGMTCCPDGRK  17119

Query  72     GSFYLSNI--------------EPHEYV---------IGVMGAADRPFGFKMV----GHA  104
                F +SN+              E HE++          G     + P GF +V       
Sbjct  17118  NYFVISNMSHTKELHLNAETEAEMHEWIEALQRAQCGFGRQKTIEEPTGFALVVKRAEEI  16939

Query  105    PRKGFV-------ELDVFVETQTD  121
              P   F        E+D+ +E +T+
Sbjct  16938  PMISFYATYSKSSEIDIVMERKTE  16867

>PHPA:scaffold_25 NW_008649011.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.25, whole genome shotgun 
sequence
Length=859936

 Score = 36.6 bits (83),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (55%), Gaps = 1/51 (2%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSF  74
              EGY+ KRGH   S R R+ VL G+ L   Y     + +P  G +T P G+F
Sbjct  90806  EGYLMKRGHKIPSMRKRYCVLIGNELTY-YVTHDDSKNPGGGATTNPLGNF  90657

>PYUU:scaffold_2011 scf1117875582011 dna:supercontig supercontig:pug:scf1117875582011:1:418791:1 
REF
Length=418791

 Score = 36.6 bits (83),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
               S EGY+ K+    +SW+  + VL+G  +  AYYESR
Sbjct  318848  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESR  318747

>PYAR:scaffold_995 par_scaffold_995 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_995:1:11277:1 
REF
Length=11277

 Score = 36.6 bits (83),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 6/51 (12%)
 Frame = +1

Query  6     LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
             +  PG T  G     T  +G++ K G   KSW+ R+ VLDG+ L   YYE+
Sbjct  6868  VASPGTTTPG----ATIKKGWLRKEGQRMKSWKRRYFVLDGTRLH--YYEN  7002

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (44%), Gaps = 24/116 (21%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
             C G++ K+G   KSW+ RF  L G+ L+  Y+++     P  G +T              
Sbjct  7864  CSGWLRKQGGHIKSWKERFFTLVGTTLR--YFKTENG--PFIGGAT--------------  7989

Query  83    EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQ  138
               ++ V+    R   F+M  ++ RK    + V  E++ +  +W+     A+   R+
Sbjct  7990  --IVHVLLIHTRKHSFEMTLNSGRK----MAVLAESEGEAERWIRALKRAIAVARE  8139

>PYUU:scaffold_1722 scf1117875581722 dna:supercontig supercontig:pug:scf1117875581722:1:328448:1 
REF
Length=328448

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = +2

Query  1      MNILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
              M++++ P P  + S    +P    G++ K+GH  +SW+ R+ VL G +LQ  Y+E+    
Sbjct  76295  MDLVKAP-PSLSPS--IVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN--ID  76453

Query  61     HPPNG  65
               PP G
Sbjct  76454  KPPRG  76468

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 9/75 (12%)
 Frame = +3

Query  2      NILRLPEPGATASGDKAQPTSCE--GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
              ++L    P   A G +A     +  G+V K+G   ++W+ RF+VL G   Q+ YY++ A+
Sbjct  47976  SLLEREAPAFRAIGTRA*SMEAQHSGWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT-AS  48146

Query  60     CHPPNGESTMPKGSF  74
                P     T  KGSF
Sbjct  48147  ISPK----TKEKGSF  48179

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +2

Query  18     AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
              A   +CEG++ K+GH  K W+ R+  L+   L+
Sbjct  75929  ASSQTCEGWLLKQGHKSKRWKRRYFTLNNDMLE  76027

>PYAR:scaffold_267 par_scaffold_267 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_267:1:23113:1 
REF
Length=23113

 Score = 36.6 bits (83),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 24/42 (57%), Gaps = 4/42 (10%)
 Frame = +3

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
             EG +TKR  + K WR RF VL G+ L    Y  RAA  P +G
Sbjct  2250  EGELTKRSVWLKEWRRRFFVLKGNKL----YFCRAAKEPAHG  2363

>APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.12:1:1527504:1 
REF
Length=1527504

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
               EGY+ K+G   K W+ R+ V DG +L  +YY S+    P
Sbjct  486848  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKP  486958

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)
 Frame = +2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
               EGY+ K+G   K W+ R+ V DG +L  +Y+ ++A   P
Sbjct  489917  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTP  490027

>PYAP:scaffold_11 pag1_scaffold_11 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_11:1:137235:1 
REF
Length=137235

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 48/115 (42%), Gaps = 24/115 (21%)
 Frame = -1

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
              C G++ K G   K+W+ RF  L G+ L+  Y++S              KGSF    +  +
Sbjct  57600  CSGWLNKEGGKVKTWKRRFFTLHGTTLK--YFKS-------------DKGSF----LRTY  57478

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKR  137
              E V  V       FGF +  +  RK    + V  ET  +  KWL      L  +R
Sbjct  57477  E-VNAVEELPSLKFGFCVTMNGGRK----MIVTAETNEEYEKWLLAIWGVLADQR  57328

 Score = 35.8 bits (81),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (43%), Gaps = 20/122 (16%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
              G++ K+G   K+W+ RF+VL G   Q+ YY++     P   E    KGSF          
Sbjct  54496  GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTE-RISPRVKE----KGSF---------Q  54365

Query  85     VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQAI  144
              VI V  ++D   G  + G   R     L ++ ++  + N W     +A          A+
Sbjct  54364  VITVELSSDIQNGLIVHGRGGRV----LKLYTDSTDNTNGWYHAIMDATNNTGGGGGSAV  54197

Query  145    DQ  146
              D+
Sbjct  54196  DR  54191

>PYUU:scaffold_2006 scf1117875582006 dna:supercontig supercontig:pug:scf1117875582006:1:1270039:1 
REF
Length=1270039

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 2/45 (4%)
 Frame = -2

Query  11      ATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
               AT +      T   G++ K+GH  KSW+ RF V++GS   + Y+E
Sbjct  804363  ATVTSGSDSGTRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  804235

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 45/112 (40%), Gaps = 24/112 (21%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
               CEG++ KRG    +W+ RF  L+G  LQ  Y +S      P GE +              
Sbjct  804747  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ--YQDSPG--ENPKGEGS--------------  804622

Query  83      EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                 V+ +    +  F  ++     R     L V  ++Q   N W++  C  L+
Sbjct  804621  --VVDIQLGDEGTFSMEIQLDTGRI----LSVTADSQDQVNMWVDAICTVLE  804484

>PYIR:scaffold_47 pir_scaffold_47 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_47:1:69492:1 
REF
Length=69492

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = -2

Query  18     AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
              A+   CEG++ KRG    +W+ RF  L+G  LQ
Sbjct  54407  AETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  54309

>APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.14:1:1185136:1 
REF
Length=1185136

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = +1

Query  21       TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
                T  EGYV K+GH  ++WR R+ +L G+     YY S+
Sbjct  1143919  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  1144023

>PLHA:NW_020187350.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_430, whole genome shotgun sequence
Length=1405462

 Score = 36.2 bits (82),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 21/117 (18%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH-PPNG---ESTMPKGSFYL---S  77
               GY+ K+G   K+++ R++ L+GS L  AYY+ +   +  P G   + T+ +G   L   S
Sbjct  369455  GYLRKKGEKNKAFKRRYMELNGSVL--AYYKKKPEKNGIPLGREEKKTLERGRIDLDRVS  369628

Query  78      NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
               +++P       M +   P+G  +V  A R   +  D  VE+Q    +WL+  C+ +K
Sbjct  369629  SLQP-------MESKTEPYGILLVTTA-RTWAICADSEVESQ----RWLKGLCDVVK  369763

 Score = 33.9 bits (76),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
               EG++ K+G   K W+ R+ V DG  L  +YY SR    P
Sbjct  769638  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKDRRP  769748

>PHPA:scaffold_6 NW_008648992.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.6, whole genome shotgun 
sequence
Length=2202294

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (48%), Gaps = 21/117 (18%)
 Frame = -1

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYL---S  77
                G + KRG   K+++ R++ LDGS L  AYY+ +   H      + +    +G   L   S
Sbjct  1451397  GILRKRGEGIKAFKKRYMELDGSVL--AYYKKKPEKHGIPLSRDEKKAYERGCIDLDRVS  1451224

Query  78       NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                +++P       M     P+GF +V  A R   +  D    ++T+ ++W++  C  +K
Sbjct  1451223  SLQP-------MDNKSEPYGFLLVTTA-RTWVLAAD----SETEYHRWIKALCGVVK  1451089

>PHRA:scaffold_82
Length=214170

 Score = 36.2 bits (82),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)
 Frame = +2

Query  12     TASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ--VAYYESRAACHPPNGESTM  69
              T  G   +    EGY+ KRGH   S R R+ VL G+ L   V + +S+   +P  G +T 
Sbjct  78770  TTEGPVNEAILVEGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSK---NPGGGATTA  78940

Query  70     PKGSFYLSNI  79
              P G F ++ +
Sbjct  78941  PLGKFRVAVV  78970

>PYIW:scaffold_784 piw_scaffold_784 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_784:1:14159:1 
REF
Length=14159

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 4/47 (9%)
 Frame = -3

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTM  69
              CEG++ KRG    +W+ RF  L+G   Q+ Y E+      P GE ++
Sbjct  11703  CEGWLYKRGQRSTAWKKRFFTLNG--FQLTYQENPG--DNPKGEGSV  11575

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 3/41 (7%)
 Frame = -2

Query  16     DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              D++ P  C GY+ K G   KSW++R+  L G+ L  +Y++S
Sbjct  10108  DESLP-GCSGYLRKEGSTIKSWKLRYFTLTGTTL--SYFKS  9995

>PHIF:NW_003303749.1 Phytophthora infestans T30-4 supercont1.10 
genomic scaffold, whole genome shotgun sequence
Length=3761764

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (48%), Gaps = 21/117 (18%)
 Frame = +3

Query  25       GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYL---S  77
                G + KRG   K+++ R++ LDGS L  AYY+ +   H      + +    +G   L   S
Sbjct  3280518  GILRKRGEGIKAFKKRYMELDGSVL--AYYKKKPEKHGIPLSRDEKKAYERGCIDLDKVS  3280691

Query  78       NIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                +++P       M     P+GF +V  A R   +  D    ++T+ ++W++  C  +K
Sbjct  3280692  SLQP-------MDNKSEPYGFLLVTTA-RTWVLAAD----SETEYHRWIKALCGVVK  3280826

>PLHA:NW_020188201.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_1286, whole genome shotgun sequence
Length=27542

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 8/57 (14%)
 Frame = -2

Query  4     LRLPEPGATASGDKAQPTSCEGYVTKRGHF--------RKSWRVRFLVLDGSNLQVA  52
             ++LPE     +  + + T  +GY+ K+G          RK+W+ R+ +L GSNL  A
Sbjct  8446  VQLPEQKVIEAAQEKEVTELQGYLIKQGGGGNVLNPLRRKNWKQRYFILTGSNLIYA  8276

>PHPA:scaffold_2 NW_008648988.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.2, whole genome shotgun 
sequence
Length=2916180

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 55/127 (43%), Gaps = 26/127 (20%)
 Frame = -3

Query  12       TASGDKAQ--------PTSCEGYVTKR---GHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
                T++ DKAQ        P    GY+ KR     +  SWR  F VL G+ L+  +Y S+   
Sbjct  2779033  TSARDKAQALTHAQHPPRLFGGYLRKRYSSSMYMGSWR--FCVLQGARLR--WYRSKECA  2778866

Query  61       HPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQT  120
                       T  +G  ++ +IEP +   G    A  P  F +   + +     L    ETQ 
Sbjct  2778865  E----TDTQLRGEVWVQSIEPWD---GRTALATYPHAFAVRTTSKKL----LLCTAETQR  2778719

Query  121      DRNKWLE  127
                DR+ WL+
Sbjct  2778718  DRDLWLQ  2778698

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 8/57 (14%)
 Frame = -1

Query  4        LRLPEPGATASGDKAQPTSCEGYVTKRGHF--------RKSWRVRFLVLDGSNLQVA  52
                ++LPE     +    + T  +GY+ K+G          RK+W+ R+ +L G+NL  A
Sbjct  1713780  VQLPEQKVIEAAQDKEVTELQGYLIKQGGGGNVLNPLGRKNWKQRYFILIGANLIYA  1713610

>ALLA:FR824107 dna:supercontig supercontig:ENA1:FR824107:1:102118:1 
REF
Length=102118

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 58/136 (43%), Gaps = 11/136 (8%)
 Frame = +3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA-ACHPPNGESTMPKGSFYLSNIEPH  82
              EGY+ KRGH   S R R+ VL   N  + Y+E++  A     G   +  G F + N+   
Sbjct  26529  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDADSFQYGLKAL--GEFQIGNVCDW  26702

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQ  142
                  G         G ++     R  F        ++ +R  W+    +A+ ++  L  +
Sbjct  26703  N---GRTLTQTYKNGMQVEACDGRVYFCA----ASSENERESWIRAFHHAIVSREALC-E  26858

Query  143    AIDQSVSPNKKKLFGF  158
              A +   SP ++KLF F
Sbjct  26859  APESLFSPLRQKLFNF  26906

>APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.2:1:2059303:1 
REF
Length=2059303

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +3

Query  24       EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
                EGY+ K+G   K W+ R+ V DG +L  +YY ++    P
Sbjct  1220973  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKLEKKP  1221083

>PHCA:scaffold_72 PHYCAscaffold_72
Length=230452

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)
 Frame = +2

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F KSW+ RF +L      + YY S
Sbjct  70904  GYLVKQGSFWKSWKRRFFILRRDRPVLCYYTS  70999

>ALCA:scaffold_25 AcNc2_CONTIG_25_length_153538 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_25_length_153538:1:153538:1 
REF
Length=153538

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 33/56 (59%), Gaps = 8/56 (14%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
              G+V K+G   K+W+ RF+VL+G+ L+  YY S ++        T  KGS  + ++E
Sbjct  24954  GWVYKQGAIVKTWKRRFMVLNGTELK--YYNSSSSM------KTEEKGSVQILSVE  25097

>APIN:scaffold_10 supercont1.10 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.10:1:1522286:1 
REF
Length=1522286

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 52/129 (40%), Gaps = 8/129 (6%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGY+ KR  + K W   + VL G  L     E  A  HP +  S +  G F +S+    +
Sbjct  173493  EGYLMKRSDWLKHWDTYYFVLHGRVLYCYLSEEEAKVHPES--SKIKHGKFSISDSLILD  173320

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLTRQA  143
                V  V       F F+           ++ +  +T+  +  W+ +A + +        QA
Sbjct  173319  EVFSVRSRHHYEFIFE------NDQGKQIYLRAKTEASKQMWMHMASHGIVDNYTDHDQA  173158

Query  144     IDQSVSPNK  152
               ++   +P +
Sbjct  173157  LNMRRAPQR  173131

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 29/65 (45%), Gaps = 2/65 (3%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHE  83
               EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+    +
Sbjct  169688  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SRIKDGRFTFSDKVVLD  169515

Query  84      YVIGV  88
                VI +
Sbjct  169514  KVIDI  169500

>PHSO:scaffold_13
Length=2041583

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = -3

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQ--VAYYESRAACHPPNGESTMPKGSF  74
               EGY+ KRGH   S R R+ VL G+ L   V + +S+   +P  G +T P G+F
Sbjct  359721  EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSK---NPGGGATTNPLGNF  359572

>PYIW:scaffold_1511 piw_scaffold_1511 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1511:1:8511:1 
REF
Length=8511

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +1

Query  22    SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRA  58
             S  G++ K GH RK+W+ R+ VLD S L+    ES A
Sbjct  3250  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLA  3360

>PYAP:scaffold_747 pag1_scaffold_747 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_747:1:14717:1 
REF
Length=14717

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 2/30 (7%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
              G++ K GH RK+W++R+ VLD S L+  YY
Sbjct  13541  GWLRKLGHVRKNWKLRYFVLDKSVLR--YY  13458

>PYIW:scaffold_525 piw_scaffold_525 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_525:1:17108:1 
REF
Length=17108

 Score = 35.8 bits (81),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -1

Query  6     LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
             + EP   A    A+P    G++ K+G   KSW+ R+ VL+G +LQ
Sbjct  5156  VAEPVEAAPAIVAEPEIKYGWLLKQGSLIKSWKRRYFVLEGDSLQ  5022

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -1

Query  7     PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
             P P   A+     P  C G++ K G   K+W+ R+  L G+ L+  Y++S
Sbjct  4172  PTPDDVATEQPLTPGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR--YFKS  4029

>SAPA:scaffold_66 supercont2.66 dna:supercontig supercontig:ASM15154v2:supercont2.66:1:187659:1 
REF
Length=187659

 Score = 35.8 bits (81),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (4%)
 Frame = -2

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
               EGY+ KR  + K W   + VL G  L     E  A  HP N  S +  G F  S+
Sbjct  179996  EGYLMKRSDWLKHWETYYFVLHGRVLCCYLSEDDARLHPEN--SKIKDGRFTFSD  179838

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 36/84 (43%), Gaps = 5/84 (6%)
 Frame = -3

Query  8       EPGATASGDK---AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPN  64
               E   TAS D    A  T  EGY+ KR  + K W   + VL G  L        A   P N
Sbjct  183358  ETTTTASVDTPAVAVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN  183179

Query  65      GESTMPKGSFYLSNIEPHEYVIGV  88
                 S +  G+F  ++    ++V+ +
Sbjct  183178  --SKIKHGAFSFTSHVVLQHVVSI  183113

>PYAR:scaffold_2807 par_scaffold_2807 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2807:1:4275:1 
REF
Length=4275

 Score = 35.4 bits (80),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 6/50 (12%)
 Frame = +2

Query  12    TASGDKAQ----PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             T   D+AQ    P   EGYV +RG +   W   +L +DG  L+  +YES+
Sbjct  1028  TLQSDRAQMKMLPILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESK  1171

>SADI:scaffold_17 supercont1.17 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.17:1:803178:1 
REF
Length=803178

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 7/57 (12%)
 Frame = -2

Query  23      CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNI  79
                 G+V K+G   KSW+ RFLV+ G +  V+YY+   + H P+      KGS  L ++
Sbjct  253370  WSGFVFKQGSLIKSWKKRFLVVQGRH--VSYYDR--SVHEPDPRE---KGSLVLGDV  253221

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = -2

Query  19      QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
               +P  C G + K+G   K+WR R+  +DG + Q++Y  S A   PP G
Sbjct  252611  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY--SDAETEPPKG  252480

>ALLA:FR824244 dna:supercontig supercontig:ENA1:FR824244:1:48268:1 
REF
Length=48268

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 50/120 (42%), Gaps = 15/120 (13%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGES----TMPKGSFYLSNI  79
              EGY+ K+G   K W+ R+ V DG  L  +YY +     P    S    T+  G    +  
Sbjct  13532  EGYLQKKGQRLKGWKQRWFVCDGRTL--SYYITSKDRRPNAIISLDGCTVQDGGMSETWQ  13359

Query  80     EPHEY-------VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVE-TQTDRNKWLEVACN  131
               P  Y       V+  + + D P     + H  RK   +L      TQTD+   L V+C+
Sbjct  13358  SPRIYLTDRATGVLYCLSSEDAPVVIDWL-HVLRKAVAQLSTETHTTQTDKRIPLPVSCD  13182

>PHRA:scaffold_1
Length=1244001

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +2

Query  25      GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               G + KRG  +RK W++RF+ LDG   Q+AYYE   A
Sbjct  529454  GSLEKRGFRWRKKWKLRFVELDGR--QLAYYEDTGA  529555

>PYAR:scaffold_799 par_scaffold_799 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_799:1:13125:1 
REF
Length=13125

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 37/77 (48%), Gaps = 8/77 (10%)
 Frame = -1

Query  2     NILRLPEP----GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             ++L  PEP     A  S  +      EGY+ KRGH   S R R+ VL  + L   YY ++
Sbjct  6765  SLLPAPEPVDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQ  6592

Query  58    AACHPPNGESTMPKGSF  74
                   N +++ P GSF
Sbjct  6591  EDSR--NSDTSQPLGSF  6547

>PYIW:scaffold_651 piw_scaffold_651 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_651:1:15595:1 
REF
Length=15595

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 2/36 (6%)
 Frame = -3

Query  22     SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              S EGY+ K+    ++W+  + VL+G  +  AYYESR
Sbjct  12473  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESR  12372

>APAS:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.4:1:1887962:1 
REF
Length=1887962

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)
 Frame = -2

Query  20       PTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
                P   EGY+ KRG +   W    +VLDG  L+V+YY+
Sbjct  1422163  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYD  1422062

>SADI:scaffold_10 supercont1.10 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.10:1:1089536:1 
REF
Length=1089536

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 38/94 (40%), Gaps = 20/94 (21%)
 Frame = +3

Query  204     NEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTR-------------  250
                E+V   ++L  + +DL A  R+     KLLHR     LH F    R             
Sbjct  617448  GEVVQAEQQL--LAKDLDATQREAVAAAKLLHRFAHVHLHRFKHHGRVVAVLKRRKQLHN  617621

Query  251     -----PKVPLGDHPHHSGSTSPSRLIPAIEITRD  279
                    P + LG+ PH      P R++ A E+ RD
Sbjct  617622  VLGLVPDLQLGEQPHLGLRCVPHRVVGANELDRD  617723

>ALLA:FR824348 dna:supercontig supercontig:ENA1:FR824348:1:31264:1 
REF
Length=31264

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
              GY+ K+G F KSWR R+ +L      +AYY S+
Sbjct  12488  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  12390

>PYAR:scaffold_5711 par_scaffold_5711 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_5711:1:1474:1 
REF
Length=1474

 Score = 35.0 bits (79),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
 Frame = +3

Query  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
            Q  + EGY+ K+      WR  + VL+G  L  AYYESR
Sbjct  204  QGIAFEGYLHKKSEVLSHWRATYCVLEGDTL--AYYESR  314

>PHCA:scaffold_14 PHYCAscaffold_14
Length=1100894

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 30/63 (48%), Gaps = 3/63 (5%)
 Frame = -1

Query  1       MNILRLPEPGATASGDKAQPTSC-EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               M  L+ PE     S     PT   EG++ K+G   K W+ R+ V DG  L  +YY SR  
Sbjct  548075  MIFLKWPERVPVESMPDYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISRKD  547902

Query  60      CHP  62
                 P
Sbjct  547901  RKP  547893

>SADI:scaffold_8 supercont1.8 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.8:1:1177252:1 
REF
Length=1177252

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 43/155 (28%), Positives = 61/155 (39%), Gaps = 29/155 (19%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPHEY  84
               G+V KRG   +SW+ R+ VL  + L  AYY+      P  G   +   S   S ++P+  
Sbjct  755264  GWVEKRGAVMRSWKRRYFVLRENVL--AYYDINLEGQPKKGGDLVQ--SIETSTVKPN--  755425

Query  85      VIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK----AKRQLT  140
                            FKMV      G      F ET  D  +WL +A N L     AKR   
Sbjct  755426  ----------GLEFKMVSGRSLVG------FTETTDDHVQWL-LAANTLYHEP*AKRVKL  755554

Query  141     RQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQ  175
               +  + Q  +P+     G     S  P  +P  + Q
Sbjct  755555  KNVVWQ--NPSASTRTGAWPSGS*SPAATPCARCQ  755653

>SADI:scaffold_7 supercont1.7 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.7:1:1218947:1 
REF
Length=1218947

 Score = 35.4 bits (80),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
 Frame = -2

Query  9       PGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
               P AT    +A P   EGY+ KRG +   W   ++VL G +L  AY++
Sbjct  940771  PSATDRHLQALPLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFD  940637

>APIN:scaffold_71 supercont1.71 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.71:1:149896:1 
REF
Length=149896

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 21/41 (51%), Gaps = 7/41 (17%)
 Frame = +1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
              G + KRGH RK+W  RF VL    L+  YY       PP G
Sbjct  53449  GILLKRGHLRKNWLTRFFVLTSGALR--YYRK-----PPGG  53550

>PHRA:scaffold_96
Length=174541

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = -2

Query  61     HPPNGESTMPKGSFYLSNIEPHEYVIGVMGA  91
              +PP  E  +P G  +L NI PH Y IG+MGA
Sbjct  29673  NPPATE--IPSGYKWLYNITPHRYTIGIMGA  29587

>PHKE:scaffold_306 scf_22126_306.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_306.1:1:44029:1 
REF
Length=44029

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (4%)
 Frame = -3

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78
              EGY+ KR  + K W   + VL GS+L    Y S       N +S + KG F  S+
Sbjct  19379  EGYLQKRSDWLKHWETYYFVLRGSSLYC--YLSEEDARRQNAKSKIKKGRFGFSD  19221

>PYAP:scaffold_278 pag1_scaffold_278 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_278:1:36730:1 
REF
Length=36730

 Score = 35.0 bits (79),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 18/113 (16%)
 Frame = -3

Query  25    GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGEST--MP-KGSFYLSNIEP  81
             G++ K+G   K+W+ RF +L+GS L   YY          G     MP KG   +++ + 
Sbjct  4391  GWLWKKGASFKTWKKRFFLLNGSTL--TYYTQSCVVATEVGTRCFDMPAKGGLRVASADF  4218

Query  82    HEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
              +         +  FG ++V  + R  FV+       +T R KWL V   A K
Sbjct  4217  TD---------ETSFGIRIVSSSGRVLFVQ----AGDRTSRIKWLGVLQEASK  4098

>PYAR:scaffold_4057 par_scaffold_4057 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_4057:1:2570:1 
REF
Length=2570

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 58/134 (43%), Gaps = 29/134 (22%)
 Frame = -2

Query  9     PGATASGDK--AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
             P     GD+   +  + EGY+  R H R   R R+ VL G  L V  Y S+        E
Sbjct  2482  PAIECEGDEPGVEMRTIEGYLWVRVHSR---RRRYCVLQGRTLHV--YNSKE-------E  2339

Query  67    STMPKGSFYLSNIEPHEYVIGVMGAAD--RPFGFKMVGHAPRKGFVE------------L  112
             +T P+G    S+ +    VIGV  A D  +    +++G     G ++            +
Sbjct  2338  ATTPEGQLSPSS-KKRIIVIGVKDAIDLDKQTRSQLLGGETNGGTMQNSLVISTLKSKLV  2162

Query  113   DVFVETQTDRNKWL  126
              V  ETQT++ +WL
Sbjct  2161  GVEAETQTEKQRWL  2120

>SAPA:scaffold_40 supercont2.40 dna:supercontig supercontig:ASM15154v2:supercont2.40:1:298837:1 
REF
Length=298837

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (53%), Gaps = 7/57 (12%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
                G++ K+G   K+W+ RF+VL   +L   Y+E+          +  PKGSF +  IE
Sbjct  230161  RGWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKLT-----PTLKPKGSFQVLVIE  230012

 Score = 33.5 bits (75),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQ  50
               EGY+ K+GH  K+WR RF  L G++L+
Sbjct  105637  EGYLLKQGHVVKNWRRRFFRLLGASLE  105557

>ALCA:scaffold_110 AcNc2_CONTIG_110_length_72385 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_110_length_72385:1:72385:1 
REF
Length=72385

 Score = 35.0 bits (79),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%)
 Frame = +3

Query  3      ILRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
              I  L E  +T  G        EGY+ KRGH   S R R+ VL   +  + Y+E++     
Sbjct  67620  ITSLIEERSTFVGTTKPAMLMEGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKEDAEG  67799

Query  63     PNGESTMPKGSFYLSNI  79
                  S  P G F ++N+
Sbjct  67800  FECGSK-PLGEFQVANV  67847

>SAPA:scaffold_203 supercont2.203 dna:supercontig supercontig:ASM15154v2:supercont2.203:1:29623:1 
REF
Length=29623

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 5/86 (6%)
 Frame = -3

Query  8    EPGATASGDK---AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPN  64
            E   TAS D    A  T  EGY+ KR  + K W   + VL G  L        A   P N
Sbjct  272  ETTITASVDTPAVAVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALYCYLSADEAKRQPEN  93

Query  65   GESTMPKGSFYLSNIEPHEYVIGVMG  90
              S +  G+F  ++    ++V+ + G
Sbjct  92   --SKIKHGAFSFTSHVVLQHVVSIHG  21

>SADI:scaffold_72 supercont1.72 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.72:1:302499:1 
REF
Length=302499

 Score = 35.0 bits (79),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 7/59 (12%)
 Frame = +3

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               + EG++ K+G    +W+ R++VL G    +AYY+ +   +P   E    KG+F L+ +E
Sbjct  145548  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVSNPRAKE----KGTFTLAAVE  145703

>PHRA:scaffold_3
Length=946144

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 7/56 (13%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               G+V K+G   ++W+ RF+VL G   Q+ YY++ A   P    +   KGSF +  +E
Sbjct  661720  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT-AKVDP----TVKAKGSFQVITVE  661574

 Score = 33.9 bits (76),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 2/51 (4%)
 Frame = -2

Query  6       LPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
               L      +S  +++   C G++ K G   KSW+ R+  L GS L  +YY+S
Sbjct  666384  LSRASEESSTTQSESKGCVGWLKKEGGNVKSWKRRYFTLYGSKL--SYYKS  666238

>APIN:scaffold_54 supercont1.54 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.54:1:414455:1 
REF
Length=414455

 Score = 35.0 bits (79),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 3/37 (8%)
 Frame = +1

Query  24      EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAAC  60
                G++ K+GH  K+W+ RF VLDGS   V  + +   C
Sbjct  365272  SGWLYKQGHILKNWKRRFFVLDGS---VGSWRAWWTC  365373

>SAPA:scaffold_7 supercont2.7 dna:supercontig supercontig:ASM15154v2:supercont2.7:1:943373:1 
REF
Length=943373

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 7/59 (12%)
 Frame = -2

Query  22      SCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
               + EG++ K+G    +W+ R++VL G    +AYY+ +   +P   E    KG+F L+ +E
Sbjct  162385  AWEGWIYKQGSLMPTWKKRYMVLKGR--HIAYYD-KEVTNPRAKE----KGTFTLAAVE  162230

 Score = 33.9 bits (76),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 40/168 (24%), Positives = 75/168 (45%), Gaps = 37/168 (22%)
 Frame = -3

Query  17      KAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
               + +  + EGY+ K+GHF  + + +++VL G++L   +Y S  A      ++T   G   +
Sbjct  568476  ETEAATVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDAY---MAKTTADVGCSQV  568312

Query  77      SNI---EPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
               +++   + H  ++        PF  + V HA      ++     T ++++KW+       
Sbjct  568311  ASVGDWDGHTLLLTY----PHPFRIETVAHA------QVLCSAPTASEKDKWM-------  568183

Query  134     KAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQ-MQTLATS  180
                  R L R AI        K   G    +S+  V+ P  Q +QTL +S
Sbjct  568182  ---RGL-RAAI-------AKHAIGAKTSTSSDVVLDPAVQALQTLLSS  568072

>HYAP:scaffold_322 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_322:1:27901:1 
REF
Length=27901

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (71%), Gaps = 2/31 (6%)
 Frame = +3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYE  55
              G++ KRGH  K+W+ RF +L+G+ L   YY+
Sbjct  26994  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  27080

>PHCA:scaffold_30 PHYCAscaffold_30
Length=669438

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 3/32 (9%)
 Frame = -1

Query  25      GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYE  55
               G + KRG  +RK W++RF+ LDG   Q+AYYE
Sbjct  136707  GSLEKRGFRWRKKWKLRFVELDGR--QLAYYE  136618

>SADI:scaffold_25 supercont1.25 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.25:1:683613:1 
REF
Length=683613

 Score = 35.0 bits (79),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 2/33 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              EGY+ K+G   K W+ R+ V DG +L  +YY S
Sbjct  48892  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  48984

>ALLA:FR824109 dna:supercontig supercontig:ENA1:FR824109:1:99844:1 
REF
Length=99844

 Score = 35.0 bits (79),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 4/52 (8%)
 Frame = +1

Query  14     SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
              S ++ Q  + EG +TKR  + K WR R+ +L G+ L    Y S++    P+G
Sbjct  26068  STERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKSKNDAPHG  26211

>APAS:scaffold_25 supercont1.25 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.25:1:849228:1 
REF
Length=849228

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 1/33 (3%)
 Frame = -3

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAY-YES  56
              G++ K GH RK+W+ RF VLDGS     Y +ES
Sbjct  22276  GWLYKLGHVRKNWKRRFFVLDGSVRMCIYLFES  22178

>SAPA:scaffold_5 supercont2.5 dna:supercontig supercontig:ASM15154v2:supercont2.5:1:1129684:1 
REF
Length=1129684

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 2/33 (6%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              EGY+ K+G   K W+ R+ V DG +L  +YY S
Sbjct  88957  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYIS  89049

>PYAP:scaffold_926 pag1_scaffold_926 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_926:1:10218:1 
REF
Length=10218

 Score = 34.7 bits (78),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 2/34 (6%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             EGY+ K+      WR  + VL+G  L  AYYESR
Sbjct  6806  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESR  6711

>PYAR:scaffold_122 par_scaffold_122 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_122:1:30762:1 
REF
Length=30762

 Score = 34.7 bits (78),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)
 Frame = -2

Query  24    EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESR  57
             EG++ K+G   KSW+ R+ V DG  L  +YY SR
Sbjct  2123  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  2028

>HYAP:scaffold_138 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_138:1:177340:1 
REF
Length=177340

 Score = 34.7 bits (78),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 57/120 (48%), Gaps = 27/120 (23%)
 Frame = -1

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG-------ESTMPKGSFYL-  76
               GY+ K+G   K+++ R++ L+GS L  AYY+ +      NG       + T+ +G   L 
Sbjct  114190  GYLRKKGEKNKAFKKRYMALNGSVL--AYYKKKPE---KNGIPLSRDEKKTLERGRIDLD  114026

Query  77      --SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                 S+++P       M +   P+G  +V  A         +  +++ +  +WL+  C+ +K
Sbjct  114025  RVSSLQP-------MDSKTEPYGILLVTTARTWA-----ICADSEPEYQRWLKGLCDVVK  113882

>HYAP:scaffold_103 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_103:1:248444:1 
REF
Length=248444

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (44%), Gaps = 23/114 (20%)
 Frame = -1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK-GSFYLSNIEPH  82
              EGY++K+     SW+  + VL+   +  A+YE+R      +  S M   G   L  IE  
Sbjct  33857  EGYLSKKSDVLVSWKATYCVLEEDTM--AFYETRE-----DFISNMKLIGRIQLQAIEDE  33699

Query  83     EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKW---LEVACNAL  133
              +        AD+P GF+++    R   +       T  ++ +W   + V+C  L
Sbjct  33698  D--------ADKPNGFRLIAEGNRINHLS----SRTAFEKEQWKRAIHVSCEGL  33573

>PYAP:scaffold_811 pag1_scaffold_811 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_811:1:12837:1 
REF
Length=12837

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 4/42 (10%)
 Frame = +1

Query  24     EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG  65
              EG +TKR  + K WR R+ VL G+ L    Y  RAA  P +G
Sbjct  10813  EGELTKRSVWLKEWRRRYFVLKGNKL----YFCRAANEPAHG  10926

>HYAP:scaffold_312 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_312:1:30087:1 
REF
Length=30087

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 29/58 (50%), Gaps = 7/58 (12%)
 Frame = +3

Query  23     CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80
              C G+V K+G   K+W+ RF+VL     Q+ YY +          +   KGSF +  +E
Sbjct  10053  CAGWVYKQGSLVKNWKKRFMVL--RERQLTYYNTDIVT-----PTVKAKGSFQVITVE  10205

>PHSO:scaffold_5
Length=6830280

 Score = 34.7 bits (78),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +2

Query  25       GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYESRAA  59
                G + KRG  +R+ W++RF+ LDG   Q+AYYE   A
Sbjct  4809230  GSLEKRGFRWRRKWKLRFVELDGR--QLAYYEDSGA  4809331

>PHSO:scaffold_6
Length=4785000

 Score = 34.7 bits (78),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 32/75 (43%), Gaps = 3/75 (4%)
 Frame = -3

Query  4       LRLPEPGATA-SGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHP  62
               L  P PGA A   D       EGY+ KR  + K W   + VL G +L    Y S      
Sbjct  245224  LATPTPGARAVPNDVPLRFHWEGYLQKRSDWLKHWETYYFVLRGRSLYC--YLSEEDARR  245051

Query  63      PNGESTMPKGSFYLS  77
                N +S + KG F  S
Sbjct  245050  QNAKSKIKKGKFGFS  245006

>PYIR:scaffold_94 pir_scaffold_94 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_94:1:54970:1 
REF
Length=54970

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 47/124 (38%), Gaps = 30/124 (24%)
 Frame = -3

Query  4     LRLPEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPP  63
             L++   G  +  D + P   EG +TKR  + K WR R+ VL G+ L    Y  RA   P 
Sbjct  9527  LQVTMEGDYSRCDLSDPDY-EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQHEPA  9363

Query  64    NG-----------------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGF  98
             +G                       E   P  ++Y+   N +  +  IG +G A   F  
Sbjct  9362  HGLIDLADCLTVKSAEEKTNKRFCFEVATPDSTYYMYAENEKQKDEWIGAIGRAIVKFSS  9183

Query  99    KMVG  102
                G
Sbjct  9182  SFTG  9171

>PHIF:NW_003303758.1 Phytophthora infestans T30-4 supercont1.1 
genomic scaffold, whole genome shotgun sequence
Length=6928287

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +2

Query  25       GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYESRAA  59
                G + KRG  +RK W++R++ LDG   Q+AYYE   A
Sbjct  2232392  GALEKRGFRWRKKWKLRYVELDGR--QLAYYEDSGA  2232493

>PYVX:scaffold_722 pve_scaffold_722 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_722:1:14843:1 
REF
Length=14843

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 55/140 (39%), Gaps = 27/140 (19%)
 Frame = -3

Query  15     GDKAQPTS---CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
              G   +PT    C G++ K G   KSW+ R+  L G+ L   Y++S               
Sbjct  11952  GSNLEPTDLVVCSGWLRKEGGTVKSWKQRYFTLHGTTL--CYFKS-------------DN  11818

Query  72     GSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACN  131
              G+   S I  H     V+    +    ++   + RK  V  D    +Q D  +WL     
Sbjct  11817  GALLRSLIVCH-----VVTVRTKTLCLEITTESGRKLLVASD----SQVDFERWLSSLQR  11665

Query  132    ALKAKRQLTRQAIDQSVSPN  151
              AL   ++    AI +  SP+
Sbjct  11664  ALVVDKERKFAAIREKRSPS  11605

>APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.18:1:978767:1 
REF
Length=978767

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 27/118 (23%)
 Frame = +2

Query  21     TSC----EGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYL  76
              TSC    EG++ K+G   KSW+ R+ V+ G++L  AYY+           + + +G+F  
Sbjct  97286  TSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYKDELRG------TVLGQGTFV-  97438

Query  77     SNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
               +++P+          D+P+   ++ +  R     L V + ++ D   WL    +AL+
Sbjct  97439  -HVKPN---------PDKPWSLVIILNTGRL----LVVALSSEHDEATWLHALQSALQ  97570

>PHKE:scaffold_223 scf_22126_223.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_223.1:1:58154:1 
REF
Length=58154

 Score = 34.7 bits (78),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (52%), Gaps = 2/54 (4%)
 Frame = +3

Query  18     AQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPK  71
              A+    EGY+ KRGH   S R R+ VL G+ L  +YY +      P G +T  +
Sbjct  51705  AESILMEGYLMKRGHRIPSMRKRYCVLIGNEL--SYYVTHDDSKNPGGGATTAR  51860

 Score = 33.9 bits (76),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 42/82 (51%), Gaps = 11/82 (13%)
 Frame = +3

Query  8      EPGATASGDKAQPTSCEGYVTKRGHFRKS-WRVRFLVLDGSNLQVAYYESRAACHPPNGE  66
              E    AS ++A+    EGY+  R H   S W  RF+VLDGS L +   +S A     + E
Sbjct  54453  ETSVIASTNEAK---TEGYLRVRHHNLGSIWHDRFVVLDGSKLSIYSDKSDADADHESNE  54623

Query  67     STMPKGSFYLSNIEPHEYVIGV  88
              ST P      + +E HE V+GV
Sbjct  54624  ST-PS-----TALEKHE-VVGV  54668

>PLHA:NW_020187139.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_218, whole genome shotgun sequence
Length=463652

 Score = 34.3 bits (77),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 3/32 (9%)
 Frame = -3

Query  25      GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYE  55
               G + KRG  +RK W++RFL LDG   Q+ YYE
Sbjct  145617  GSLEKRGFRWRKKWKLRFLELDGR--QLVYYE  145528

>PYUU:scaffold_2025 scf1117875582025 dna:supercontig supercontig:pug:scf1117875582025:1:692778:1 
REF
Length=692778

 Score = 34.3 bits (77),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = +2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
               GY+ K+G + K+WR R+ +L      ++YY+S
Sbjct  138731  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  138826

>ALLA:FR824197 dna:supercontig supercontig:ENA1:FR824197:1:60032:1 
REF
Length=60032

 Score = 34.3 bits (77),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 58/147 (39%), Gaps = 47/147 (32%)
 Frame = +3

Query  21     TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH---PPNGESTMP-------  70
              T  +G++ KRGH +K+W+ R+  ++   LQ  + E++       P NG    P       
Sbjct  23664  TRRDGFLWKRGHLKKNWKKRYFRIEDGQLQY-FTENKKLMRGAIPLNGTVVSPGMTCCPD  23840

Query  71     --KGSFYLSNI--------------EPHEYVIGVMGA---------ADRPFGFKMV----  101
                K  F +SN+              E HE+V  +  A          + P GF +V    
Sbjct  23841  GRKNYFVISNMNHKSELHLNAETEAEMHEWVQVLQQAQSGFERKKRIEEPLGFALVVKRA  24020

Query  102    -------GHAPRKGFVELDVFVETQTD  121
                      +A      E+DV +E +T+
Sbjct  24021  EEIPIISFYATYSKSNEIDVVMERKTE  24101

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = -3

Query  7      PEPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54
              PE     + D +   S  G++ K GH RK+W+ R+ VL+ S L+  YY
Sbjct  62988  PEAPDANAFDDSFLDSMRGWLRKLGHVRKNWKSRYFVLERSVLR--YY  62851

>PHKE:scaffold_255 scf_22126_255.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_255.1:1:51676:1 
REF
Length=51676

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 44/111 (40%), Gaps = 23/111 (21%)
 Frame = +1

Query  23    CEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIEPH  82
             CEG++ KRG     W+ R+  L G  LQ   Y+       P G  T+      L   EP 
Sbjct  4021  CEGWLYKRGQRSTEWQRRYFKLKGFTLQ---YQDGPGESVPKGAGTVVG----LKLGEPG  4179

Query  83    EYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNAL  133
                + V       FG   V          L V  ++Q+  +KW++  C+ L
Sbjct  4180  SNCVFVQ------FGSSRV----------LCVSADSQSQVDKWVQAICSVL  4284

>PYIW:scaffold_735 piw_scaffold_735 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_735:1:14751:1 
REF
Length=14751

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -1

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F K+WR R+ +L      ++YY+S
Sbjct  12042  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  11947

>PHPA:scaffold_23 NW_008649009.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.23, whole genome shotgun 
sequence
Length=932115

 Score = 34.3 bits (77),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = -3

Query  25      GYVTKRG-HFRKSWRVRFLVLDGSNLQVAYYESRAA  59
               G + KRG  +RK W++R++ LDG   Q+AYYE   A
Sbjct  108334  GSLEKRGFRWRKKWKLRYVELDGR--QLAYYEDSGA  108233

>PYAR:scaffold_7164 par_scaffold_7164 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_7164:1:1005:1 
REF
Length=1005

 Score = 33.9 bits (76),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 4/60 (7%)
 Frame = +3

Query  52   AYYESRAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVE  111
            +++E  + CH    E   P GS  LS   P E  +    A    FG+K    AP K FVE
Sbjct  297  SFFEHLSVCHTVMPERA-PDGSVRLSASSPDEQALVAAAAC---FGYKFSARAPGKAFVE  464

>PHIF:NW_003303730.1 Phytophthora infestans T30-4 supercont1.29 
genomic scaffold, whole genome shotgun sequence
Length=2113949

 Score = 34.3 bits (77),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 45/118 (38%), Gaps = 30/118 (25%)
 Frame = +1

Query  10       GATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNG----  65
                G  +  D ++P   EG +TKR  + K WR R+ VL G+ L    Y  RA   P +G    
Sbjct  1934659  GDYSHCDLSEPDF-EGELTKRSVWLKEWRKRYFVLKGNKL----YFCRAQGEPAHGLIDL  1934823

Query  66       -------------------ESTMPKGSFYL--SNIEPHEYVIGVMGAADRPFGFKMVG  102
                                   E   P  +FY+   N +  +  IG +G A   F     G
Sbjct  1934824  ADCLTVKSAEEKTNKRFCFEVATPDSTFYMYAENEKQKDEWIGAIGRAIVKFSSSFTG  1934997

>APIN:scaffold_13 supercont1.13 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.13:1:1515874:1 
REF
Length=1515874

 Score = 34.3 bits (77),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 7/62 (11%)
 Frame = -1

Query  16      DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFY  75
               D   PTS  G + K+ +  K+W+ RF+VL G ++   YY S         E T P+G   
Sbjct  307051  DFYAPTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTTS-----EETYPRGVIS  306893

Query  76      LS  77
               LS
Sbjct  306892  LS  306887

>PYAP:scaffold_292 pag1_scaffold_292 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_292:1:35410:1 
REF
Length=35410

 Score = 33.9 bits (76),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 25/114 (22%), Positives = 50/114 (44%), Gaps = 17/114 (15%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH----PPNGESTMPKGSFYLSNIE  80
              GY+ KRG   +S++ R++ L+G+ L  +YY+ +   +      + + +  +GS  L  + 
Sbjct  23790  GYLRKRGEHNRSYKRRYMELNGATL--SYYKKKPEKNGIPLSRDDKKSYERGSIDLDRVS  23617

Query  81     PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                     +      PFG  +V            +  E++ D  +WL+  C  +K
Sbjct  23616  ------SIQPIDSEPFGMHLVTTTRTWA-----ISAESEQDFLRWLKSLCGVIK  23488

>SAPA:scaffold_4 supercont2.4 dna:supercontig supercontig:ASM15154v2:supercont2.4:1:1210272:1 
REF
Length=1210272

 Score = 33.9 bits (76),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 0/42 (0%)
 Frame = +2

Query  8       EPGATASGDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNL  49
                P AT    +A P   EGY+ KRG +   W   ++VL G +L
Sbjct  763502  SPSATDRHLQALPLRWEGYLRKRGDWLPRWDTYYVVLSGVDL  763627

>PYIR:scaffold_78 pir_scaffold_78 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_78:1:58522:1 
REF
Length=58522

 Score = 33.9 bits (76),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -2

Query  25     GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56
              GY+ K+G F K+WR R+ +L      ++YY+S
Sbjct  48174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  48079

>ALLA:FR824049 dna:supercontig supercontig:ENA1:FR824049:1:277804:1 
REF
Length=277804

 Score = 33.9 bits (76),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 13/111 (12%)
 Frame = -2

Query  25      GYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACH-PPNGESTMPKGSFYLSNIEPHE  83
               GY+ KRG   KS+R R++ L    L  +YY+ + +   P + +    +GS  L N+    
Sbjct  143022  GYLRKRGGTNKSYRRRYMELKDRTL--SYYKKKPSHRLPSDKQEAYLRGSIDLENVSS--  142855

Query  84      YVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALK  134
                 +  M      +G  +V  +           V  + + +KWL+  C A+K
Sbjct  142854  --LQPMDPKVEKYGIVLVTTSRTWE------LVAEEKEYHKWLKEFCQAVK  142726

Lambda      K        H        a         alpha
   0.316    0.132    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 92949157125

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40