Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
HYAP:scaffold_591899881905661936829e-82
PLHA:NW_020189861.1184554418460591865031e-57
PHSO:scaffold_1279915127996211925021e-57
PHCA:scaffold_84998271001441223702e-52
PHRA:scaffold_56151403151591632812e-49
PHKE:scaffold_986679966987632961e-46
PHIF:NW_003303697.14304564307851223157e-45
PYAP:scaffold_16219078195841843513e-37
ALLA:FR8240811015641020341812923e-29
PHPA:scaffold_63250561250749632674e-29
SADI:scaffold_42052472056901702482e-23
PYIW:scaffold_9631023410389551362e-22
PYUU:scaffold_2037130671713070431141572e-22
PYVX:scaffold_275269730561352299e-21
ALCA:scaffold_8018108183861132085e-18
SAPA:scaffold_243933393937881561786e-14
PYIR:scaffold_8102735102890551428e-14
PYAR:scaffold_2917050175441661742e-13
APAS:scaffold_12707004707183621495e-12
APIN:scaffold_20400835400993551359e-10
HYAP:scaffold_82156661581851880.045
PHSO:scaffold_44062091406225856870.066
PLHA:NW_020187475.114497514514256860.071
PHKE:scaffold_1743055321654850.10
PHIF:NW_003303729.142634642651356840.16
PHPA:scaffold_1771766371783056830.17
PYUU:scaffold_202886063486078651780.92
ALCA:scaffold_64761927635354771.1
PYVX:scaffold_5755755591654742.4
PHRA:scaffold_6216004916021656742.4
ALLA:FR824265125411264535733.2
PYIW:scaffold_955780593251724.5
SAPA:scaffold_95838958405654725.6
SADI:scaffold_8010043210059354725.6
PYAR:scaffold_269335952054715.7
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= HYAP_07103

Length=164
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  267        9e-82
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  198        1e-57
PHSO:scaffold_1                                                       197        1e-57
PHCA:scaffold_84 PHYCAscaffold_84                                     147        2e-52
PHRA:scaffold_56                                                      112        2e-49
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  118        1e-46
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  125        7e-45
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  139        3e-37
ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:...  117        3e-29
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  107        4e-29
SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_dicl...  100        2e-23
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  57.0       2e-22
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  65.1       2e-22
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  92.8       9e-21
ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig sup...  84.7       5e-18
SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM151...  73.2       6e-14
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  59.3       8e-14
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  71.6       2e-13
APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_a...  62.0       5e-12
APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_i...  56.6       9e-10
HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  38.5       0.045
PHSO:scaffold_4                                                       38.1       0.066
PLHA:NW_020187475.1 Plasmopara halstedii genome assembly, contig:...  37.7       0.071
PHKE:scaffold_174 scf_22126_174.1_contig_1 dna:supercontig superc...  37.4       0.10 
PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 ge...  37.0       0.16 
PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 ...  36.6       0.17 
PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:p...  34.7       0.92 
ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig sup...  34.3       1.1  
PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pv...  33.1       2.4  
PHRA:scaffold_62                                                      33.1       2.4  
ALLA:FR824265 dna:supercontig supercontig:ENA1:FR824265:1:43796:1...  32.7       3.2  
PYIW:scaffold_95 piw_scaffold_95 dna:supercontig supercontig:piw_...  32.3       4.5  
SAPA:scaffold_95 supercont2.95 dna:supercontig supercontig:ASM151...  32.3       5.6  
SADI:scaffold_80 supercont1.80 dna:supercontig supercontig:Sap_di...  32.3       5.6  
PYAR:scaffold_2693 par_scaffold_2693 dna:supercontig supercontig:...  32.0       5.7  

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 164/193 (85%), Gaps = 29/193 (15%)
 Frame = +1

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE------------------  42
               MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE                  
Sbjct  189988  MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKECVVVVIMNKSRFLFVS*L  190167

Query  43      -----------VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvllll  91
                          VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCLTLSLFSVLLLL
Sbjct  190168  PNELSICFRCRVSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCLTLSLFSVLLLL  190347

Query  92      lhhyfscffsDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQH  151
               LHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQH
Sbjct  190348  LHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQH  190527

Query  152     FMDRKSGPPRPIF  164
               FMDRKSGPPRPIF
Sbjct  190528  FMDRKSGPPRPIF  190566

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 124/186 (67%), Gaps = 36/186 (19%)
 Frame = -1

Query  1        MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE------------------  42
                +RPLYKKLLRLAQ+LP+ KRQ S+DQIRREFR H DLTDPKE                  
Sbjct  1846059  LRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKE*LDEVNFSCLSRSNSSLQ  1845880

Query  43       ----VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfsc  98
                    VS  +QRAQSS+ +LKI+TPR ES     +L +  +C  L                
Sbjct  1845879  FLLRVSEFIQRAQSSLSYLKIITPRTESSRCFVALRYPAICR*LDSNHT-----------  1845733

Query  99       ffsDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSG  158
                   DTG+QRF+YR+G+R++AA+ +KKG ENAR+KTQD+EAG KRHHQLLRRQ+FMDRKSG
Sbjct  1845732  ---DTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRKSG  1845562

Query  159      PPRPIF  164
                PPRPIF
Sbjct  1845561  PPRPIF  1845544

>PHSO:scaffold_1
Length=13391543

 Score = 197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 123/192 (64%), Gaps = 63/192 (33%)
 Frame = +1

Query  1        MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPK-------------------  41
                +RPLYKKLLRLAQSLPEPKR++SLDQIRREFR HGDLTDP+                   
Sbjct  2799151  LRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGCVHVVSCPSCPAV*SLYC  2799330

Query  42       ---------EVSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllll  92
                          VS+L+QRAQSS+ +LKIVTPR ES                          
Sbjct  2799331  VDAMSVCGCRVSALIQRAQSSLSYLKIVTPRGES--------------------------  2799432

Query  93       hhyfscffsDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHF  152
                         +TG+QRF+YR+G+R++AAE + KGEENARYKTQDIEAG+KRHHQLLRRQ+F
Sbjct  2799433  ---------NTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYF  2799585

Query  153      MDRKSGPPRPIF  164
                MDRKSGPPRPIF
Sbjct  2799586  MDRKSGPPRPIF  2799621

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 147 bits (370),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 88/122 (72%), Gaps = 16/122 (13%)
 Frame = +2

Query  43      VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsD  102
               VS LLQRAQSS+ +LKIVTPRAES  F   +    +                  S   +D
Sbjct  99827   VSKLLQRAQSSLGYLKIVTPRAESSEFCLFICSCFL----------------AESTAATD  99958

Query  103     TGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRP  162
               TG+QRF+YRDGKR++A EL+ KGEENAR+KTQD+EAG+KRHHQLLRRQ+FMDRKSGPPRP
Sbjct  99959   TGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRKSGPPRP  100138

Query  163     IF  164
               IF
Sbjct  100139  IF  100144

 Score = 80.5 bits (197),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +3

Query  1      MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSL  46
              +RPLYKKLLRLAQSLPEPKRQ S+DQIRREFR H DLTDPKE  S+
Sbjct  99639  LRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKECGSI  99776

>PHRA:scaffold_56
Length=334739

 Score = 112 bits (281),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -2

Query  102     DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPR  161
               D GIQR++YR+G+R++A E++  GEENARYKTQDIE G+KRHHQLLRRQHFMDRKSGPPR
Sbjct  151591  DKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRKSGPPR  151412

Query  162     PIF  164
               PIF
Sbjct  151411  PIF  151403

 Score = 105 bits (261),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 65/94 (69%), Gaps = 23/94 (24%)
 Frame = -1

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE------------------  42
               +RPLYKKLLRLAQSLPEPKRQ+SLDQIRREFR H +LTDPKE                  
Sbjct  151937  LRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKECVSLFILSLPGQFTNYR*  151758

Query  43      -----VSSLLQRAQSSIDFLKIVTPRAESGGFMA  71
                    VS+L+QRAQSS+ +LKIVTPRAES  F A
Sbjct  151757  IAAARVSALIQRAQSSLGYLKIVTPRAESSEFAA  151656

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 118 bits (296),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 63/63 (100%), Gaps = 0/63 (0%)
 Frame = +1

Query  102    DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPR  161
              D+G+QR++YR+G+R++AAEL++KGEENARYKTQD+EAG+KRHHQL+RRQHFMDRKSGPPR
Sbjct  66799  DSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRKSGPPR  66978

Query  162    PIF  164
              P+F
Sbjct  66979  PMF  66987

 Score = 74.7 bits (182),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +2

Query  1      MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSS  45
              +RPLYKKLLR+AQ+LPEPKR +SL QIRREFR HGDL+DPKE  +
Sbjct  66386  LRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKECVT  66520

 Score = 35.8 bits (81),  Expect(3) = 1e-46, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  43     VSSLLQRAQSSIDFLKIVTPRAES  66
              VS LLQ AQSS+ +LKIVTPR E+
Sbjct  66624  VSKLLQLAQSSLSYLKIVTPRDET  66695

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 125 bits (315),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  43      VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsD  102
               VS+L+QRAQSS+ +LKIVTPRAES  F+  +                       +    D
Sbjct  430456  VSALIQRAQSSLSYLKIVTPRAESSEFLVIMP------------PPCDWSDAACAVNNVD  430599

Query  103     TGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRP  162
               TG+QR++YR+G+R++AAE ++KG ENAR+K QD+E G+KRHHQLL+RQ+FM+RKSGPPRP
Sbjct  430600  TGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRKSGPPRP  430779

Query  163     IF  164
               IF
Sbjct  430780  IF  430785

 Score = 76.6 bits (187),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLL  47
               +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGD TDPKE + ++
Sbjct  430275  LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKECAVVV  430415

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 112/184 (61%), Gaps = 35/184 (19%)
 Frame = +1

Query  1      MRPLYKKLLRLAQSLP-EPKRQKSLDQIRREFRIHGDLTDPKE-----------------  42
              +RPLYK+LLRLA+SLP E KR+ ++ QIR EFR   D  DPKE                 
Sbjct  19078  LRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKE*VTAHEMR***DD*RVE  19257

Query  43     --VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscff  100
                V++L+QRAQ+ I +LKIVTPR+ +G     +    +C+ +  +S              
Sbjct  19258  DRVAALVQRAQAKIGYLKIVTPRSTAGRMRWRVERPELCVLMRRWSA-------------  19398

Query  101    sDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPP  160
               D G++ FVY +GKR+D+++++ + EE ARYKT D E  M+RH+QLLRRQHFMDR   PP
Sbjct  19399  -DAGVKSFVYVNGKRVDSSDVQTR-EEGARYKTIDFEGNMRRHNQLLRRQHFMDRGVAPP  19572

Query  161    RPIF  164
              +PIF
Sbjct  19573  KPIF  19584

>ALLA:FR824081 dna:supercontig supercontig:ENA1:FR824081:1:137019:1 
REF
Length=137019

 Score = 117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 99/181 (55%), Gaps = 51/181 (28%)
 Frame = +2

Query  2       RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE-------------------  42
               R +YK+L+RLA+SLP  K+  +L  IR EFR H D++DP +                   
Sbjct  101564  RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQCVRIY*TLLTASNF*LKPF  101743

Query  43      --VSSLLQRAQSSIDFLKIVTPRAESGGFMA------SLAFSIMCltlslfsvlllllhh  94
                 +S LL+RAQS+I +LKIVTP   SG ++       S +  ++C               
Sbjct  101744  RRLSQLLERAQSTIGYLKIVTPHKRSGPWLCVCLSH*SESNQMLCS--------------  101881

Query  95      yfscffsDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMD  154
                      D+G++RF+++DG+RI   E   K  E AR+K QDI  G+KRHHQLLRRQHFMD
Sbjct  101882  -------DSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFMD  102031

Query  155     R  155
               R
Sbjct  102032  R  102034

 Score = 35.4 bits (80),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  4      LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
              LY+++LRLA+  P  KR   ++ IR EFR   D+T    +   +  A + I
Sbjct  72679  LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGI  72527

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 107 bits (267),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +1

Query  102     DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPR  161
               D G+QR++YR+G+R++A E ++KGEENAR+KTQD+E G++RHHQLLRRQ+F+DRKSGPPR
Sbjct  250561  DMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRKSGPPR  250740

Query  162     PIF  164
               PIF
Sbjct  250741  PIF  250749

 Score = 42.4 bits (98),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 19/26 (73%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  41      KEVSSLLQRAQSSIDFLKIVTPRAES  66
               + VS+L+QRAQSS+ +LKIVTPRAES
Sbjct  250422  RRVSALIQRAQSSLSYLKIVTPRAES  250499

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 7/63 (11%)
 Frame = +2

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
               +RPLYKKLLRLAQSLPEPKRQ S+DQIRR+FR HGDLTDP+E + +L  A        +V
Sbjct  250235  LRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQECALILYIA-------TLV  250393

Query  61      TPR  63
                PR
Sbjct  250394  CPR  250402

>SADI:scaffold_4 supercont1.4 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.4:1:1391842:1 
REF
Length=1391842

 Score = 100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 36/170 (21%)
 Frame = -1

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE--------------VSSL  46
               +R  YKKLL+LA+S+P+ +R ++L+++R EFR H     P+E              +  L
Sbjct  205690  IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEE*VMRRRDRRSRVGRLDQL  205511

Query  47      LQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQ  106
               L++AQS I +LKIVTP+  S  +     +++                   +     T   
Sbjct  205510  LRKAQSKISYLKIVTPKKSSSAYARGCVWNM-------------------TFLVGSTQGS  205388

Query  107     RFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
                FVY++G+RID  EL     ++A  KT D  A M +H QL+RRQHFMDRK
Sbjct  205387  HFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  205247

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 57.0 bits (136),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = +1

Query  102    DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
              D G++ ++Y++G+R++AA +    E+ A+Y+  D    M RH +LLRRQHFMDRK
Sbjct  10234  DAGVKNYIYKNGQRVEAAAVM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  10389

 Score = 52.8 bits (125),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  1      MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEV  43
              +RP+YKKLL+LA++LPE KR+ +  QIR EFR   +L+DPKE 
Sbjct  9878   LRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKEC  10006

 Score = 37.7 bits (86),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +3

Query  43     VSSLLQRAQSSIDFLKIVTPRAESG  67
              +++LL RAQSSI +LKIVTPR  SG
Sbjct  10068  LNALLARAQSSISYLKIVTPRKSSG  10142

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 65.1 bits (157),  Expect(2) = 2e-22, Method: Composition-based stats.
 Identities = 51/114 (45%), Positives = 70/114 (61%), Gaps = 5/114 (4%)
 Frame = +1

Query  43       VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsD  102
                +++LL RAQSSI +LKIVTPRA SG  + +  ++           L+ +       F++D
Sbjct  1306717  IAALLARAQSSIGYLKIVTPRATSGTVVYAAHYA*--RDNMFTVSLVCMFVVSTWPFWAD  1306890

Query  103      TGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
                 G++ +VY  GKR++AA   +     ARYKT D  A M+RH QLLRRQHFMDRK
Sbjct  1306891  AGVKNYVYIKGKRVEAAGAAED---GARYKTADYNAQMQRHVQLLRRQHFMDRK  1307043

 Score = 61.6 bits (148),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +3

Query  1        MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSL  46
                +RP+YKKLL+LAQ+LP  KRQ +++QIRREFR H    DPKE   L
Sbjct  1306503  LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKECVYL  1306640

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 78/135 (58%), Gaps = 26/135 (19%)
 Frame = -2

Query  41    KEVSSLLQRAQSSIDFLKIVTPRAESGGF-----------MASLAFSIMCltlslfsvll  89
             + V+ LLQRAQS + +LKIVTPR  SG +           ++ L  S       L +   
Sbjct  3056  RRVAKLLQRAQSQLGYLKIVTPRGPSGTWPRPPFAGNWRGLS*LVVSFWWC*PRLVTA--  2883

Query  90    lllhhyfscffsDTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRR  149
                          +G++R++YR+G+R+DA   +  GE+ ARYKT D+E  +KRHHQLLRR
Sbjct  2882  -------------SGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRR  2742

Query  150   QHFMDRKSGPPRPIF  164
             QHFMDR   PPRPIF
Sbjct  2741  QHFMDRGVAPPRPIF  2697

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = -1

Query  1     MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVS--SLLQRAQSSIDFLK  58
             +RPLYKKLLRLAQSLPEPKR  ++ QIR EFR H ++TD  E     LL    S ID   
Sbjct  3258  LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAECVL*PLLS*HTSPIDHSP  3079

Query  59    IVTP  62
             + TP
Sbjct  3078  VCTP  3067

>ALCA:scaffold_80 AcNc2_CONTIG_80_length_84930 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_80_length_84930:1:84930:1 
REF
Length=84930

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 20/113 (18%)
 Frame = +3

Query  43     VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsD  102
              ++ LL+RAQS+I +LKIVTP   SG ++  +  SI C                      D
Sbjct  18108  LAQLLERAQSTIGYLKIVTPHKRSGTYIF-VCMSIRCKLYVSP----------------D  18236

Query  103    TGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDR  155
              +G++ FVY+DG+RI+ +    +  E A++K QD+E G+KRH+QL+RRQ+FMDR
Sbjct  18237  SGVKHFVYKDGERIEKS---LQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  18386

 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = +1

Query  2      RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE---VSSLLQRAQSSIDFLK  58
              R ++KK+++LA+SLP  K+  +L  IR EFR H D+ DP +   +  +L + +SS D + 
Sbjct  17920  RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQCVRID*MLPQKRSSYDTID  18099

Query  59     IV  60
              +V
Sbjct  18100  LV  18105

>SAPA:scaffold_24 supercont2.24 dna:supercontig supercontig:ASM15154v2:supercont2.24:1:471063:1 
REF
Length=471063

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 78/156 (50%), Gaps = 6/156 (4%)
 Frame = +3

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60
               +R  YKKLL+LA+S+P+ +R ++L+++R EFR H     P+E +    R +    +L  V
Sbjct  393339  IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEE*A---MRGRDWRLYLVCV  393509

Query  61      TPRAESGGFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVYRDGKRIDAAE  120
                  + S      LA S      S         +              FVY++G+RID  E
Sbjct  393510  DSTSSSARRSPRLATSRS*RLRSRRVRTQPPAYGT*RSPVGPGQGNHFVYKNGQRIDGRE  393689

Query  121     LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
               L     ++A  KT D  A M +H QL+RRQHFMDRK
Sbjct  393690  L---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  393788

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 59.3 bits (142),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 3/55 (5%)
 Frame = -2

Query  102     DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
               D G++ ++Y++G+R++A  +    E+ A+Y   D  A M+RH +LLRRQHFMDRK
Sbjct  102890  DAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  102735

 Score = 38.5 bits (88),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  43      VSSLLQRAQSSIDFLKIVTPRAESGGFMASLAF  75
               +++LL RAQSSI +LKIVTPR  SG   A + F
Sbjct  103057  LNALLARAQSSIGYLKIVTPRKSSGMGFAHVVF  102959

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEV  43
               +RP+YKKLL+LA++LPE KR  +L QIR EFR   D++DPKE 
Sbjct  103320  LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKEC  103192

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 74/166 (45%), Gaps = 31/166 (19%)
 Frame = -1

Query  21     QKSLDQIRREFRIHGDLTDPK-----------------------EVSSLLQRAQSSIDFL  57
              + +L QIR EFR  GDL+DPK                        V++L+ RAQS I +L
Sbjct  17544  EATLQQIRSEFRSSGDLSDPKACVLILFPPALLGVPLTIGGALRSVAALVLRAQSKIGYL  17365

Query  58     KIVTPRAESG-------GFMASLAFSIMCltlslfsvlllllhhyfscffsDTGIQRFVY  110
              KIVTPRA SG            L  S+   TL+  ++         +   + T   R   
Sbjct  17364  KIVTPRATSGMVQ*GVSCLYWVLILSLWVQTLARSALST*TGRP*TAPTRTCTTRAR-AX  17188

Query  111    RDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
                              E ARYKT D +A M+RH QLLRRQHFMDRK
Sbjct  17187  XXXXXXXXXXXXXXXXEGARYKTADYDAQMRRHTQLLRRQHFMDRK  17050

>APAS:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.12:1:1206637:1 
REF
Length=1206637

 Score = 62.0 bits (149),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +3

Query  102     DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPR  161
               ++G QRF+Y+DGKR+D+  L   G  N   KT D+ A M+RH +L+RRQHFMDRK     
Sbjct  707004  ESGPQRFIYKDGKRLDSQSLDDGG--NRTIKTTDVNAMMERHVKLIRRQHFMDRK*YKQV  707177

Query  162     PI  163
               PI
Sbjct  707178  PI  707183

 Score = 30.0 bits (66),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 10/66 (15%)
 Frame = +2

Query  17      EPKRQK-SLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVTP-RAESGGFM--AS  72
               +P+R K  ++ I RE  +H        +  L+ +AQS I +LKIVTP R     F+  AS
Sbjct  706820  QPQRSK*HMESIPRE--VHESC----RLDKLVMKAQSKISYLKIVTPKRTPRTWFLPCAS  706981

Query  73      LAFSIM  78
               + F+ +
Sbjct  706982  MVFTWI  706999

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKE  42
               +R  YKKL++LAQSLP  ++  +LD+IR +FR  G ++  +E
Sbjct  706708  VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEE  706833

>APIN:scaffold_20 supercont1.20 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.20:1:1003253:1 
REF
Length=1003253

 Score = 56.6 bits (135),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = -2

Query  102     DTGIQRFVYRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156
               +T  QR++Y+DGKR+D   + +    NA  KT D  A M+RH +L+RRQHFMDRK
Sbjct  400993  ETSPQRYIYKDGKRLDPGCIDQ--STNATIKTVDFNAMMERHVKLVRRQHFMDRK  400835

 Score = 27.3 bits (59),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (56%), Gaps = 0/34 (0%)
 Frame = -1

Query  46      LLQRAQSSIDFLKIVTPRAESGGFMASLAFSIMC  79
               ++ +AQS I +LKIVTP+      M+    S  C
Sbjct  401102  IVMKAQSKISYLKIVTPKRAPRMCMSRCIVSPGC  401001

 Score = 47.0 bits (110),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  1       MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSID  55
               +R  YKKL++LAQSLP  ++  +LD++R EFR HG +T   +   L      +ID
Sbjct  401286  VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQCGPLAPCPPLTID  401122

>HYAP:scaffold_82 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_82:1:287376:1 
REF
Length=287376

 Score = 38.5 bits (88),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  4      LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
              +Y+++L+LAQ  P  KRQ  +  I+ EFR + +L+D ++V   L   Q+ I
Sbjct  15818  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  15666

>PHSO:scaffold_4
Length=7609242

 Score = 38.1 bits (87),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = -1

Query  4        LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
                +Y+++L+LAQ  P  KR+  +  I+ EF  + DLTD +++   L   ++ I  L +
Sbjct  4062258  MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELSM  4062091

>PLHA:NW_020187475.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_555, whole genome shotgun sequence
Length=2240492

 Score = 37.7 bits (86),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
               +Y++LL+LAQ  P  KR+  +  I+ EF  +  +TD +++   +  A + I  L +
Sbjct  144975  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  145142

>PHKE:scaffold_174 scf_22126_174.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_174.1_contig_1:1:71367:1 
REF
Length=71367

 Score = 37.4 bits (85),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -1

Query  4     LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
             +Y+++L+LAQ  P  KR   +  I+ EF  H  LTD +++   L  A++ I  L
Sbjct  3216  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  3055

>PHIF:NW_003303729.1 Phytophthora infestans T30-4 supercont1.30 
genomic scaffold, whole genome shotgun sequence
Length=2025055

 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +1

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
               +Y+++L+LAQ  P  KR+  +  I+ EF  + DLTD +++   L   ++ I  L +
Sbjct  426346  MYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSM  426513

>PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.17, whole genome shotgun 
sequence
Length=1143538

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +3

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
               LY+++L+LAQ  P  KR+  +  I+ EF  + +LTD +++   L   ++ I  L +
Sbjct  717663  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  717830

>PYUU:scaffold_2028 scf1117875582028 dna:supercontig supercontig:pug:scf1117875582028:1:960197:1 
REF
Length=960197

 Score = 34.7 bits (78),  Expect = 0.92, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -1

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
               +Y+++L+LA   P  KR   +  I+ EFR +  LTD   + + +Q A+  I
Sbjct  860786  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  860634

>ALCA:scaffold_64 AcNc2_CONTIG_64_length_94369 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_64_length_94369:1:94369:1 
REF
Length=94369

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = -2

Query  4      LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
              LY+++LRLA+  P  KR   ++ IR EFR   ++  P  +   +  A + I  L
Sbjct  76353  LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  76192

>PYVX:scaffold_575 pve_scaffold_575 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_575:1:19158:1 
REF
Length=19158

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = +1

Query  4     LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
             LY+++L+LAQ  P  KR   +  I+ EF  +  L+D ++V   +  A++ I  L
Sbjct  5755  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  5916

>PHRA:scaffold_62
Length=334142

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +2

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKI  59
               +Y+++L+LAQ  P  KR   +  I+ EF  +  LTD +++   L   ++ I  L +
Sbjct  160049  MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELSM  160216

>ALLA:FR824265 dna:supercontig supercontig:ENA1:FR824265:1:43796:1 
REF
Length=43796

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%)
 Frame = -3

Query  110    YRDGKRIDAAELKKKGEENARYKTQDIEAGMKRHH  144
              YR+G R+DA ++    ++N R K+ D E     HH
Sbjct  12645  YREGSRLDATQVPNDAKQNWRSKSTDAEKDPAFHH  12541

>PYIW:scaffold_95 piw_scaffold_95 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_95:1:31709:1 
REF
Length=31709

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = +2

Query  4     LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSI  54
             LY+++L+LA   P  KR   + +I+ EF  +  LTD  ++   +Q A+  I
Sbjct  5780  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  5932

>SAPA:scaffold_95 supercont2.95 dna:supercontig supercontig:ASM15154v2:supercont2.95:1:144479:1 
REF
Length=144479

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -1

Query  4      LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
              +Y+++L+LAQ  P  K+ + +  I+ EF  +  LTD  ++   +  A   I+ L
Sbjct  84056  IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  83895

>SADI:scaffold_80 supercont1.80 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.80:1:248937:1 
REF
Length=248937

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = +1

Query  4       LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
               +Y+++L+LAQ  P  K+ + +  I+ EF  +  LTD  ++   +  A   I+ L
Sbjct  100432  IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  100593

>PYAR:scaffold_2693 par_scaffold_2693 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_2693:1:4498:1 
REF
Length=4498

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = -1

Query  4    LYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFL  57
            LY+++L+LA+  P  KR   ++ I+ EF     LTD   +   +  AQ+ I  L
Sbjct  520  LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  359

Lambda      K        H        a         alpha
   0.322    0.137    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 20403253680

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40