Note:

Full BLAST raw output including alignments follows below the summary table

Hit Name Hit Start Hit End HSP Length HSP Score HSP Significance
HYAP:scaffold_5915885216061858930910.0
PHSO:scaffold_12794877279665559324920.0
PHPA:scaffold_6324599024773858924790.0
PHKE:scaffold_98617146345958924720.0
PHCA:scaffold_84963399808758924600.0
PHRA:scaffold_5615853616029358924480.0
PHIF:NW_003303697.139609639785058924330.0
PLHA:NW_020189861.11849515185128459222300.0
PYUU:scaffold_20371304058130574359121450.0
PYAP:scaffold_162170531872358921010.0
PYIR:scaffold_810426310593959120960.0
PYIW:scaffold_9637453894353118830.0
PYAR:scaffold_29183481975147518660.0
PYVX:scaffold_2754218559746517930.0
APAS:scaffold_1894524794691759317050.0
APIN:scaffold_18678336950959317030.0
SADI:scaffold_15085781024559316170.0
SAPA:scaffold_113865738824059316130.0
SAPA:scaffold_1066801466944448810082e-118
SADI:scaffold_7116512516655548910072e-118
PHCA:scaffold_86765926779864835603e-59
PYAP:scaffold_73928416424685551e-58
PYAR:scaffold_544198435855535523e-58
PHIF:NW_003303727.15819665833544815452e-57
SADI:scaffold_94339544353604835426e-57
PYAP:scaffold_510265240854945382e-56
PHPA:scaffold_212765692779484785339e-56
PHSO:scaffold_136975646990034985302e-55
PHRA:scaffold_751203671217254695161e-53
HYAP:scaffold_871212611226134695142e-53
PLHA:NW_020187271.14152784166694805142e-53
SADI:scaffold_831274361281162312909e-53
SADI:scaffold_393634853641562352893e-52
PYUU:scaffold_20354273844286944514983e-51
PHKE:scaffold_694474761054714903e-50
SAPA:scaffold_173799853806652392845e-50
PYIR:scaffold_23634560352852553052e-49
PYAR:scaffold_58314115144724814e-49
ALCA:scaffold_52312154135995014752e-48
APIN:scaffold_701399341409923663621e-45
PYIR:scaffold_1258635576654504512e-45
ALLA:FR82424632792335832673643e-45
PYVX:scaffold_12438126392143783471e-39
PYIW:scaffold_339081118573573925e-38
PYAP:scaffold_61012453138024783803e-36
PLHA:NW_020190027.154976559473303803e-36
PYUU:scaffold_13521327571338093543652e-34
PYIR:scaffold_544493563084843643e-34
ALCA:scaffold_26216793181454813563e-33
ALLA:FR82422024723260784823554e-33
PHKE:scaffold_81640381653844803521e-32
APIN:scaffold_304761634768792512532e-32
PHRA:scaffold_601872391882133283444e-32
PHKE:scaffold_13921103934534823378e-31
HYAP:scaffold_20838045393884793323e-30
PHKE:scaffold_351060431073894843244e-29
HYAP:scaffold_321821001826901993154e-28
PHKE:scaffold_661061981067881993145e-28
PYUU:scaffold_20326522336535794783102e-27
PYVX:scaffold_632843496724413064e-27
PHSO:scaffold_44005134011031993041e-26
PHIF:NW_003303731.1189899118995811992994e-26
PHPA:scaffold_791005871011771992941e-25
PHSO:scaffold_2130070813020514902914e-25
PHRA:scaffold_10967354687064802914e-25
PHCA:scaffold_207763987769882012871e-24
PHIF:NW_003303722.154881562334822862e-24
PHCA:scaffold_513801263814784792842e-24
PHKE:scaffold_531311643544332833e-24
PHKE:scaffold_1317492187664742781e-23
PLHA:NW_020187357.12991483005665042692e-22
SAPA:scaffold_541165581179344962611e-21
SADI:scaffold_194915714929144852583e-21
PYAR:scaffold_42514438158625092541e-20
PHIF:NW_003303667.12300372307442521812e-20
APAS:scaffold_244172604179192312513e-20
APIN:scaffold_444333455714412503e-20
SAPA:scaffold_473311136531842461e-19
PYVX:scaffold_6751055410760701435e-19
APAS:scaffold_8845178464164432398e-19
PYIW:scaffold_330825531872305e-18
APAS:scaffold_962026232032672282308e-18
SAPA:scaffold_114000554005131572272e-17
PHPA:scaffold_312472272484264222227e-17
PYAR:scaffold_1175317240022902146e-16
PYAP:scaffold_25534414353583371813e-15
HYAP:scaffold_731609331615442191655e-10
SADI:scaffold_472620792623691161621e-09
SAPA:scaffold_728739687638961593e-09
PHRA:scaffold_53529503540203711575e-09
PHPA:scaffold_1343417534352423701503e-08
ALLA:FR82406994907960733951451e-07
PHIF:NW_003303668.192588932382321404e-07
PYIW:scaffold_2918289234101841395e-07
PHRA:scaffold_322108322114792311396e-07
PLHA:NW_020187364.14563694570162311361e-06
PHPA:scaffold_173177803184362341333e-06
PHSO:scaffold_79634709641172311324e-06
PHKE:scaffold_794229229422321314e-06
HYAP:scaffold_29813173138262261306e-06
PHPA:scaffold_1753539235616801281e-05
PHCA:scaffold_7139928405932391271e-05
APIN:scaffold_118317201831887641244e-05
APAS:scaffold_2924362924529641226e-05
APIN:scaffold_14866696866872671218e-05
APAS:scaffold_15846638846865841191e-04
PYIR:scaffold_818534749801191e-04
PHIF:NW_003303629.150533509821581163e-04
SAPA:scaffold_875779058038991163e-04
SADI:scaffold_13323109323285671163e-04
PYVX:scaffold_5281201812209721137e-04
PYUU:scaffold_2014329151329318641110.001
PHIF:NW_003303757.141577624157920611090.002
PYVX:scaffold_12722238871080.003
PHPA:scaffold_139104913901411080.003
PYAP:scaffold_2462173621981941060.004
ALCA:scaffold_51092111079611060.005
PYIW:scaffold_92414851652641050.006
PYIW:scaffold_103436723839641050.006
PHKE:scaffold_653925439457851050.006
ALCA:scaffold_100339964160631030.008
PYAR:scaffold_3981084511075901030.009
PLHA:NW_020187508.18835488512611030.009
HYAP:scaffold_261513171516581411030.010
PHSO:scaffold_354038425404009641020.012
PYIR:scaffold_335928759457651020.012
ALLA:FR824046456002456160611020.012
PYUU:scaffold_1402621231621407671020.014
PYIW:scaffold_730721338114920.069
SAPA:scaffold_13511966210655950.078
PHKE:scaffold_157779278346203900.30
PHIF:NW_003303230.16387653057890.48
PYVX:scaffold_14714516440788.0
APIN:scaffold_1264306164319244788.3
TBLASTN 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Database: OGOB_genomes.fna
           64,241 sequences; 1,297,559,224 total letters

Query= HYAP_07095

Length=613
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_5...  1195       0.0   
PHSO:scaffold_1                                                       964        0.0   
PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 ...  959        0.0   
PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercon...  956        0.0   
PHCA:scaffold_84 PHYCAscaffold_84                                     952        0.0   
PHRA:scaffold_56                                                      947        0.0   
PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 ge...  941        0.0   
PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig:...  863        0.0   
PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:p...  830        0.0   
PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:p...  813        0.0   
PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_sc...  811        0.0   
PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:pi...  729        0.0   
PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_...  723        0.0   
PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pv...  695        0.0   
APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_a...  661        0.0   
APIN:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_i...  660        0.0   
SADI:scaffold_150 supercont1.150 dna:supercontig supercontig:Sap_...  627        0.0   
SAPA:scaffold_113 supercont2.113 dna:supercontig supercontig:ASM1...  625        0.0   
SAPA:scaffold_10 supercont2.10 dna:supercontig supercontig:ASM151...  392        2e-118
SADI:scaffold_71 supercont1.71 dna:supercontig supercontig:Sap_di...  392        2e-118
PHCA:scaffold_8 PHYCAscaffold_8                                       220        3e-59 
PYAP:scaffold_739 pag1_scaffold_739 dna:supercontig supercontig:p...  218        1e-58 
PYAR:scaffold_544 par_scaffold_544 dna:supercontig supercontig:pa...  217        3e-58 
PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 ge...  214        2e-57 
SADI:scaffold_9 supercont1.9 dna:supercontig supercontig:Sap_dicl...  213        6e-57 
PYAP:scaffold_510 pag1_scaffold_510 dna:supercontig supercontig:p...  211        2e-56 
PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 ...  209        9e-56 
PHSO:scaffold_13                                                      208        2e-55 
PHRA:scaffold_75                                                      203        1e-53 
HYAP:scaffold_87 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_8...  202        2e-53 
PLHA:NW_020187271.1 Plasmopara halstedii genome assembly, contig:...  202        2e-53 
SADI:scaffold_83 supercont1.83 dna:supercontig supercontig:Sap_di...  116        9e-53 
SADI:scaffold_39 supercont1.39 dna:supercontig supercontig:Sap_di...  115        3e-52 
PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:p...  196        3e-51 
PHKE:scaffold_694 scf_22126_694.1 dna:supercontig supercontig:Phy...  193        3e-50 
SAPA:scaffold_17 supercont2.17 dna:supercontig supercontig:ASM151...  114        5e-50 
PYIR:scaffold_236 pir_scaffold_236 dna:supercontig supercontig:pi...  122        2e-49 
PYAR:scaffold_583 par_scaffold_583 dna:supercontig supercontig:pa...  189        4e-49 
ALCA:scaffold_523 AcNc2_CONTIG_523_length_15388 dna:supercontig s...  187        2e-48 
APIN:scaffold_70 supercont1.70 dna:supercontig supercontig:Apha_i...  144        1e-45 
PYIR:scaffold_1258 pir_scaffold_1258 dna:supercontig supercontig:...  178        2e-45 
ALLA:FR824246 dna:supercontig supercontig:ENA1:FR824246:1:47019:1...  144        3e-45 
PYVX:scaffold_124 pve_scaffold_124 dna:supercontig supercontig:pv...  138        1e-39 
PYIW:scaffold_3390 piw_scaffold_3390 dna:supercontig supercontig:...  155        5e-38 
PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:p...  150        3e-36 
PLHA:NW_020190027.1 Plasmopara halstedii genome assembly, contig:...  150        3e-36 
PYUU:scaffold_1352 scf1117875581352 dna:supercontig supercontig:p...  145        2e-34 
PYIR:scaffold_544 pir_scaffold_544 dna:supercontig supercontig:pi...  144        3e-34 
ALCA:scaffold_262 AcNc2_CONTIG_262_length_36549 dna:supercontig s...  141        3e-33 
ALLA:FR824220 dna:supercontig supercontig:ENA1:FR824220:1:54737:1...  141        4e-33 
PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig superconti...  140        1e-32 
APIN:scaffold_30 supercont1.30 dna:supercontig supercontig:Apha_i...  102        2e-32 
PHRA:scaffold_60                                                      137        4e-32 
PHKE:scaffold_1 scf_22126_1.1_contig_1 dna:supercontig superconti...  134        8e-31 
HYAP:scaffold_208 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  132        3e-30 
PHKE:scaffold_35 scf_22126_35.1_contig_1 dna:supercontig supercon...  129        4e-29 
HYAP:scaffold_32 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_3...  125        4e-28 
PHKE:scaffold_66 scf_22126_66.1 dna:supercontig supercontig:PhyKe...  125        5e-28 
PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:p...  124        2e-27 
PYVX:scaffold_632 pve_scaffold_632 dna:supercontig supercontig:pv...  122        4e-27 
PHSO:scaffold_4                                                       121        1e-26 
PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 ge...  119        4e-26 
PHPA:scaffold_79 NW_008649065.1 Phytophthora parasitica INRA-310 ...  117        1e-25 
PHSO:scaffold_2                                                       116        4e-25 
PHRA:scaffold_109                                                     116        4e-25 
PHCA:scaffold_20 PHYCAscaffold_20                                     115        1e-24 
PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 ge...  114        2e-24 
PHCA:scaffold_51 PHYCAscaffold_51                                     114        2e-24 
PHKE:scaffold_531 scf_22126_531.1 dna:supercontig supercontig:Phy...  113        3e-24 
PHKE:scaffold_13 scf_22126_13.1_contig_1 dna:supercontig supercon...  111        1e-23 
PLHA:NW_020187357.1 Plasmopara halstedii genome assembly, contig:...  108        2e-22 
SAPA:scaffold_54 supercont2.54 dna:supercontig supercontig:ASM151...  105        1e-21 
SADI:scaffold_19 supercont1.19 dna:supercontig supercontig:Sap_di...  103        3e-21 
PYAR:scaffold_425 par_scaffold_425 dna:supercontig supercontig:pa...  102        1e-20 
PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 ge...  74.3       2e-20 
APAS:scaffold_24 supercont1.24 dna:supercontig supercontig:Apha_a...  101        3e-20 
APIN:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_inv...  100        3e-20 
SAPA:scaffold_473 supercont2.473 dna:supercontig supercontig:ASM1...  99.4       1e-19 
PYVX:scaffold_675 pve_scaffold_675 dna:supercontig supercontig:pv...  79.0       2e-13 
APAS:scaffold_88 supercont1.88 dna:supercontig supercontig:Apha_a...  96.7       8e-19 
PYIW:scaffold_3308 piw_scaffold_3308 dna:supercontig supercontig:...  93.2       5e-18 
APAS:scaffold_96 supercont1.96 dna:supercontig supercontig:Apha_a...  93.2       8e-18 
SAPA:scaffold_11 supercont2.11 dna:supercontig supercontig:ASM151...  92.0       2e-17 
PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 ...  90.1       7e-17 
PYAR:scaffold_1175 par_scaffold_1175 dna:supercontig supercontig:...  87.0       6e-16 
PYAP:scaffold_255 pag1_scaffold_255 dna:supercontig supercontig:p...  74.3       3e-15 
HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_7...  68.2       5e-10 
SADI:scaffold_47 supercont1.47 dna:supercontig supercontig:Sap_di...  67.0       1e-09 
SAPA:scaffold_72 supercont2.72 dna:supercontig supercontig:ASM151...  65.9       3e-09 
PHRA:scaffold_5                                                       65.1       5e-09 
PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 u...  62.4       3e-08 
ALLA:FR824069 dna:supercontig supercontig:ENA1:FR824069:1:177300:...  60.5       1e-07 
PHIF:NW_003303668.1 Phytophthora infestans T30-4 supercont1.91 ge...  58.5       4e-07 
PYIW:scaffold_2918 piw_scaffold_2918 dna:supercontig supercontig:...  58.2       5e-07 
PHRA:scaffold_32                                                      58.2       6e-07 
PLHA:NW_020187364.1 Plasmopara halstedii genome assembly, contig:...  57.0       1e-06 
PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 ...  55.8       3e-06 
PHSO:scaffold_7                                                       55.5       4e-06 
PHKE:scaffold_794 scf_22126_794.1_contig_1 dna:supercontig superc...  55.1       4e-06 
HYAP:scaffold_298 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_...  54.7       6e-06 
PHPA:scaffold_175 NW_008649161.1 Phytophthora parasitica INRA-310...  53.9       1e-05 
PHCA:scaffold_71 PHYCAscaffold_71                                     53.5       1e-05 
APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inv...  52.4       4e-05 
APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_ast...  51.6       6e-05 
APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_i...  51.2       8e-05 
APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_a...  50.4       1e-04 
PYIR:scaffold_818 pir_scaffold_818 dna:supercontig supercontig:pi...  50.4       1e-04 
PHIF:NW_003303629.1 Phytophthora infestans T30-4 supercont1.130 g...  49.3       3e-04 
SAPA:scaffold_87 supercont2.87 dna:supercontig supercontig:ASM151...  49.3       3e-04 
SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_di...  49.3       3e-04 
PYVX:scaffold_528 pve_scaffold_528 dna:supercontig supercontig:pv...  48.1       7e-04 
PYUU:scaffold_2014 scf1117875582014 dna:supercontig supercontig:p...  47.4       0.001 
PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 gen...  46.6       0.002 
PYVX:scaffold_1272 pve_scaffold_1272 dna:supercontig supercontig:...  46.2       0.003 
PHPA:scaffold_139 NW_008649125.1 Phytophthora parasitica INRA-310...  46.2       0.003 
PYAP:scaffold_246 pag1_scaffold_246 dna:supercontig supercontig:p...  45.4       0.004 
ALCA:scaffold_5 AcNc2_CONTIG_5_length_245754 dna:supercontig supe...  45.4       0.005 
PYIW:scaffold_924 piw_scaffold_924 dna:supercontig supercontig:pi...  45.1       0.006 
PYIW:scaffold_1034 piw_scaffold_1034 dna:supercontig supercontig:...  45.1       0.006 
PHKE:scaffold_65 scf_22126_65.1 dna:supercontig supercontig:PhyKe...  45.1       0.006 
ALCA:scaffold_1003 AcNc2_CONTIG_1003_length_4568 dna:supercontig ...  44.3       0.008 
PYAR:scaffold_398 par_scaffold_398 dna:supercontig supercontig:pa...  44.3       0.009 
PLHA:NW_020187508.1 Plasmopara halstedii genome assembly, contig:...  44.3       0.009 
HYAP:scaffold_26 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_2...  44.3       0.010 
PHSO:scaffold_3                                                       43.9       0.012 
PYIR:scaffold_33 pir_scaffold_33 dna:supercontig supercontig:pir_...  43.9       0.012 
ALLA:FR824046 dna:supercontig supercontig:ENA1:FR824046:1:580768:...  43.9       0.012 
PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:p...  43.9       0.014 
PYIW:scaffold_7307 piw_scaffold_7307 dna:supercontig supercontig:...  40.0       0.069 
SAPA:scaffold_1351 supercont2.1351 dna:supercontig supercontig:AS...  41.2       0.078 
PHKE:scaffold_15 scf_22126_15.1_contig_1 dna:supercontig supercon...  39.3       0.30  
PHIF:NW_003303230.1 Phytophthora infestans T30-4 supercont1.538 g...  38.9       0.48  
PYVX:scaffold_1471 pve_scaffold_1471 dna:supercontig supercontig:...  34.7       8.0   
APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_i...  34.7       8.3   

>HYAP:scaffold_59 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_59:1:376122:1 
REF
Length=376122

 Score = 1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/589 (100%), Positives = 589/589 (100%), Gaps = 0/589 (0%)
 Frame = +2

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
               MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF
Sbjct  158852  MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  159031

Query  61      VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
               VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED
Sbjct  159032  VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  159211

Query  121     DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
               DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK
Sbjct  159212  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  159391

Query  181     KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
               KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS
Sbjct  159392  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  159571

Query  241     KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
               KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI
Sbjct  159572  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  159751

Query  301     FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
               FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM
Sbjct  159752  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  159931

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
               QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA
Sbjct  159932  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  160111

Query  421     GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
               GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY
Sbjct  160112  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  160291

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
               DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK
Sbjct  160292  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  160471

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP
Sbjct  160472  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  160618

>PHSO:scaffold_1
Length=13391543

 Score = 964 bits (2492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/593 (79%), Positives = 513/593 (87%), Gaps = 4/593 (1%)
 Frame = -2

Query  1        MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
                M ++YP  VAFE H FEDRDAFK WLS +  DF + FG DSKA  HVTSPFVW SNPTTF
Sbjct  2796655  MQMLYPDSVAFEAHPFEDRDAFKHWLSVAQGDFASCFGADSKAVKHVTSPFVWSSNPTTF  2796476

Query  61       VGGCDDLLAVFRSGIAVGNIQDVASTR----EDGETLDGTAPMDDTASASELNESRTPPI  116
                VGGCDDLLA FRSGIAVG  Q  A +     ED      T    + A A     + TP  
Sbjct  2796475  VGGCDDLLAFFRSGIAVGKPQGAAPSEQQQVEDKSAPSATMSTAEVADAPVPAVAETPSA  2796296

Query  117      VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
                V E + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVG
Sbjct  2796295  VDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVG  2796116

Query  177      CIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykV  236
                CIPKKLMHQSSLIGE++HHD A+FGWN+ S +G   TF WKQLV+NV  YI+ I+FKYKV
Sbjct  2796115  CIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKV  2795936

Query  237      ELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
                ELRSK VKYEN LGSFVD HTL+LWHP+KGTK+ITTR VVIAVGGRP++L C GGE A+S
Sbjct  2795935  ELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAIS  2795756

Query  297      SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
                SDDIFWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGE
Sbjct  2795755  SDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGE  2795576

Query  357      YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
                YME+QSGIEFIRKTVPQSITKL++GQLLVKW TEDG+  EE FDTVLNATGRDPDVAKLG
Sbjct  2795575  YMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLG  2795396

Query  417      LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
                LD+A VKLNEKTGRIWV NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  T 
Sbjct  2795395  LDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTA  2795216

Query  477      QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
                QMDYDKICTAVFTPIEYGCCGLSEEDSKE YG+D++EVYHKNFVPLEWSL+E+TR AAES
Sbjct  2795215  QMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAES  2795036

Query  537      CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                CY+KV+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  2795035  CYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  2794877

>PHPA:scaffold_63 NW_008649049.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.63, whole genome shotgun 
sequence
Length=342508

 Score = 959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/589 (80%), Positives = 513/589 (87%), Gaps = 6/589 (1%)
 Frame = -1

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
               M ++YP RV+FE H FEDR AFKQWLS S ED    FG DSKA  HVTSPFVW SNPTTF
Sbjct  247738  MQMLYPDRVSFEAHPFEDRGAFKQWLSASQEDISASFGADSKAAKHVTSPFVWSSNPTTF  247559

Query  61      VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
               VGGCDDLLA FRSGIA G  Q V  + E+  T   TAP  +T +      + T P   E 
Sbjct  247558  VGGCDDLLAFFRSGIAAGKHQGVTPS-ENQPT--ATAPATETDAPMPEVTAETSPADAEK  247388

Query  121     DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
               + SYDYDLVVIGGGSGGLACSKEAAS G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  247387  ETSYDYDLVVIGGGSGGLACSKEAASLGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  247208

Query  181     KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
               KLMHQSSLIGE++HHD A+FGWNV    G  PTFDWKQLV+NV  YIK I+FKYKVELRS
Sbjct  247207  KLMHQSSLIGEVMHHDSANFGWNV---EGSAPTFDWKQLVTNVDGYIKGINFKYKVELRS  247037

Query  241     KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
               K VKYEN +GSF+DPHTL+LWHP+KGTK+ITTR VVIAVGGRPR+L C GGE A+SSDDI
Sbjct  247036  KYVKYENFMGSFIDPHTLELWHPRKGTKQITTRDVVIAVGGRPRELTCPGGEHAISSDDI  246857

Query  301     FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
               FWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  246856  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMATKIGEYMEV  246677

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
               QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FDTVLNATGRDPDVAKLGLD+A
Sbjct  246676  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  246497

Query  421     GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
               GVKLNEK+GRIWV NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  246496  GVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  246317

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
               DK+CTAVFTPIEYGCCGLSEE+S E YG+D++EVYH NFVPLEWSL+ +TR AAESCYVK
Sbjct  246316  DKVCTAVFTPIEYGCCGLSEENSIERYGEDNIEVYHTNFVPLEWSLSTETRTAAESCYVK  246137

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               VVCDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  246136  VVCDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  245990

>PHKE:scaffold_98 scf_22126_98.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_98.1_contig_1:1:103693:1 
REF
Length=103693

 Score = 956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/589 (79%), Positives = 519/589 (88%), Gaps = 7/589 (1%)
 Frame = -2

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
              M ++YP +V+FETHAFEDRDAFKQWLSTS + FV  FG DSKA THVTSPFVW SNP  F
Sbjct  63459  MQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKF  63280

Query  61     VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
              VGGCDDLLA FRSG+AVG+ Q      +  E  +  A ++   + S +  + TP + +E+
Sbjct  63279  VGGCDDLLAFFRSGVAVGSPQGA----DPAEKAEAAASIE--VAESSMTVTETPAVPMEE  63118

Query  121    DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
              + SYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  63117  ETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  62938

Query  181    KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              KLMHQSSLIGE +HHD A+FGWNV S  G+  TFDWKQLVSNV SYIKSI+FKYKVELRS
Sbjct  62937  KLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRS  62758

Query  241    KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
              K VKYEN LGSF+DPHTL+LWHP+KGTK+ITTRHVV+AVGGRP+QL C G E A+SSDDI
Sbjct  62757  KYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDI  62578

Query  301    FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
              FWMK+  PGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  62577  FWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  62398

Query  361    QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
              Q+GIEFIRKTVP+SITKL++GQLLVKW TED +  EETFDTVLNATGRDPDVAKLGLD+A
Sbjct  62397  QAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKA  62218

Query  421    GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
              GVKLNEKTGRIW  NEQT+TPN++AIGDVIDAPELTPVAIQAGR LSRRLYN  TVQMDY
Sbjct  62217  GVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDY  62038

Query  481    DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
              DK+CTAVFTPIEYGCCGLSEEDS E +G+D+VEVYHKNFVPLEWSL+E +R ++ESCYVK
Sbjct  62037  DKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSE-SRTSSESCYVK  61861

Query  541    VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              V+CD TR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  61860  VICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  61714

>PHCA:scaffold_84 PHYCAscaffold_84
Length=182275

 Score = 952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/589 (78%), Positives = 515/589 (87%), Gaps = 6/589 (1%)
 Frame = -3

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
              M ++YP RV FE H FEDR+AFK WLS S ++F T FG+DSKAT HVTSPFVW SNPT F
Sbjct  98087  MQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAF  97908

Query  61     VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
              VGGCDDLL  FRSG+ VGN Q       +G   + TA  D   S + + E+ T      +
Sbjct  97907  VGGCDDLLTYFRSGVGVGNPQGATP---NGSPTEKTAEADVPMSETSVEETSTADA---E  97746

Query  121    DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
              + +YDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  97745  ETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  97566

Query  181    KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              KLMHQSSLIGE++HHD A+FGWN+ S +G  PTF+WKQLVSNV  YIKSI+FKYKVELRS
Sbjct  97565  KLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINFKYKVELRS  97386

Query  241    KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
              K VKYEN LGSFV+PHTL+LWHP+KGTK+ITTR VVIAVGGRP++L C GGE A+SSDDI
Sbjct  97385  KYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDI  97206

Query  301    FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
              FWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA KIGEYME+
Sbjct  97205  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMADKIGEYMEV  97026

Query  361    QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
              QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FDTVLNATGRDPDVAKL LD+A
Sbjct  97025  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDVAKLNLDKA  96846

Query  421    GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
              GVKLNEK+GRIWV NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  96845  GVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTVQMDY  96666

Query  481    DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
              +K+CTAVFTPIEYGCCG+SEEDSKE +G+D++EVYH NFVPLEWSL+  TR AAESCY+K
Sbjct  96665  EKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRTAAESCYLK  96486

Query  541    VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              V+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  96485  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  96339

>PHRA:scaffold_56
Length=334739

 Score = 947 bits (2448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/589 (80%), Positives = 514/589 (87%), Gaps = 3/589 (1%)
 Frame = +1

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
               M ++YP RVAFE H FEDRDAFKQWLS S  DF   FG DSKA THVTSPFVW SNPTTF
Sbjct  158536  MQMLYPERVAFEMHPFEDRDAFKQWLSESKTDFAASFGADSKANTHVTSPFVWSSNPTTF  158715

Query  61      VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
               VGGCDDLL  FRSG+AVG  Q V    +  E    TA     A A+   E+  P    E+
Sbjct  158716  VGGCDDLLTFFRSGVAVGKPQGVEPAEKQREE-PATAAGTADALAAVEEEAEIPSADAEE  158892

Query  121     DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
               + SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  158893  ETSYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  159072

Query  181     KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
               KLMHQSSLIGE++HHD A+FGWNV S  G  PTF+WKQLVSNV +YIKSI+FKYKVELRS
Sbjct  159073  KLMHQSSLIGEVMHHDSANFGWNVAS-EGSAPTFNWKQLVSNVDAYIKSINFKYKVELRS  159249

Query  241     KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
               K VKYEN LGSFVDPHTL+LWH +KGTK+ITTR VVIAVGGRP++L+C GGE A+SSDDI
Sbjct  159250  KYVKYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDI  159429

Query  301     FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
               FWMK+KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  159430  FWMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEV  159609

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
               QSGIEFIRKTVPQSIT L++GQLLVKW  EDG+  EE FDTVLNATGRDPDVAKLGLD+A
Sbjct  159610  QSGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKA  159789

Query  421     GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
               GVKLNEK+GRIWV NEQT+T N+YA+GDVIDAPELTPVAIQAGRLLSRRLYN  T QMDY
Sbjct  159790  GVKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDY  159969

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
               +K+CTAVFTPIEYGCCGLSEEDSKE +G+D+VEVYH NFVPLEWSL+E TR +AESCYVK
Sbjct  159970  EKVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSE-TRTSAESCYVK  160146

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               V+CDKTR+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  160147  VICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  160293

>PHIF:NW_003303697.1 Phytophthora infestans T30-4 supercont1.62 
genomic scaffold, whole genome shotgun sequence
Length=695754

 Score = 941 bits (2433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/589 (78%), Positives = 506/589 (86%), Gaps = 4/589 (1%)
 Frame = -2

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
               M ++YP RVAFETH FEDR+AFKQWLS S +D    FG DS+AT HVTSPFVW S  T F
Sbjct  397850  MQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSS--TIF  397677

Query  61      VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
               VGGCD+LLA FRSGIAVG  Q V  + +        AP  D +      E  T     ++
Sbjct  397676  VGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETDGSMPDVAAE--TSSTAAKE  397503

Query  121     DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
               +ASYDYDLVVIGGGSGGLACSKEAASFG+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPK
Sbjct  397502  EASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPK  397323

Query  181     KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
               KLMHQSSLIGE+LHHD ASFGWNV S  G  P FDWKQLV+NV  YI+ I+FKYKVELRS
Sbjct  397322  KLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRS  397143

Query  241     KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
               K VKYEN LGSF+DPHTL+LWHP+KG+K+ITTR VVIAVGGRPR+L   GGE A+SSDDI
Sbjct  397142  KYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTIPGGEHAISSDDI  396963

Query  301     FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
               FWMK KEPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFDQDMA+KIGEYME+
Sbjct  396962  FWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEV  396783

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
               QSGIEFIRKTVPQSITKL++GQLLVKW +EDG+  EE FD+VLNATGRDPD+AKL LD+A
Sbjct  396782  QSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKA  396603

Query  421     GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
               GVKLNEKTGRIWV +EQT+TPN+YAIGDVIDAPELTPVAIQAGRLLSRRLYN  TVQMDY
Sbjct  396602  GVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDY  396423

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
               DK+CTAVFTPIEYGCCGLSEEDS + +G D +EVYH NFVPLEWSL+ +TR AAESCYVK
Sbjct  396422  DKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVK  396243

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               V+CD+ R+ FV+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+VDTVGIHP
Sbjct  396242  VICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  396096

>PLHA:NW_020189861.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_2956, whole genome shotgun sequence
Length=1921269

 Score = 863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/592 (72%), Positives = 491/592 (83%), Gaps = 5/592 (1%)
 Frame = -2

Query  1        MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
                M ++YP R+AF+   FEDR+ F+ WL  S  DF   FG  SKA  HVTSPFVW SNPTTF
Sbjct  1851284  MQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGAKSKAMKHVTSPFVWSSNPTTF  1851105

Query  61       VGGCDDLLAVFRSGIAVGNIQDVASTRE-DGETLDGTA--PMDDTASASELNESRTPPIV  117
                VGGCDDLL  FRSGIAVG  Q + ++ E  G++    A    DD    S   E  +    
Sbjct  1851104  VGGCDDLLLFFRSGIAVGRPQGMHTSDEVAGKSSKSVAIPETDDVIPKSRYQEISS--TA  1850931

Query  118      VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGC  177
                V++   +DYDLVVIGGG GGLACSKEAASFG+KVCVLDYVKPSP GT+WGLGGTCVNVGC
Sbjct  1850930  VQEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGC  1850751

Query  178      IPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVE  237
                IPKKL+HQSSLIGEI+ HD A FGW   +    VP FDWKQLV+NV  YIK+I+FKYKV+
Sbjct  1850750  IPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVK  1850571

Query  238      LRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSS  297
                LRSK VKYEN LGSFVDPHT+KL HP+KGTK+ITTR+VVIAVG RPR+L C GGE AVSS
Sbjct  1850570  LRSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSS  1850391

Query  298      DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEY  357
                DDIFWMK+KEPGKTLV+GASYVALECAGFLKGMGY VKVMVRSILLR FDQ+MA KIGEY
Sbjct  1850390  DDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEY  1850211

Query  358      MEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGL  417
                ME+QSGI+FIRKTVPQSI++L++ QLLVKW+ E G   EE F+TVLNATGRDP+VA LGL
Sbjct  1850210  MEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGL  1850031

Query  418      DEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQ  477
                D+AGVKLNEKTGRI V NEQT+T N+YAIGDV+DAPELTPVAIQ+GRLLS+RLYN  +VQ
Sbjct  1850030  DKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQ  1849851

Query  478      MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC  537
                MDYDK+CT VFTPIEYGCCGLSEE SK  YG+D++E+YH NFVPLEWSL+ +TR A+ SC
Sbjct  1849850  MDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSC  1849671

Query  538      YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                Y+KVVCDK+R+ FVLGFHYLGPNAGEV QAMGLAM+L FTYDQ+V+TVGIHP
Sbjct  1849670  YIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHP  1849515

>PYUU:scaffold_2037 scf1117875582037 dna:supercontig supercontig:pug:scf1117875582037:1:1414051:1 
REF
Length=1414051

 Score = 830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/591 (71%), Positives = 473/591 (80%), Gaps = 31/591 (5%)
 Frame = -3

Query  1        MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
                M V+YP  + F  H F DRDAF+ WL  S +DF T FG  S A TH +SPFVW SN   F
Sbjct  1305743  MQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEF  1305567

Query  61       VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPM--DDTASASELNESRTPPIVV  118
                VGGCD LLA  R  I+V         RE        AP+  D+   A             
Sbjct  1305566  VGGCDALLATIRGSISVRAFDASPVMRE--------APVKQDNKQDA-------------  1305450

Query  119      EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
                 D  +YDYDLVVIGGGSGGLACSKEAA +GKKVCVLDYVKPS  GTSWGLGGTCVNVGCI
Sbjct  1305449  -DAVTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSLVGTSWGLGGTCVNVGCI  1305273

Query  179      PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
                PKKLMHQSSLIGE +H D  +FGW VG       TFDW Q++ +V+SYIKSI+FKYKVEL
Sbjct  1305272  PKKLMHQSSLIGETIHKDSKAFGWTVGE-----QTFDWAQMLKSVNSYIKSINFKYKVEL  1305108

Query  239      RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298
                R K+VKYEN+LGSF+D HTL+LWHPKKGTK +TTR VVIAVGGRP+ LAC GG+LA+SSD
Sbjct  1305107  RDKKVKYENLLGSFIDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLACEGGDLAISSD  1304928

Query  299      DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
                DIFW K+  PGKTLVVGASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMA KIGE+M
Sbjct  1304927  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMADKIGEFM  1304751

Query  359      EMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418
                E++S IEFIR  VPQSI KL++GQLLVKW T DG+  EE FDTVLNATGRDPDVAKLGLD
Sbjct  1304750  EVESKIEFIRGCVPQSIMKLENGQLLVKWTTADGEACEEAFDTVLNATGRDPDVAKLGLD  1304571

Query  419      EAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM  478
                +AGVKLN KTGRIWV NEQT+TPNVYAIGDVIDAPELTPVAIQAGRLL+RRLYN  T  M
Sbjct  1304570  KAGVKLNPKTGRIWVENEQTSTPNVYAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLM  1304391

Query  479      DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
                DYDK+CTAVFTPIEYGCCGLSEE S E++G+D++E+YH+NF PLEWSL+  TR AA SCY
Sbjct  1304390  DYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDNLEIYHQNFTPLEWSLSSATRPAASSCY  1304211

Query  539      VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                VKV+CDK+R+ +V+GFHYLGPNAGEVTQAMGLAMKLGFTYDQ+V+ VGIHP
Sbjct  1304210  VKVICDKSRDKYVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVNVVGIHP  1304058

>PYAP:scaffold_162 pag1_scaffold_162 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_162:1:52209:1 
REF
Length=52209

 Score = 813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/589 (68%), Positives = 476/589 (81%), Gaps = 32/589 (5%)
 Frame = -1

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60
              M ++Y   VA E   FE RDAFK WL+ S   F   FG DS A TH +SPFVW SN   F
Sbjct  18723  MQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGTDSPALTHTSSPFVW-SNARGF  18547

Query  61     VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120
              +GGCD  LA FRSG+A                     P+   +++  +      P+ V++
Sbjct  18546  IGGCDATLAHFRSGVA-------------------ARPLAGPSASPTMT-----PVAVDE  18439

Query  121    DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
                +YDYDLVVIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPK
Sbjct  18438  SKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPK  18259

Query  181    KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              KLMHQS+LIGE++H D  +FGWN+G        F W QLV +V++YIK I+FKYKVELR 
Sbjct  18258  KLMHQSALIGELMHKDAGAFGWNMGEQK-----FTWTQLVESVNNYIKGINFKYKVELRD  18094

Query  241    KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300
              K+VKYEN LGSFVDPHT++LWH KKGTK ITTRHVV+AVGGRPRQL+C GGE A+SSDDI
Sbjct  18093  KKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDI  17914

Query  301    FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360
              FW ++ EPGKTLVVGASYVALECAGFLKGMGY VKVMVRSILLRGFD+DMA++IG++M+ 
Sbjct  17913  FW-RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQD  17737

Query  361    QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420
              +S IEFIR  VP+SI KL++GQLLVKW + DG+  EE FD+VLNATGRDPDV+KL LD+A
Sbjct  17736  ESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKA  17557

Query  421    GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480
              GV+LN KTGRI V NEQT+TPNV+AIGDVIDAPELTPVAIQAGRLL+RRLYN  T  MDY
Sbjct  17556  GVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDY  17377

Query  481    DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
              DK+CTAVFTPIEYGCCGLSEE +K++YG+D++E+YH++F+PLEWSL+ Q R+AA +CYVK
Sbjct  17376  DKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLS-QDRVAANTCYVK  17200

Query  541    VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              V+CDKTR+ +V+GFHYLGPNAGEVTQAMGLAMK+GFTYDQ+V+ VGIHP
Sbjct  17199  VICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHP  17053

>PYIR:scaffold_8 pir_scaffold_8 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_8:1:111390:1 
REF
Length=111390

 Score = 811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/591 (70%), Positives = 477/591 (81%), Gaps = 34/591 (6%)
 Frame = +1

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWL--STSYEDFVTQFGLDSKATTHVTSPFVWISNPT  58
               M V+YP  V FE H F DR+AF++WL  S++ E+    FG DSKA TH +SPFVW +N  
Sbjct  104263  MRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVW-ANTR  104439

Query  59      TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
                F+GGCDD LA+FRSG+                    +AP    A+ + +  +       
Sbjct  104440  GFIGGCDDTLALFRSGV--------------------SAPATLAATPTMVAAAPA----P  104547

Query  119     EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
                DDA YDYDL+VIGGGSGGLACSKEA+ +GKKVCVLDYVKPSP GTSWGLGGTCVNVGCI
Sbjct  104548  ADDAKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  104727

Query  179     PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
               PKKLMHQSSLIGE +H D  +FGW VG       TFDW Q++ +V+SYIKSI+FKYKVEL
Sbjct  104728  PKKLMHQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVEL  104892

Query  239     RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298
               R K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GG+LA+SSD
Sbjct  104893  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  105072

Query  299     DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
               DIFW K+  PGKTLVVGASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMA+KIGE+M
Sbjct  105073  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFM  105249

Query  359     EMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418
               E +S IEFIR  VPQSITKL+SGQLLVKW++ DG+  EE FDTVLNATGRDPDVAKLGLD
Sbjct  105250  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLD  105429

Query  419     EAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM  478
               + GVKLN KTGRI V NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLL+RRLYN  T  M
Sbjct  105430  KVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  105609

Query  479     DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
               DYDK+CTAVFTPIEYGCCGLSEE S E+YG++++E+YH+NF PLEWSL+   R AA SCY
Sbjct  105610  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCY  105786

Query  539     VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               VKV+CD  RN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYDQ+V+ VGIHP
Sbjct  105787  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHP  105939

>PYIW:scaffold_963 piw_scaffold_963 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_963:1:12226:1 
REF
Length=12226

 Score = 729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/531 (72%), Positives = 435/531 (82%), Gaps = 38/531 (7%)
 Frame = -2

Query  63    GCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPI----VV  118
             GCDD LA+FRSGI+    +D                           ES TP +    VV
Sbjct  8943  GCDDTLALFRSGISAQFGKD---------------------------ESPTPTMVAAPVV  8845

Query  119   EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
             +D+ +YDYDL+VIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCI
Sbjct  8844  DDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCI  8665

Query  179   PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
             PKKLMHQSSLIGE +H D A+FGW+VG        FDW Q++ +V+SYIKSI+FKYKVEL
Sbjct  8664  PKKLMHQSSLIGETIHKDAAAFGWSVGE-----QKFDWAQMLKSVNSYIKSINFKYKVEL  8500

Query  239   RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298
             R K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GGELA+SSD
Sbjct  8499  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSD  8320

Query  299   DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
             DIFW K+  PGKTLV+GASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMASKIGE+M
Sbjct  8319  DIFWRKEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFM  8143

Query  359   EMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418
             E++S IEFIR  VPQSITKL+SGQLLVKW++ DGD  EE FDTVLNATGRDPDVAKL LD
Sbjct  8142  EVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLD  7963

Query  419   EAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM  478
               GV+LN KTGRI V NEQT+ PN++AIGDVIDAPELTPVAIQAGR+L+RRLYN  T  M
Sbjct  7962  SVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALM  7783

Query  479   DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
             DYDK+CTAVFTPIEYGCCGLSEE S E++G+D +E+YH+NF PLEWSL+   R AA SCY
Sbjct  7782  DYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCY  7606

Query  539   VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             VKV+CD TRN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYD +V+ VGIHP
Sbjct  7605  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHP  7453

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  1     MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVW  53
             M V+YP  V  E H F DR+AF+ WLS S  DF   FG DSKA TH +SPFVW
Sbjct  9299  MRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFGADSKAATHTSSPFVW  9141

>PYAR:scaffold_29 par_scaffold_29 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_29:1:42963:1 
REF
Length=42963

 Score = 723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/475 (74%), Positives = 414/475 (87%), Gaps = 7/475 (1%)
 Frame = +3

Query  115    PIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVN  174
              P+ V+D+A+YDYDLVVIGGGSGGLACSKEAA  GKKV VLDYVKPSP GT+WGLGGTCVN
Sbjct  18348  PMDVDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVN  18527

Query  175    VGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfky  234
              VGCIPKKLMHQS+L+GE++H D  +FGW  G+      +F W QLV++V++YIK I+FKY
Sbjct  18528  VGCIPKKLMHQSALLGELMHKDAPAFGWTTGA-----QSFTWTQLVASVNNYIKGINFKY  18692

Query  235    kVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELA  294
              KVELR K+VKYEN LGSFVD HT++LWH KK  K +TTRHVVIAVGGRPR L C GGE A
Sbjct  18693  KVELRDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHA  18872

Query  295    VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKI  354
              +SSDDIFW K  EPGKTLVVGASYVALECAGFLKGMGY VK+MVRSILLRGFDQDMA++I
Sbjct  18873  ISSDDIFWRKT-EPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRI  19049

Query  355    GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
              G++M+ +S IEFIR  VP+SI K ++G+LLVKW + DGD  EE FDTVLNATGRDPDV K
Sbjct  19050  GDFMQDESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTK  19229

Query  415    LGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEG  474
              L LD+AGV+LN K+GRI   NEQT+TPN++AIGDVIDAPELTPVAIQAGRLL+RRLYN  
Sbjct  19230  LNLDKAGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE  19409

Query  475    TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAA  534
              T  MDYDKICTAVFTPIEYGCCGLSEED+K +YG++++E+YH++F+PLEWSL+E+ R+AA
Sbjct  19410  TTLMDYDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEE-RVAA  19586

Query  535    ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               +CYVKV+CDKTR+  V+GFHYLGPNAGEVTQAMGLAMK+GFTYDQ+V+ VGIHP
Sbjct  19587  ATCYVKVICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHP  19751

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +2

Query  40     DSKATTHVTSPFVWISNPTTFVGGCDDLLAVFRSG  74
              DS A TH +SPFVW SN   FVGGCD  LA FRSG
Sbjct  18197  DSPALTHTSSPFVW-SNAHGFVGGCDATLAHFRSG  18298

>PYVX:scaffold_275 pve_scaffold_275 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_275:1:32274:1 
REF
Length=32274

 Score = 695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/465 (74%), Positives = 405/465 (87%), Gaps = 5/465 (1%)
 Frame = +3

Query  125   DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
             DYDLVVIGGGSGGLACSKEA+ FG+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMH
Sbjct  4218  DYDLVVIGGGSGGLACSKEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMH  4397

Query  185   QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             QS+LIGE++H D A FGW   +     P FDW QL S+VS+YIK+++FKYKV+LR K+VK
Sbjct  4398  QSALIGEVMHKDAALFGWQFENA----PKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVK  4565

Query  245   YENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMK  304
             YEN LG+FVDPHT++L +P+K +K +TTR VV+AVGGRPR L C GGEL+++SDDIFW +
Sbjct  4566  YENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFW-R  4742

Query  305   QKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEMQSGI  364
             +  PGKTLVVGASYVALECAGFLKG GY VKVMVRSILLRGFDQDMA++IGEYME+++GI
Sbjct  4743  KTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGI  4922

Query  365   EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
             EFIR+TVP SITKL+ G+LLVKW   DG   EE FDTVLNATGR+PDV KL LD+AGVKL
Sbjct  4923  EFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKL  5102

Query  425   NEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKIC  484
             N KTGRI V NEQT+TPN++AIGDVIDAPELTPVAIQAGRLL+RRLYN  T  MDY+K+C
Sbjct  5103  NPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVC  5282

Query  485   TAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCD  544
             TAVFTPIEYGCCGLSEE+S E +G+D++EVYH+NF PLEW+L++ TR +  +CY+KV+CD
Sbjct  5283  TAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICD  5462

Query  545   KTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             KTR+ FV+GFHYLGPNAGEVTQA+GLAMKLGFTY+Q+V  VGIHP
Sbjct  5463  KTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  5597

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +2

Query  9     VAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTFVGGCDDLL  68
             V  E H F DRDAF+ WL+ S E F + FG +S A TH++SPFVW SNPT FVGGCD LL
Sbjct  3908  VEHEIHRFPDRDAFRAWLAASREAFASAFGDESAAVTHMSSPFVWTSNPTAFVGGCDALL  4087

Query  69    AVFRSGIAVGN  79
               FRS +   N
Sbjct  4088  DRFRSQVPRPN  4120

>APAS:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.18:1:978767:1 
REF
Length=978767

 Score = 661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/593 (59%), Positives = 424/593 (72%), Gaps = 40/593 (7%)
 Frame = +1

Query  1       MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59
               M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  945247  MQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDNDARPLKHKSSPFCYLEQDDTP  945426

Query  60      -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
                FVGGCDD LA FR+       Q   S      ++      +DT+ A             
Sbjct  945427  KFVGGCDDTLAFFRA-----RTQSAPSAPASSASIHA----NDTSDA-------------  945540

Query  119     EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
                 D  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  945541  --DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  945714

Query  179     PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
               PKKLMHQSS+IGEILH D   FGW+V +      TFDW +LVS+V  YI  ++FKY+V+L
Sbjct  945715  PKKLMHQSSIIGEILHKDADQFGWSVSNA-----TFDWSKLVSSVQDYIHGLNFKYRVDL  945879

Query  239     RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
               R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  945880  RDKKVKYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALS  946059

Query  297     SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
               SDDIF  K   PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  946060  SDDIF-SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  946236

Query  357     YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
               YME +SGI FI+++VP SI KL++GQ  V   T      ++ +DT+LNATGR PDV KL 
Sbjct  946237  YMESESGIAFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLN  946401

Query  417     LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
               LD AGV LN K+GRI V NEQT+TPN+YA+GDVIDAPELTPVAIQAG+LLSRRL+  GT 
Sbjct  946402  LDAAGVALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTT  946581

Query  477     QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
                MDY KICTAVFTP+EYGCCGLSEED+    G ++VEVYH+NF PLEWSL+    +A E 
Sbjct  946582  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKE-  946758

Query  537     CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               CY K++ D T+   VLGFHYLGPNAGEVTQA+G+A+KL  TYD  ++TVGIHP
Sbjct  946759  CYAKLIVDTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHP  946917

>APIN:scaffold_18 supercont1.18 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.18:1:1130244:1 
REF
Length=1130244

 Score = 660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/593 (58%), Positives = 425/593 (72%), Gaps = 38/593 (6%)
 Frame = -2

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTT-  59
              M  ++P +V    H   ++++F  WL+ S  +F  QF  D++   H +SPF ++    T 
Sbjct  69509  MQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTP  69330

Query  60     -FVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
               FVGGCDD LA FR+       Q   ST   G      A + DT+S+             
Sbjct  69329  KFVGGCDDTLAFFRA-----RTQSAPST---GAPSAANAHVSDTSSS-------------  69213

Query  119    EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
               D+  YD+DLVVIGGGSGGLACSKEA+  G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  69212  -DETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  69036

Query  179    PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
              PKKLMHQSS+IGE+LH D   FGW V +      +FDW +LVS+V  YI  ++FKY+++L
Sbjct  69035  PKKLMHQSSIIGELLHKDAEQFGWTVSNA-----SFDWTKLVSSVQDYIHGLNFKYRIDL  68871

Query  239    RSKQVKYENVLGSFVDPHTLKLWH--PKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
              R K+VKYEN+LG+F D HTL L +   KKG  ++T R  VIAVGGRP+ L+C G E A+S
Sbjct  68870  RDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAIS  68691

Query  297    SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
              SDDIF  K + PGKTLVVGASYVALECAGFLKG G+ V +MVRSILLRGFDQD+A +IGE
Sbjct  68690  SDDIF-SKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGE  68514

Query  357    YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
              YME +SGI FI+++VP SI KL +GQL V     +G      +DTVLNATGR PDV  L 
Sbjct  68513  YMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLN  68349

Query  417    LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
              L  AGV LN K+GRI V NEQT+TP++YAIGDVIDAPELTPVAIQAG+LL+RRL+  GT 
Sbjct  68348  LPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTA  68169

Query  477    QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
               MDY KICTAVFTP+EYGCCGLSEED+    G D+++VYH+NF PLEWSL+ +  +A E 
Sbjct  68168  LMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKE-  67992

Query  537    CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              CY K++ D T+   V+GFHYLGPNAGEVTQA+G+AMKL  TYD  V+TVGIHP
Sbjct  67991  CYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHP  67833

>SADI:scaffold_150 supercont1.150 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.150:1:81170:1 
REF
Length=81170

 Score = 627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/593 (57%), Positives = 418/593 (70%), Gaps = 41/593 (7%)
 Frame = -3

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNP--T  58
              M  ++PG+V    H    + +F  WL TS   F TQF  D++AT H TSPF ++ +   T
Sbjct  10245  MQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGT  10066

Query  59     TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
               FVGGCDD LA FRS       Q  A+       +                        V
Sbjct  10065  KFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND--------------------V  9961

Query  119    EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
              +D A+YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  9960   DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  9781

Query  179    PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
              PKKLMHQS+++GE+LH D  +FGW V +      TFDW +L+++V  YI  ++FKY+V+L
Sbjct  9780   PKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRVDL  9616

Query  239    RSKQVKYENVLGSFVDPHTLKLWHPKKGT--KEITTRHVVIAVGGRPRQLACLGGELAVS  296
              R K+VKYEN LG+F D HTL L +P KG   K++T R  +IAVGGRP+ L C G +LA+S
Sbjct  9615   RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  9436

Query  297    SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
              SDDIF  +   PGKTLVVGASYVALECAGFLKG G+ V VMVRSILLRGFD DMA++IG 
Sbjct  9435   SDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGT  9259

Query  357    YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
              YME ++ I FI+  VP SI +L +GQL V     +G      +DTVLNATGR PDV+ L 
Sbjct  9258   YMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLN  9094

Query  417    LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
              L  AGV LN KTGRI V +EQT+TP++YA+GDVID PELTPVAIQAGRLLS+RL++    
Sbjct  9093   LSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSAT  8914

Query  477    QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
               M YDK+CTAVFTPIEYGCCGLSE+ + E  G D++ VYH++F PLEWSL+   R  A+ 
Sbjct  8913   LMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAKE  8737

Query  537    CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              CY K++ D+T+N+ V+GFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHP
Sbjct  8736   CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHP  8578

>SAPA:scaffold_113 supercont2.113 dna:supercontig supercontig:ASM15154v2:supercont2.113:1:101906:1 
REF
Length=101906

 Score = 625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/593 (56%), Positives = 417/593 (70%), Gaps = 41/593 (7%)
 Frame = -2

Query  1      MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNP--T  58
              M  ++PG+V    H    + +F  WL  S   F TQF  D++AT H TSPF ++ +   T
Sbjct  88240  MQTLFPGQVKATIHEHATKQSFNDWLEASQATFATQFVGDARATNHYTSPFCYLEDGAGT  88061

Query  59     TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118
               FVGGCDD LA FRS       Q  A+       +                        V
Sbjct  88060  KFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND--------------------V  87956

Query  119    EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
              +D A+YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  87955  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  87776

Query  179    PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
              PKKLMHQS+++GE+LH D  +FGW V +      TFDW +LV++V  YI  ++FKY+V+L
Sbjct  87775  PKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLVTSVQDYIHGLNFKYRVDL  87611

Query  239    RSKQVKYENVLGSFVDPHTLKLWHPKKGT--KEITTRHVVIAVGGRPRQLACLGGELAVS  296
              R K+VKYEN LG+F D HTL L +P KG   K++T R  +IAVGGRP+ L C G +LA+S
Sbjct  87610  RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  87431

Query  297    SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
              SDDIF  +   PGKTLVVGASYVALECAGFLK  G+ V VMVRSILLRGFD DMA++IG 
Sbjct  87430  SDDIF-SRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIGT  87254

Query  357    YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416
              YME ++ I+FI+  VP SI +L +GQL V     +G      +DTVLNATGR+PDV+ L 
Sbjct  87253  YMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSGLN  87089

Query  417    LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476
              L  AGV LN KTGRI V +EQT+ P++YA+GDVID PELTPVAIQAGRLL++RL++    
Sbjct  87088  LPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSAT  86909

Query  477    QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
               M YDK+CTAVFTPIEYGCCGLSE+ + E  G D++ VYH++F PLEWSL+   R  A+ 
Sbjct  86908  LMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALAKE  86732

Query  537    CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              CY K++ D+T+N+ V+GFHYLGPNAGEVTQA+G+AMKL  +YD  V TVGIHP
Sbjct  86731  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHP  86573

>SAPA:scaffold_10 supercont2.10 dna:supercontig supercontig:ASM15154v2:supercont2.10:1:790954:1 
REF
Length=790954

 Score = 392 bits (1008),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 233/488 (48%), Positives = 308/488 (63%), Gaps = 31/488 (6%)
 Frame = +1

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+ HGT WGLGGTCVNVGC+PKK
Sbjct  668014  SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  668193

Query  182     LMHQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQLVSNVssyiksisfkykVEL  238
               +MH S ++G  L HD A  GW       QVP     +W+ LV  V +++K ++F Y+V L
Sbjct  668194  IMHYSGILGAGL-HDAAHLGW-------QVPEKVEHNWETLVEAVQAHVKKLNFSYRVGL  668349

Query  239     RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGG--ELAVS  296
               RS +V+Y N L  F DPHTL        T+ +T  H++IA GGRP     + G  E A++
Sbjct  668350  RSNKVQYINALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAIT  668529

Query  297     SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356
               SDD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A+KI +
Sbjct  668530  SDDLFSLSTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQD  668706

Query  357     YMEMQSGIEFIRKTVPQSITKLD-SGQLLVKWI-TEDGDCFEETFDTVLNATGRDPDVAK  414
                M  Q G++F   T+P SI K + +GQL V +  +E  + F E FDTVL A GR  D   
Sbjct  668707  IMVAQ-GMDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFN  668883

Query  415     LGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDA-PELTPVAIQAGRLLSRRLYNE  473
               +GL++AGVK     G+    NE T  P+++A+GDV+   PELTPVAI+AG  L RRL+  
Sbjct  668884  IGLEKAGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKP  669060

Query  474     G-TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
                 T  M+YD I T VFTP+EYG  GLSEE++   YG D + VY   F  LEW    + + 
Sbjct  669061  NYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKA  669240

Query  533     AA-----------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQL  581
                +            +C  K+VC K+ N  VLGFH++GPNAGEVTQ   +A+ +G T +  
Sbjct  669241  ESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDF  669420

Query  582     VDTVGIHP  589
                + +GIHP
Sbjct  669421  DNVIGIHP  669444

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = +3

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               +YDLVVIG G   + C+ E+   GK V V+D           G+GG CV+ G IP K   
Sbjct  755607  EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  755762

Query  185     QSSL  188
               +S L
Sbjct  755763  ESVL  755774

>SADI:scaffold_71 supercont1.71 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.71:1:282769:1 
REF
Length=282769

 Score = 392 bits (1007),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 233/489 (48%), Positives = 310/489 (63%), Gaps = 33/489 (7%)
 Frame = +2

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               +++DYD VVIGGGSGG+A +KEAA  G KV + D+VKP+ HGT WGLGGTCVNVGC+PKK
Sbjct  165125  SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  165304

Query  182     LMHQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQLVSNVssyiksisfkykVEL  238
               +MH S ++G  L HD A  GW       Q+P     +W+ LV  V +++K ++F Y+V L
Sbjct  165305  IMHYSGILGAGL-HDAAHLGW-------QLPEKVEHNWETLVETVQAHVKKLNFSYRVGL  165460

Query  239     RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR---PRQLACLGGELAV  295
               RS +V+Y N L  F DPHTL        T+ +T  H++IA GGR   P+++  + GE A+
Sbjct  165461  RSNKVQYINALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGV-GEYAI  165637

Query  296     SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIG  355
               +SDD+F +    PGKTLVVG SY+ALECAGFL  + Y   V VRSILLRGFD+ +A+KI 
Sbjct  165638  TSDDLFSLTTA-PGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQ  165814

Query  356     EYMEMQSGIEFIRKTVPQSITKLD-SGQLLVKWI-TEDGDCFEETFDTVLNATGRDPDVA  413
               + M  Q G++F   T+P SI K D +GQL V +  +E  + F E FDTVL A GR  D  
Sbjct  165815  DIMVAQ-GMDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTF  165991

Query  414     KLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDA-PELTPVAIQAGRLLSRRLYN  472
                +GL++ GVK     G+    NE T  P+++A+GDV+   PELTPVAI+AG  L RRL+ 
Sbjct  165992  NIGLEKVGVKA-LPNGKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFK  166168

Query  473     EG-TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTR  531
                  T  M+YD I T VFTP+EYG  GLSEE++   YG D V VY   F  LEW    + +
Sbjct  166169  PNYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQK  166348

Query  532     IAA-----------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580
                 +            +C  K+VC K+ N  VLGFH++GPNAGEVTQ   +A+ +G T + 
Sbjct  166349  AESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKED  166528

Query  581     LVDTVGIHP  589
                 + +GIHP
Sbjct  166529  FDNVIGIHP  166555

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 39/76 (51%), Gaps = 9/76 (12%)
 Frame = +3

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               +YDLVVIG G   + C+ E+   GK V V+D           G+GG CV+ G IP K   
Sbjct  252786  EYDLVVIGSGPSAVQCAIESVKKGKTVAVIDK--------KAGIGGVCVHTGTIPSKTFR  252941

Query  185     QSSL-IGEILHHDCAS  199
               +S L +    H  CA+
Sbjct  252942  ESVLHLSGFRHQGCAA  252989

>PHCA:scaffold_8 PHYCAscaffold_8
Length=1194346

 Score = 220 bits (560),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 174/483 (36%), Positives = 257/483 (53%), Gaps = 23/483 (5%)
 Frame = +2

Query  112     RTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGT  171
               R  P ++  D  YDY  +VIGGGSGG+A ++ AA++G KV V   V+        GLGGT
Sbjct  676592  RIFPSIMSTDVVYDY--MVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGT  676756

Query  172     CVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksis  231
               CVN GC+PKK+M  ++   E L+ +   +  N      Q   FDW  +     +YIK ++
Sbjct  676757  CVNFGCVPKKVMFNTAAHVEHLNRN-KDYSINTADKEFQFGDFDWNNMKIKRDAYIKRLN  676933

Query  232     fkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGG  291
                 Y+  L +  V +   +   V    +++     G K  T +HV++A GG P      G 
Sbjct  676934  GIYERNLGNANVDHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGM  677098

Query  292     ELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDM  350
               E  + SD  F ++Q +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +
Sbjct  677099  ENVIDSDGFFKLEQ-QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIV  677275

Query  351     ASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRD  409
                  + E ME ++G++F+R      + K D+G+L  V  I  +   F + FDT+L A GR+
Sbjct  677276  RDLVNEEME-KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPD-FDTILYAVGRE  677449

Query  410     PDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLS  467
               P    LGL+E GVKL+E  G I V+  E T+ P VYAIGD  +   ELTPVAI AGR LS
Sbjct  677450  PRTKDLGLEEVGVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLS  677626

Query  468     RRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526
                RL+  E    ++Y +I T +F+    G  G +E ++ E+YG+++V+VY   FV L  S+
Sbjct  677627  DRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSM  677806

Query  527     AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
               A+  R    +  +  V +K     V+G H  G  A E+ Q  G+A+K+  T     + V 
Sbjct  677807  ADPERKGKTAMKLVTVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVA  677977

Query  587     IHP  589
               IHP
Sbjct  677978  IHP  677986

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 150/369 (41%), Gaps = 63/369 (17%)
 Frame = +1

Query  270     ITTRHVVIAVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGF  326
               +T    ++ VG RP  R      GE    SD + W K K  P + ++VGA  V +E A  
Sbjct  170890  LTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASM  171069

Query  327     LKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLL  384
               +  + G  V V+  R  +L   D++++  +  Y   Q+G  F+     +S+ K   G++ 
Sbjct  171070  MTIIPGTDVTVIDGRQEILNMADKEVSEALC-YSMAQTGTRFLTGETIKSVEKTAKGEVF  171246

Query  385     VKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNV  443
               V    E G       D +L   GR  +V  L L+  G++  +K GRI V NN QT  P++
Sbjct  171247  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLE-PDKRGRIKVDNNFQTAVPHM  171411

Query  444     YA----------------------IGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM---  478
               YA                       GD+I  P L   +++ GRL S  +    T+     
Sbjct  171412  YARVIVHK*VQGLTAMFLCWDSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKTLNTKEL  171591

Query  479     -------DYDKICT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVP  521
                      D D++ T           ++T  E    G +E+   +E      +V ++    
Sbjct  171592  SDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE------QVPYEVGKA  171753

Query  522     LEWSLAEQTRIAAESCYVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  580
                   LA    +     ++K++ C +T    +LG H +G  A E+     + M  G   + 
Sbjct  171754  RYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEGATEIIHIGQVVMSTGGDLEY  171927

Query  581     LVDTVGIHP  589
                 + V  +P
Sbjct  171928  FRNAVFNYP  171954

 Score = 45.1 bits (105),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 11/99 (11%)
 Frame = +2

Query  87      REDGETLDGTAPMDDTASASELNESRTPPI---VVEDDASYDYDLVVIGGGSGGLACSKE  143
               R    +L  + P+   A+ S    +   P+   + E  AS  +DL+VIG G  G  C+ +
Sbjct  170186  RRAVSSLRPSRPLLRAAAFSTEAPAENKPLTDALRELRASEHFDLIVIGSGPAGQKCAID  170365

Query  144     AASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182
               +A  GK V ++D            +GG CV+ G +P K+
Sbjct  170366  SAKSGKSVAIIDKRD--------MMGGVCVHTGTVPSKV  170458

 Score = 35.0 bits (79),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = -1

Query  102     TASASELNESRTPPI---VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
                A A  L+ ++  P+   + E  AS  +DL+VIG G  G  C+ ++A  GK V ++D
Sbjct  936808  AAFAPPLSTTQNKPLTDALHELRASEHFDLIVIGSGPAGQKCAIDSAKCGKSVSIID  936638

>PYAP:scaffold_739 pag1_scaffold_739 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_739:1:14927:1 
REF
Length=14927

 Score = 218 bits (555),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 168/468 (36%), Positives = 249/468 (53%), Gaps = 19/468 (4%)
 Frame = -2

Query  126   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
             YD VVIGGGSGG+A ++ AA++G KV +++  +   H    GLGGTCVN GC+PKK+M  
Sbjct  1642  YDYVVIGGGSGGMASARRAATYGAKVLLVE--RGRAH-DGMGLGGTCVNYGCVPKKVMFN  1472

Query  186   SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
             ++   E L  +   +  N      +   FDW  + +   +YI  ++  Y+  + +  +  
Sbjct  1471  AAAHVEHLARN-GDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGIDL  1295

Query  246   ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                + + V  + +++       K  T +HV++AVGG P   A  G E A+ SD  F + +
Sbjct  1294  VQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKL-E  1133

Query  306   KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
              +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME + G+
Sbjct  1132  SQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KHGV  956

Query  365   EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
              F+R++  + I K   G+L +    +  D   E FD VL A GR+P    LGLD+AGVKL
Sbjct  955   NFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGVKL  776

Query  425   NEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYD  481
             N+  G I V+  E T+ P VYAIGD      ELTPVAI AGR L+ RL+ NE    + Y 
Sbjct  775   ND-GGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLHYH  599

Query  482   KICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKV  541
             +I T VF+    G  G +E ++  ++G D V+VY   FV L  S+A+       +  +K+
Sbjct  598   QIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTA--MKL  425

Query  542   VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             VC    +  V+G H  G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  424   VC-VGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHP  284

>PYAR:scaffold_544 par_scaffold_544 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_544:1:16696:1 
REF
Length=16696

 Score = 217 bits (552),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 173/553 (31%), Positives = 277/553 (50%), Gaps = 85/553 (15%)
 Frame = +1

Query  103   ASASELNESRTPPIVVE----------DDASYDYDLVVIGGGSGGLACSKEAASF-GKKV  151
             A+ S+L  + T P+             +D  YDY  +VIG GSGG+A S+ AAS+   +V
Sbjct  1984  ANVSKLRAASTLPLRARGGISRLLSTANDVEYDY--LVIGAGSGGMASSRRAASYPNTRV  2157

Query  152   CVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFG----------  201
              V++  +         LGGTCVNVGC+PKK+M+ ++ +G +LH D   +G          
Sbjct  2158  AVVEQAR---------LGGTCVNVGCVPKKIMYLAANMGHLLHRDLFHYGFETKRGGGHL  2310

Query  202   -------WN---------VGSVNGQVPTF------DW-----------KQLVSN---Vss  225
                    WN         V  +NG    +      DW           + L ++   + +
Sbjct  2311  IDETQFHWNKLKERRDAYVLRLNGIYERYVPDNESDWFTS**CGMECGRNLGNSKVELLT  2490

Query  226   yiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQ  285
                + + +  VE+  K++  +NVL +       +  + +   KEI+ ++V+IAVGG+P  
Sbjct  2491  GTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQ-GNVEVDGKEISAKNVLIAVGGKPLI  2667

Query  286   LACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLR  344
                 G E  + SD  F +++  P K  VVGA Y+A+E AG L G+G    +  R   +LR
Sbjct  2668  PNIPGKEHCIDSDGFFELEEM-PKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLR  2844

Query  345   GFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLN  404
             GFD+ + S + + M+ + G++    ++   +TK   G   +  + +DG      FDTV+ 
Sbjct  2845  GFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTL--VLQDG-TEHAGFDTVIY  3012

Query  405   ATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTP--NVYAIGDVIDAPELTPVAIQA  462
             A GR P    L L+ AGV+ + + G I ++  Q TT   N++A+GDV   P LTPVAI A
Sbjct  3013  AAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPALTPVAIAA  3189

Query  463   GRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVP  521
             GR LS RL+      +M Y+ I T VF+    G  GL+E++++ ++GDD+V+VY   FV 
Sbjct  3190  GRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVYSSRFVN  3369

Query  522   LEWSLAEQ-----TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGF  576
             + + +  +      +       +K+VC   +   V+G H +G  A E+ Q  G+A+K+G 
Sbjct  3370  MHYGIVNEFGNDGQQKPKPMTAMKLVC-VGKEEKVVGVHLIGMAADEILQGFGVAVKMGA  3546

Query  577   TYDQLVDTVGIHP  589
             T       V IHP
Sbjct  3547  TKADFDSCVAIHP  3585

>PHIF:NW_003303727.1 Phytophthora infestans T30-4 supercont1.32 
genomic scaffold, whole genome shotgun sequence
Length=1926061

 Score = 214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 258/481 (54%), Gaps = 23/481 (5%)
 Frame = +2

Query  114     PPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCV  173
               PP+ +  D  YDY  +VIGGGSGG+A ++ AA++G KV V   V+        GLGGTCV
Sbjct  581966  PPLRMSTDVVYDY--MVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCV  582130

Query  174     NVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfk  233
               N GC+PKK+M  ++   E L+ +   +  N  S + +   FDW  + +   +YIK ++  
Sbjct  582131  NFGCVPKKVMFNAAAHVEHLNRN-KDYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGI  582307

Query  234     ykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGEL  293
               Y+  L + +V +   +   V    +++       +  T +HV++A GG P      G E 
Sbjct  582308  YERNLGNAKVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEH  582472

Query  294     AVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMAS  352
                + SD  F ++Q +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +  
Sbjct  582473  VIDSDGFFKLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRD  582649

Query  353     KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET-FDTVLNATGRDPD  411
                + E ME ++G+ F+R +    + K D+G+ L   +T DG+  + T FD+++ A GR P 
Sbjct  582650  LVNEEME-KAGVNFVRNSRAVRVEKQDNGK-LTYVVTVDGEEQKFTDFDSIVYAIGRSPR  582823

Query  412     VAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRR  469
                  LGL+E GVKL E  G I V+  E T+   VYAIGD  +   ELTPVAI AGR LS R
Sbjct  582824  TKDLGLEEVGVKLAE-GGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDR  583000

Query  470     LY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE  528
               L+  E    ++Y +I T +F+    G  G +E ++  +YG+++V+VY   FV L  S+A+
Sbjct  583001  LFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMAD  583180

Query  529     QTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
                 R    +  +  V DK     V+G H  G  A E+ Q  G+A+K+  T     + V IH
Sbjct  583181  PERKGKTAMKLVTVGDKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIH  583351

Query  589     P  589
               P
Sbjct  583352  P  583354

>SADI:scaffold_9 supercont1.9 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.9:1:1129835:1 
REF
Length=1129835

 Score = 213 bits (542),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 162/483 (34%), Positives = 246/483 (51%), Gaps = 33/483 (7%)
 Frame = +1

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD +VIGGGSGG + ++ AA++G KV V++    +      G+GGTCVNVGC+PKK+M  
Sbjct  433954  YDYIVIGGGSGGNSSARRAAAYGAKVLVIERGHAN---DGAGMGGTCVNVGCVPKKVMFN  434124

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               +++  E+LH   A    N+  V  +  +FDW  L     +Y+  ++  Y+  L + ++  
Sbjct  434125  AAMHAEMLHSAHAYTFKNIQDV--EYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPL  434298

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                     FVD HT+++          T +H++IAVGG P      G E A+SSD  F + +
Sbjct  434299  IYGAAKFVDNHTIEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL-E  434460

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEM----  360
                +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME     
Sbjct  434461  TQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEQYDIL  434640

Query  361     ------------QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGR  408
                            +G+ F+R++   SI K + G L ++            F+TVL A GR
Sbjct  434641  IDIATCS***MDSAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGR  434820

Query  409     DPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLS  467
                P    LGL+   + L+          E TT PNV+A+GDV     ELTPVAI AGR L+
Sbjct  434821  TPRTHDLGLETTDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLA  435000

Query  468     RRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526
                RL+ NE    ++Y +I T VF+    G  GL+E  + E+YG  +V+VY   F  + +++
Sbjct  435001  DRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAM  435180

Query  527     AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586
               +EQ     +   +K++C       V+G H  G  A E+ Q  G+A+K+G       + V 
Sbjct  435181  SEQDE--KQKTAMKLMCIGEEET-VIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVA  435351

Query  587     IHP  589
               IHP
Sbjct  435352  IHP  435360

 Score = 211 bits (538),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 160/488 (33%), Positives = 247/488 (51%), Gaps = 37/488 (8%)
 Frame = -1

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               A+YDY  +V+G GSGG++ +  A ++G KV V++  + +      GLGGTCVNVGC+PKK
Sbjct  433211  ATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKK  433047

Query  182     LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               +M  ++L  E+L H   ++ +  G  + Q   FDW  + +   +Y+K ++  Y   +   
Sbjct  433046  IMFNAALHAEML-HSARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLED  432873

Query  242     QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIF  301
               +V        FVD HT+++   +   K     H++IAVGG P      G E A+SSD  F
Sbjct  432872  KVDLVMGAAKFVDNHTVEVNGDRYAAK-----HILIAVGGVPAMPPLPGIEHAISSDGFF  432708

Query  302     WMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEM  360
                + + +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME 
Sbjct  432707  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEMEQ  432531

Query  361     ----------------QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLN  404
                                +G+ F+R++   SI K + G L ++            F+TVL 
Sbjct  432530  YDLLLDIATCS***MDSAGVRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLF  432351

Query  405     ATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAG  463
               A GR P    LGL+   + L+          E TT PNV+A+GDV     ELTPVAI AG
Sbjct  432350  AIGRTPRTHDLGLETTDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAG  432171

Query  464     RLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPL  522
               R L+ RL+ NE    ++Y +I T VF+    G  GL+E  +  +YG  +V  +  +F  +
Sbjct  432170  RRLADRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNM  431991

Query  523     EWSL-AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQL  581
                +++ AE+ ++      +K+VC       V+G H  G  A E+ Q  G+A+K+G      
Sbjct  431990  FYAMSAEKDKV---QTAMKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDF  431823

Query  582     VDTVGIHP  589
                + V IHP
Sbjct  431822  DNIVAIHP  431799

>PYAP:scaffold_510 pag1_scaffold_510 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_510:1:23801:1 
REF
Length=23801

 Score = 211 bits (538),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 159/494 (32%), Positives = 244/494 (49%), Gaps = 46/494 (9%)
 Frame = -1

Query  126   YDLVVIGGGSGGLACSKEAASFGK-KVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
             YD +VIG GSGG+A S+ AA++   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  4085  YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  3933

Query  185   QSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQLVS---------NVssyiksisfk  233
              ++ +G  LH D   +G+    G        F WK+L           N           
Sbjct  3932  LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGR*DSMRM  3753

Query  234   ykVELRSK----QVKYENVLGSFVDPHTLKLWHPKKGT-----KEITTRHVVIAVGGRPR  284
               ++ R           N+  S VD          KG      KEI  ++V+IAVGG+P 
Sbjct  3752  DMIDTRKA*WPCSFVCSNLDNSKVDLFRGTATFNAKGNVEVDGKEIAAKNVLIAVGGKPL  3573

Query  285   QLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LL  343
                  G E  + SD  F +++ +P K  VVGA Y+A+E AG L G+G    +  R   +L
Sbjct  3572  IPDIPGKEHCIDSDGFFELEE-QPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVL  3396

Query  344   RGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVL  403
             RGFD+ + + + + M  +        +V + I   D  + LV     DG      FD+V+
Sbjct  3395  RGFDELIRTTLHDAMAKEGVNLRPHSSVTKVIKAADGTKTLV---LADG-SEHSGFDSVI  3228

Query  404   NATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTP--NVYAIGDVIDAPELTPVAIQ  461
              A GR P    L L+ AG++ ++  G I ++  Q TT   N++A+GDV   P LTPVAI 
Sbjct  3227  YAAGRVPLTESLNLEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIA  3051

Query  462   AGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
             AGR L+ RL+      +  Y+ I T VF+    G  GL+E+ ++ ++GDD ++VY   FV
Sbjct  3050  AGRRLADRLFGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFV  2871

Query  521   PLEWSLAEQ-----TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLG  575
              + + +  +      +       +K+VC + ++  V+G H +G  A E+ Q  G+A+K+G
Sbjct  2870  NMHYGIINEFGEDGQQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKMG  2694

Query  576   FTYDQLVDTVGIHP  589
              T       V IHP
Sbjct  2693  ATKADFDSCVAIHP  2652

>PHPA:scaffold_21 NW_008649007.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.21, whole genome shotgun 
sequence
Length=1058518

 Score = 209 bits (533),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 166/478 (35%), Positives = 258/478 (54%), Gaps = 23/478 (5%)
 Frame = -1

Query  117     VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
               ++  D  YDY  +VIGGGSGG+A ++ AA+FG KV V   V+        GLGGTCVN G
Sbjct  277948  IMSTDVVYDY--MVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFG  277784

Query  177     CIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykV  236
               C+PKK+M  ++   E L+ +   +  N  S + +   FDW  + +   +YIK ++  Y+ 
Sbjct  277783  CVPKKVMFNTAAHVEHLNRN-KDYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYER  277607

Query  237     ELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVS  296
                L + +V +   +   V    +++       +  T +HV++A GG P      G E  + 
Sbjct  277606  NLGNAKVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVID  277442

Query  297     SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIG  355
               SD  F ++Q +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + 
Sbjct  277441  SDGFFKLEQ-QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVN  277265

Query  356     EYMEMQSGIEFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
               E ME ++G++F+R +    + K ++G+L  V  +  +   F + FDT++ A GR+P    
Sbjct  277264  EEME-KAGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFAD-FDTIVFAIGREPRTKD  277091

Query  415     LGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-  471
               LGL+E GVKL+E  G I V+  E T+ P VYAIGD  +   ELTPVAI AGR LS RL+ 
Sbjct  277090  LGLEEIGVKLSE-GGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFG  276914

Query  472     NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTR  531
                E    ++Y +I T +F+    G  G +E ++  +YG+++++VY   FV L  S+A+  R
Sbjct  276913  GEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPER  276734

Query  532     IAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                   +  +  V +K     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  276733  KGKTAMKLVTVGEKET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  276569

>PHSO:scaffold_13
Length=2041583

 Score = 208 bits (530),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 171/498 (34%), Positives = 260/498 (52%), Gaps = 30/498 (6%)
 Frame = +1

Query  104     SASELNESRTPPIV-------VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDY  156
                A + +  +TPP +       +  D  YDY  VVIGGGSGG+A ++ AA++G KV V++ 
Sbjct  697564  KAPKSSARKTPPPLFHSTLYRMSTDVVYDY--VVIGGGSGGMASARRAATYGAKVLVVER  697737

Query  157     VKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDW  216
                +        GLGGTCVN GC+PKK+M  ++   E L  +   +  N  + + +   FDW
Sbjct  697738  GR---EFEGMGLGGTCVNFGCVPKKVMFNAAAHVEHLARN-KDYSINTAAKDFEFGDFDW  697905

Query  217     KQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVV  276
                 + +   +YIK ++  Y+  L + QV +   +   V    +++       K  T +HV+
Sbjct  697906  ANMKTKRDAYIKRLNGIYERNLGNAQVDHVQGIAKLVAKDKVEV-----AGKVFTGKHVL  698070

Query  277     IAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKV  336
               +A GG P      G E  + SD  F ++Q +P K  VVGA Y+A+E AG    +     +
Sbjct  698071  VAPGGVPSVPDLPGMEHVIDSDGFFKLEQ-QPKKVAVVGAGYIAVEMAGIFNVLKSDTTL  698247

Query  337     MVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQL-LVKWITEDGDC  394
                 R   +LR FD  +   + E ME ++G++F+R      + K   G+L  V  I  +   
Sbjct  698248  FCRFDQVLRKFDPIVRDLVNEEME-KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHK  698424

Query  395     FEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV-IDA  452
               F + FD +L A GR+P    LGL+E GVKL+E  G I V+  E T+ P VYAIGD  I  
Sbjct  698425  FPD-FDAILYAVGREPRTKDLGLEEVGVKLSE-GGFIEVDAQENTSVPGVYAIGDATITG  698598

Query  453     PELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDS  511
                ELTPVAI AGR LS RL+  E    ++Y +I T +F+    G  G +E ++  +YG+++
Sbjct  698599  WELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEEN  698778

Query  512     VEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLA  571
               V+ Y   FV L  S+A+  R    +  +  V ++     V+G H  G  A E+ Q  G+A
Sbjct  698779  VKCYTSKFVNLLHSMADPERKGKTAMKLVTVGEQET---VVGVHVAGEGADEMIQGFGVA  698949

Query  572     MKLGFTYDQLVDTVGIHP  589
               +K+  T     + V IHP
Sbjct  698950  VKMNATKADFDNIVAIHP  699003

>PHRA:scaffold_75
Length=257998

 Score = 203 bits (516),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 162/469 (35%), Positives = 247/469 (53%), Gaps = 21/469 (4%)
 Frame = +1

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD VVIGGGSGG+A ++ AA++G KV V   V+        GLGGTCVN GC+PKK+M  
Sbjct  120367  YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  120537

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               ++   E LH +   +     + +     FDW  +     +YI  ++  Y+  L + +V +
Sbjct  120538  AAAHVEHLHRN-EDYSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDH  120714

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                  + + V    +++       K  T +HV++A GG P      G E    SD  F ++Q
Sbjct  120715  VQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFFRLEQ  120879

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
                +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + + ME ++G+
Sbjct  120880  -QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGV  121053

Query  365     EFIRKTVPQSITKLDSGQLLVKWITEDGDCFE-ETFDTVLNATGRDPDVAKLGLDEAGVK  423
               +F+R T    + K D G+L    +T DG+  +   FD +L A GR+P    LGL++ GVK
Sbjct  121054  KFVRNTRAVRVDKQDDGKLTF-VVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVK  121230

Query  424     LNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
               L +  G I V+  E T+ P VYAIGD      ELTPVAI AGR LS RL+  E    ++Y
Sbjct  121231  LADG-GFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNY  121407

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
                +I T +F+    G  G +E ++  ++G+++V+VY   FV L  S+A+  R    +  + 
Sbjct  121408  HQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLV  121587

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  121588  TVGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  121725

>HYAP:scaffold_87 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_87:1:280800:1 
REF
Length=280800

 Score = 202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 158/469 (34%), Positives = 251/469 (54%), Gaps = 23/469 (5%)
 Frame = -1

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD +VIGGGSGG+A ++ AA++G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  122613  YDYIVIGGGSGGMASARRAATYGAKVLVIERGRQY---DGMGLGGTCVNFGCVPKKIMFN  122443

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               ++    + H + A   +++ +       FDW ++ +   +YI  ++  Y+  L + +V +
Sbjct  122442  TA--AHVEHLNRAK-DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDH  122272

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                  +  FV  + +++       +  T +HV+IA GG P +    G    + SDD F ++Q
Sbjct  122271  VEGIAKFVAKNKVQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQ  122107

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
                +P K  VVGA Y+A+E AG    +     +  R   +LR F+  +   + E ME ++G+
Sbjct  122106  -QPQKVAVVGAGYIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGV  121933

Query  365     EFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVK  423
                F+R      + K   G+L LV  +  +   F + FDT+L A GR P    LGL++ GVK
Sbjct  121932  TFVRNMSAVGVEKQLDGKLTLVVNVHNEEQKFTD-FDTILFAVGRKPRTEDLGLEDIGVK  121756

Query  424     LNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRLY-NEGTVQMDY  480
               L E  G I V+  E T+ P VYAIGD  +   ELTPVAI AGR L+ RL+  E    ++Y
Sbjct  121755  LAE-GGFIQVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNY  121579

Query  481     DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540
                +I + +F+    G  G +E ++  +YG+++V+VY   FV L  S+A+       +  + 
Sbjct  121578  HQIPSVIFSHPPIGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLV  121399

Query  541     VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  121398  TVGEQET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  121261

>PLHA:NW_020187271.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_350, whole genome shotgun sequence
Length=864042

 Score = 202 bits (514),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 252/480 (53%), Gaps = 21/480 (4%)
 Frame = +3

Query  115     PIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVN  174
               P+ V+      YD +VIGGGSGG+A ++ AA+ G KV V   V+        GLGGTCVN
Sbjct  415278  PLPVDMSTDMVYDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVN  415448

Query  175     VGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfky  234
                GC+PKK+M  +++  E L+ +   +  N  + + +   FDW  + +   +YI+ ++  Y
Sbjct  415449  FGCVPKKVMFNTAVHVEHLNRN-KDYSINTCAKDFEFGDFDWANMKTKRDAYIQRLNGIY  415625

Query  235     kVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELA  294
               +  L + QV     +   V    +++          T +HV++A GG P      G E  
Sbjct  415626  ERNLSNAQVDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHV  415790

Query  295     VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASK  353
               + SD  F ++Q +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   
Sbjct  415791  IDSDGFFKLEQ-QPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDL  415967

Query  354     IGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET-FDTVLNATGRDPDV  412
               + E ME ++G+EF+R      I K +  +L    +T +G+  E T FDT+L A GR P  
Sbjct  415968  VNEEME-KAGVEFVRNMSATRIEKSNDDKLTF-VVTMNGEEQEFTNFDTILFAVGRVPRT  416141

Query  413     AKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDV-IDAPELTPVAIQAGRLLSRRL  470
                 LGL+E GVKL +  G I V+  E TT P VYAIGDV +   ELTPVAI AGR L+ RL
Sbjct  416142  KDLGLEEIGVKLAD-GGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRL  416318

Query  471     Y-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
               +  E    ++Y +I T +F+    G  G +E ++   +G +++++Y   FV L  ++A+ 
Sbjct  416319  FGGEKDACLNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADP  416498

Query  530     TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                R    +  +  V ++     V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  416499  ERKGKTAMKLVTVGEEET---VVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHP  416669

>SADI:scaffold_83 supercont1.83 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.83:1:225395:1 
REF
Length=225395

 Score = 116 bits (290),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/231 (35%), Positives = 121/231 (52%), Gaps = 7/231 (3%)
 Frame = -2

Query  362     SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAG  421
               +G++F+R++   +I K   G L ++            F+TVL A GR P    LGL+   
Sbjct  128116  AGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTD  127937

Query  422     VKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMD  479
               + L+ +        E TT PNVYAIGDV     ELTPVAI AGR L+ RL+ NE    ++
Sbjct  127936  IALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVN  127757

Query  480     YDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESCY  538
               Y +I T VF+    G  GL+E  + E+YG  +V  +  +F  + +++ AE+ ++      
Sbjct  127756  YSQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKV---QTA  127586

Query  539     VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  127585  MKLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  127436

 Score = 115 bits (289),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 121/235 (51%), Gaps = 12/235 (5%)
 Frame = -3

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD +V+G GSGG++ +  A ++G KV V   V+        GLGGTCVNVGC+PKK+M  
Sbjct  128850  YDYIVLGAGSGGVSTAHRAVAYGAKVLV---VERGRENDGAGLGGTCVNVGCVPKKIMFN  128680

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               ++L  E+LH   A     V  +  Q   FDW  + +   +Y+  ++  Y   +   +V  
Sbjct  128679  AALHAEMLHSARAYAFKGVSDI--QYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  128506

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                     FVD HT+++       +  T +H++IAVGG P      G E A+SSD  F + +
Sbjct  128505  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  128344

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYME  359
                +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME
Sbjct  128343  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME  128179

>SADI:scaffold_39 supercont1.39 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.39:1:589803:1 
REF
Length=589803

 Score = 115 bits (289),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 121/235 (51%), Gaps = 12/235 (5%)
 Frame = -3

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD +V+G GSGG++ +  A ++G KV V   V+        GLGGTCVNVGC+PKK+M  
Sbjct  364156  YDYIVLGAGSGGVSTAHRAVAYGAKVLV---VERGRENDGAGLGGTCVNVGCVPKKIMFN  363986

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               ++L  E+LH   A     V  +  Q   FDW  + +   +Y+  ++  Y   +   +V  
Sbjct  363985  AALHAEMLHSARAYAFKGVSDI--QYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDL  363812

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                     FVD HT+++       +  T +H++IAVGG P      G E A+SSD  F + +
Sbjct  363811  VMGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFAL-E  363650

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYME  359
                +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   +   ME
Sbjct  363649  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME  363485

 Score = 114 bits (286),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/231 (34%), Positives = 120/231 (52%), Gaps = 7/231 (3%)
 Frame = -2

Query  362     SGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAG  421
               +G++F+R++   +I K   G L ++            F+TVL A GR P    LGL+   
Sbjct  363422  AGVQFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTD  363243

Query  422     VKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMD  479
               + L+ +        E TT PNVYAIGDV     ELTPVAI AGR L+ RL+ NE    ++
Sbjct  363242  IALSTEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVN  363063

Query  480     YDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESCY  538
               Y +I T VF+    G  GL+E  +  +YG  +V  +  +F  + +++ AE+ ++      
Sbjct  363062  YSQIPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKV---QTA  362892

Query  539     VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  362891  MKLVCIGVEEA-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  362742

>PYUU:scaffold_2035 scf1117875582035 dna:supercontig supercontig:pug:scf1117875582035:1:696189:1 
REF
Length=696189

 Score = 196 bits (498),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 226/451 (50%), Gaps = 17/451 (4%)
 Frame = +1

Query  142     KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFG  201
               + AA++G KV V++  +        GLGGTCVN GC+PKK+M  ++   E LH + A + 
Sbjct  427384  RRAATYGAKVLVVERGRKY---DGAGLGGTCVNYGCVPKKVMFNAASHVEHLHRN-ADYS  427551

Query  202     WNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLW  261
                   +   +   FDWK + +   +YI  ++  Y+  L + Q+     +   V    +++ 
Sbjct  427552  ITTTTKPFEFGDFDWKNMKTKRDAYIARLNGIYERNLGNAQIDLVEGVAKLVAKDKVEV-  427728

Query  262     HPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVAL  321
                        T +H+++AVGG P      G E  + SDD F +++ +P K  VVGA Y+A+
Sbjct  427729  ----DGVVYTGKHILVAVGGVPSLPPIPGIEHVIDSDDFFKLEE-QPKKVAVVGAGYIAI  427893

Query  322     ECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDS  380
               E AG    +     +  R   +LR FD  +   I E  E ++GI F+R +  + I K   
Sbjct  427894  EIAGIFNALKSDTSLFCRFDHVLRTFDPIVRDLINEEGE-KAGINFVRNSRIERIDKQAD  428070

Query  381     GQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTT  440
               G L +       +     F+ +L A GR+P    LGL+E GVKLNEK   +    E T+ 
Sbjct  428071  GTLQITAKVNGEEQVIGGFNQILYAIGREPRTKDLGLEEVGVKLNEKGFIVVDAQENTSV  428250

Query  441     PNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGL  498
                 +YAIGD      ELTPVAI AGR LS RL+  E    + Y +I T VF+    G  G 
Sbjct  428251  SGIYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEPNACLHYHQIPTVVFSHPPLGTIGY  428430

Query  499     SEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLG  558
               +E ++ E++G ++V+ Y   FV L +++A+       +  +  V +   +  V+G H  G
Sbjct  428431  TEPEAIEKFGAENVKTYSSKFVNLLYAMADPDHKGKTAMKLVTVGE---DEVVVGIHVAG  428601

Query  559     PNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 A E+ Q  G+A+K+  T     + V IHP
Sbjct  428602  EGADEMIQGFGVAVKMNATKADFDNIVAIHP  428694

>PHKE:scaffold_694 scf_22126_694.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_694.1:1:11588:1 
REF
Length=11588

 Score = 193 bits (490),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 160/471 (34%), Positives = 247/471 (52%), Gaps = 25/471 (5%)
 Frame = -3

Query  126   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
             YD VVIGGGSGG+A ++ AA++G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  6105  YDYVVIGGGSGGMASARRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFN  5935

Query  186   SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
             +++  E L  +   +  N    + Q   FDW  + +   +YI  ++  Y+  L+++QV +
Sbjct  5934  TAMHVEHLARN-RDYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  5758

Query  246   ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                +   V    +++       +  T +++++A GG P      G E  + SD  F ++Q
Sbjct  5757  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  5593

Query  306   KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
              +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   + E ME ++G+
Sbjct  5592  -QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  5419

Query  365   EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET---FDTVLNATGRDPDVAKLGLDEAG  421
             +F+R +    + K   G+L    +T DG   EE    FDT+L A GR P    LGL+E  
Sbjct  5418  KFVRNSRAVRVEKQTDGKLTF-VVTVDGK--EEKFPDFDTILYAVGRTPRTKDLGLEEIN  5248

Query  422   VKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQM  478
             VKL++  G I V+  E T+   VYAIGD      ELTPVAI AGR LS RL+  E    +
Sbjct  5247  VKLSQD-GFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  5071

Query  479   DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538
             +Y +I T +F+    G CG +E ++ E++G ++++ Y   FV L  S+A+  R    +  
Sbjct  5070  NYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMK  4891

Query  539   VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             +  V ++     V      G  A E+ Q  G+AMK+  T     + V IHP
Sbjct  4890  LVCVGEEEVVVGVH---VAGEGADEMIQGFGVAMKMNATKADFDNIVAIHP  4747

>SAPA:scaffold_17 supercont2.17 dna:supercontig supercontig:ASM15154v2:supercont2.17:1:533194:1 
REF
Length=533194

 Score = 114 bits (284),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/239 (34%), Positives = 123/239 (51%), Gaps = 23/239 (10%)
 Frame = +2

Query  362     SGIEFIRKTVPQSITKL------DSGQLLVKWITEDGDCFEETF---DTVLNATGRDPDV  412
               +G+ F+R++   SI K       DSG         DG    ++F   +TVL A GR P  
Sbjct  379985  AGVHFVRESGITSIEKAVDGYADDSG---------DGGGVPQSFPGFETVLFAIGRTPRT  380137

Query  413     AKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY  471
                 LGL+   + L+          E T+ PNVYA+GDV     ELTPVAI AGR L+ RL+
Sbjct  380138  HDLGLETTDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLF  380317

Query  472     -NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
                NE    ++Y +I T VF+    G  GL+E  +  +YG ++V+VY  +F  + ++++EQ 
Sbjct  380318  GNEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQD  380497

Query  531     RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                   +   +K++C       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  380498  D--KQKTAMKLICIGEEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  380665

 Score = 108 bits (271),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/248 (35%), Positives = 131/248 (53%), Gaps = 14/248 (6%)
 Frame = +3

Query  114     PPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGT-SWGLGGTC  172
               P I +   A+  YD +VIGGGSGG + ++ AA++G KV +++      H     G+GGTC
Sbjct  379221  PQIAICTMATTVYDYIVIGGGSGGNSSARRAAAYGAKVLLIE----RGHANDGAGMGGTC  379388

Query  173     VNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisf  232
               VNVGC+PKK+M  ++L  E+LH   A    N+  V  +  +FDW  L     +Y+  ++ 
Sbjct  379389  VNVGCVPKKIMFNAALHAEMLHSAHAYTFKNIQDV--EYGSFDWAALKKKRDAYVARLNG  379562

Query  233     kykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGE  292
                Y+  L + Q+        FVD HT+++          T +H++IAVGG P      G E
Sbjct  379563  IYERNLGNNQIPLVYGAAKFVDNHTVEV-----NGDRYTAKHILIAVGGVPAMPPLPGIE  379727

Query  293     LAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMA  351
                A+SSD  F + + +P K  VVGA Y+A+E AG    +     +  R + +LR FD  + 
Sbjct  379728  HAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVR  379904

Query  352     SKIGEYME  359
                 +   ME
Sbjct  379905  DLVNTEME  379928

 Score = 111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 127/239 (53%), Gaps = 14/239 (6%)
 Frame = -2

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               A+YDY  +V+G GSGG++ +  A ++G KV V++    +      GLGGTCVNVGC+PKK
Sbjct  378531  ATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGHAN---DGAGLGGTCVNVGCVPKK  378367

Query  182     LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               +M  ++L  E+L H   ++ +  G  + Q   FDW  + +   +Y+K ++  Y   +   
Sbjct  378366  IMFNAALHAEML-HSARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLED  378193

Query  242     QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIF  301
               +V        FVD HT+++          T +H++IAVGG P      G E A+SSD  F
Sbjct  378192  KVDLVMGAAKFVDNHTVEV-----NGDRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  378028

Query  302     WMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYME  359
                + + +P K  VVGA Y+A+E AG    +     +  R + +LR FD  +   +   ME
Sbjct  378027  AL-ETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEME  377854

>PYIR:scaffold_236 pir_scaffold_236 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_236:1:38383:1 
REF
Length=38383

 Score = 122 bits (305),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/255 (36%), Positives = 132/255 (52%), Gaps = 20/255 (8%)
 Frame = -3

Query  342    LLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDT  401
              L+R    D  +K G  +  QS +  I KT       LD  + LV     DG      FDT
Sbjct  35285  LVRDTLHDAMAKDGIVVRPQSNVARIEKT-------LDGKKTLV---LADG-SEHAGFDT  35139

Query  402    VLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPN-VYAIGDVIDAPELTPVAI  460
              V+ A GR P  + L +  AG++  +K G I V+  QTT+ N V+A+GDV     LTPVAI
Sbjct  35138  VIYAAGRIPLTSNLNISAAGIE-TDKHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAI  34962

Query  461    QAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNF  519
               AGR LS RL+      ++ Y+ I T VF+    G  GL+E++++E+YGD  ++ Y   F
Sbjct  34961  AAGRRLSDRLFGGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRF  34782

Query  520    VPLEWSL-----AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKL  574
              V + + L     AE          +K+VC   ++  V+G H +G  A E+ Q  G+A+K+
Sbjct  34781  VNMYYGLVNELDAEGNTKPKPMTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKM  34605

Query  575    GFTYDQLVDTVGIHP  589
              G T     + V IHP
Sbjct  34604  GATKADFDNCVAIHP  34560

 Score = 99.4 bits (246),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 125/254 (49%), Gaps = 38/254 (15%)
 Frame = -2

Query  120    DDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
               DA YDY  +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+
Sbjct  36105  SDAPYDY--LVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCV  35959

Query  179    PKKLMHQSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQL-------VSNVssyiks  229
              PKK+M+ ++ +   LH D   +G+    GS  G    F W +L       +  ++   + 
Sbjct  35958  PKKIMYLAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYER  35779

Query  230    isfkykVELR-----SKQ-----VKYENVLGSFVDPHTLKLWHPKKGTKE-----ITTRH  274
               +    + +R     + Q     V   N+  S VD          +G  E     I+ R+
Sbjct  35778  YACASAI*IRYTCAAANQYVWCCVMDRNLGNSKVDLIQGTAAFNAQGEVEVDGKVISARN  35599

Query  275    VVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAV  334
              V+IAVGG+P      G E  + SD  F + ++ P K  VVGA Y+A+E AG L G+G   
Sbjct  35598  VLIAVGGKPLIPDIPGKEHCIDSDGFFEL-EELPNKVAVVGAGYIAVELAGVLHGLGSDT  35422

Query  335    KVMVRSI-LLRGFD  347
               +  R   +LR FD
Sbjct  35421  TIFCRKDGVLRTFD  35380

>PYAR:scaffold_583 par_scaffold_583 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_583:1:16086:1 
REF
Length=16086

 Score = 189 bits (481),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 157/472 (33%), Positives = 235/472 (50%), Gaps = 22/472 (5%)
 Frame = -2

Query  126   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
             YD +VIGGGSGG+A ++ AA  G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  1514  YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  1344

Query  186   SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
             ++   E L  + A +    G+   Q   FDW  + +   +YI  ++  Y+  + + ++  
Sbjct  1343  AASHVEHLARN-ADYSIRSGA-EFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDL  1170

Query  246   ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                + S      + +      T     +H+++AVGG P      G E A+ SDD F +K 
Sbjct  1169  IEGIASLTAKDAVTV---DGKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLKT  999

Query  306   KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGI  364
              +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   +   M+ + G+
Sbjct  998   -QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHGV  825

Query  365   EFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKL  424
              F+R++   +I K   G+L V+   +  D     FD VL A GR+P    LGL+  GVKL
Sbjct  824   HFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKL  645

Query  425   NEKTGRIWVNN-EQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLS-----RRLYNEGTVQ  477
             ++  G I V+  E T+   VYAIGD      ELTPVAI AGR LS               
Sbjct  644   SD-AGFIEVDKFENTSVDGVYAIGDATTTGYELTPVAIAAGRRLSXXXXXXXXXXXXXXX  468

Query  478   MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC  537
                  I T VF+    G  G +E ++ E++G D V+VY   FV L +++A+         
Sbjct  467   XXXXXIPTVVFSHPPIGTIGYTEPEAVEKFGADHVKVYTSTFVNLLYAMADPDH--KSKT  294

Query  538   YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              +K+VC    N  V+G H  G  A E+ Q  G+A+K+  T     + V IHP
Sbjct  293   AMKLVC-VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHP  141

>ALCA:scaffold_523 AcNc2_CONTIG_523_length_15388 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_523_length_15388:1:15388:1 
REF
Length=15388

 Score = 187 bits (475),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 155/501 (31%), Positives = 242/501 (48%), Gaps = 72/501 (14%)
 Frame = +1

Query  142    KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSL------------I  189
              + AA++G KV +++  +        G GGTCVN GC+PKK+M+ ++             I
Sbjct  12154  RRAATYGAKVLLIERHREY---DGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  12324

Query  190    GEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVL  249
                    +CAS  ++ G        FDW ++ +   +YI+ ++  Y   L + ++     +
Sbjct  12325  RPFTSKECASHSFSFGD-------FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGI  12483

Query  250    GSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPG  309
                 +    +++            +H++IAVGG P   +  G E A+ SD  F + + +P 
Sbjct  12484  AKLIAKDRVQVNQDSV----YEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKL-ETQPK  12648

Query  310    KTLVVGASYVALECAG-FLKGMGYAVKVM-----------------VRSILLRGFDQD--  349
              K  VVGA Y+A+E AG F   + Y  K M                 + S  L  F ++  
Sbjct  12649  KVAVVGAGYIAVEIAGLFAILILYTTKQMTMKCCL*ASLTRSSRTPLYSAALIKF*ENSI  12828

Query  350    -------MASKIGEYME----------MQSGIEFIRKTVPQSITKLDSGQL-LVKWITED  391
                     M      Y +          ++ G+ F+RK+  + ITK    +L +   I E+
Sbjct  12829  HW*GIWSMKRWKSAYFQSLHRSLLTTFLRDGVNFVRKSHLEKITKAKDDKLAITARIGEE  13008

Query  392    GDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVI  450
                 F + FD ++ A GR P    LGL+E GV LNE TG I V+  E T+ P VYA+GDV 
Sbjct  13009  NQTFSD-FDQIVMAVGRSPRTVGLGLEEVGVALNE-TGHIIVDAQENTSVPGVYALGDVT  13182

Query  451    DAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYG  508
                  ELTPVAI AGR L+ RL+ NE    + Y +I T VF+    G  G +E ++  +YG
Sbjct  13183  TTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPPLGTIGYTEPEAIAKYG  13362

Query  509    DDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
              +++V+ Y   FV L +S+AE      ++  +K+VC  ++   V+G H  G  A E+ Q  
Sbjct  13363  EENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCVGSKET-VVGLHVAGDGADEMVQGF  13536

Query  569    GLAMKLGFTYDQLVDTVGIHP  589
              G+AMK+G T     + V IHP
Sbjct  13537  GVAMKMGATKADFDNIVAIHP  13599

>APIN:scaffold_70 supercont1.70 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.70:1:209556:1 
REF
Length=209556

 Score = 144 bits (362),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/366 (34%), Positives = 190/366 (52%), Gaps = 31/366 (8%)
 Frame = -3

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YD +V+GGGSGG++ +  A  +G KV V++  + +      G+GGTCVNVGC+PKK+M+ 
Sbjct  140992  YDYIVVGGGSGGVSSASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKKIMYN  140822

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               + +  EIL H    + +    VN +  +FDW  + +   +Y+  +S  Y+  L  + + +
Sbjct  140821  AGVHAEIL-HSAKDYSFK-DVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDH  140648

Query  246     ENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQ  305
                     FVD HT+++       +  T  H++IAVGG P+     G E AVSSD  F +  
Sbjct  140647  VIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDLP-  140486

Query  306     KEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYME-----  359
                +P K  VVGA Y+A+E AG    +     V  R + +LR FD  +   + + M      
Sbjct  140485  TQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEMAK*VS*  140306

Query  360     ---------MQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEE--TFDTVLNATGR  408
                         ++G+ F+     +SI K   G L V  + + G+   E   FD +++A GR
Sbjct  140305  PVQ*RS*RVARAGVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGR  140132

Query  409     DPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLS  467
                P    +GLD+  V+L++    +    E TT   VYAIGDV     ELTPVAI AGR L+
Sbjct  140131  IPRTQDVGLDKTHVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLA  139952

Query  468     RRLYNE  473
                RL+ +
Sbjct  139951  DRLFGK  139934

 Score = 63.9 bits (154),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 2/121 (2%)
 Frame = -1

Query  469     RLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE  528
               R Y+     + Y +I T VF+    G  GL+E D+  +YG D+V VY   F  + ++LA 
Sbjct  139893  RRYH*TNACIHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALAT  139714

Query  529     QTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
                +    ++  +K+VC       V+G H  G  A E+ Q  G+A+KLG       + V IH
Sbjct  139713  HSAHKPQTA-MKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIH  139540

Query  589     P  589
               P
Sbjct  139539  P  139537

>PYIR:scaffold_1258 pir_scaffold_1258 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_1258:1:8745:1 
REF
Length=8745

 Score = 178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 140/450 (31%), Positives = 216/450 (48%), Gaps = 15/450 (3%)
 Frame = +1

Query  142   KEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFG  201
             + AA++G KV V++  +        GLGGTCVN GC+PKK+M  +S   E L+ +     
Sbjct  6355  RRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  6525

Query  202   WNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLW  261
                GS   +   FDW  + +   +YI  ++  Y+  L +  V     +   V  + +++ 
Sbjct  6526  TTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQIEV-  6702

Query  262   HPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVAL  321
                      T +H+++AVGG+P      G E  + SD  F + + +P K  VVGA Y+A+
Sbjct  6703  ----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRL-EAQPKKVAVVGAGYIAI  6867

Query  322   ECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDS  380
             E AG    +     +  R   +LR FD  +   I E  E ++GI F+R +  + I K   
Sbjct  6868  ELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQAD  7044

Query  381   GQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTT  440
             G L +    +  +     FDT+L A GR+P    LGL+E GVKL +    +    E T+ 
Sbjct  7045  GTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENTSV  7224

Query  441   PNVYAIGDV-IDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLS  499
             P +YAIGD  I   ELTPVAI AG              + Y +I T VF+    G  G +
Sbjct  7225  PGIYAIGDATITGWELTPVAIAAGXXXXXXXXXXXXXLLHYHQIPTVVFSHPPLGTIGYT  7404

Query  500   EEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGP  559
             E  + E++G ++V+VY   FV L +++A+       +  +K+V        V   H  G 
Sbjct  7405  EPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTA--MKLVTVGEDEVVVG-VHVAGE  7575

Query  560   NAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              A E+ Q  G+A+K+  T     + V IHP
Sbjct  7576  GADEMIQGFGVAVKMNATKADFDNIVAIHP  7665

>ALLA:FR824246 dna:supercontig supercontig:ENA1:FR824246:1:47019:1 
REF
Length=47019

 Score = 144 bits (364),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/267 (36%), Positives = 143/267 (54%), Gaps = 22/267 (8%)
 Frame = -3

Query  342    LLRGFDQDMASKIGEYME----------------MQSGIEFIRKTVPQSITKLDSGQLLV  385
              +LR FD  +   + E ME                +++G+ F+RK+  + I K +  +L +
Sbjct  33583  VLRKFDPLVRDLVNEEMEKCVVSMVCYSLLTISLLRNGVNFVRKSHLEKIVKSEDDKLAI  33404

Query  386    KWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVY  444
                   D       FD ++ A GR P    LGL++ GV+LNE TG I V+  E T+ P VY
Sbjct  33403  TARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELNE-TGHIIVDAQENTSIPGVY  33227

Query  445    AIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEED  502
              A+GDV     ELTPVAI AGR L+ RL+ NE    + Y +I T VF+    G  G +E +
Sbjct  33226  ALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPPLGTIGYTEPE  33047

Query  503    SKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAG  562
              +  +YG+++V+ Y   FV L +S+AE      ++C +K+VC  ++   V+G H  G  A 
Sbjct  33046  AIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-VVGLHVAGDGAD  32873

Query  563    EVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              E+ Q  G+AMK+G T     + V IHP
Sbjct  32872  EMVQGFGVAMKMGATKADFDNIVAIHP  32792

 Score = 62.4 bits (150),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 106/208 (51%), Gaps = 17/208 (8%)
 Frame = -2

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YD +VIGGGSGG+A ++ AA++G KV +++  +        G GGTCVN GC+PKK+M+ 
Sbjct  34280  YDYIVIGGGSGGVASARRAATYGAKVLLIERHREY---EGAGYGGTCVNYGCVPKKVMYN  34110

Query  186    SSLIGEILH-------HDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVEL  238
              ++   E +           AS G    S +     FDW ++     +YI+ ++  Y   L
Sbjct  34109  AAAHVEHIERAPDYSIRPFASKGDTSHSFS--FGDFDWGRMKVKRDAYIERLNGIYTRNL  33936

Query  239    RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298
               + ++     +   +    +++            +H++IAVGG P   +  G E A+ SD
Sbjct  33935  ANAKIDTVTGIAKLIAKDRVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSD  33768

Query  299    DIFWMKQKEPGKTLVVGASYVALECAGF  326
                F + + +P K  VVGA Y+A+E AG 
Sbjct  33767  GFFKL-ETQPKKVAVVGAGYIAVEIAGL  33687

>PYVX:scaffold_124 pve_scaffold_124 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_124:1:48871:1 
REF
Length=48871

 Score = 138 bits (347),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 198/378 (52%), Gaps = 21/378 (6%)
 Frame = +2

Query  98     PMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYV  157
              P    A++ +L  S  P I         YD VV+GGGSGG+A ++ AAS G KV +++  
Sbjct  38126  PARHQATSPKLRGS-CPHISATMSTETTYDYVVLGGGSGGVASARRAASHGAKVLLVERG  38302

Query  158    KPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWK  217
              + +      GLGGTCVN GC+PKK+M  ++   E L+         +G    Q   FDW 
Sbjct  38303  RAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSVTTLGERKFQFGDFDWL  38473

Query  218    QLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVI  277
               + +   +YI  ++  Y+  L + ++     +   V  + L++       K  T +++++
Sbjct  38474  NMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLEV-----DGKVYTGKNLLL  38638

Query  278    AVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM  337
              A GG P      G E A+ SD  F ++Q +P K  VVGA Y+A+E AG    +     + 
Sbjct  38639  APGGVPTLPPIPGIEHAIDSDGFFKLEQ-QPRKVAVVGAGYIAVEIAGIFNVLQSETFLF  38815

Query  338    VR-SILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFE  396
               R   +LR FD  +   +   ME ++G++F+R++    I KL+ G+L    IT + D   
Sbjct  38816  CRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLEDGKL---QITAEVDGAT  38983

Query  397    ET---FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDA  452
              +T   FDTVL A GR+P  A LGL+  GV L++K G I V+  E T+   VYAIGD    
Sbjct  38984  QTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQENTSAAGVYAIGDATTT  39160

Query  453    P-ELTPVAIQAGRLLSRR  469
                ELTPVAI AGR LS R
Sbjct  39161  GWELTPVAIAAGRRLSDR  39214

 Score = 50.1 bits (118),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 3/96 (3%)
 Frame = +3

Query  494    GCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLG  553
              G  G +E D+  +YG ++V+VY   FV L  ++A+       +  +  V  +     V+G
Sbjct  39327  GTIGYTEPDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKLVTVGAQ---ETVVG  39497

Query  554    FHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               H  G  A E+ Q  G+A+KLG T     + V IHP
Sbjct  39498  VHVAGEGADEMIQGFGVAVKLGATKADFDNIVAIHP  39605

>PYIW:scaffold_3390 piw_scaffold_3390 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3390:1:3223:1 
REF
Length=3223

 Score = 155 bits (392),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 121/357 (34%), Positives = 179/357 (50%), Gaps = 43/357 (12%)
 Frame = +1

Query  268   KEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFL  327
             KEI  ++++IAVGG+P      G EL + SD  F ++Q  P K  VVGA Y+A+E AG L
Sbjct  811   KEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFFELEQL-PKKVAVVGAGYIAVELAGVL  987

Query  328   KGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGI--------------EFIRKTVP  372
              G+G    +  R   +LR FD         ++ M SG               E +R T+ 
Sbjct  988   HGLGSNTTIFCRKDGVLRTFDV*YL-----WLTMPSGKWSLTW*YDLI*YEQELVRDTLH  1152

Query  373   QSITK---LDSGQLLVKWITEDGD----CFEET------FDTVLNATGRDPDVAKLGLDE  419
              ++ K   +   Q  V  + +  D     F +       FDTV+ A GR P  ++L L  
Sbjct  1153  DAMAKDGIVVRPQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSA  1332

Query  420   AGVKLNEKTGRIWVNNEQTTT-PNVYAIGDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQ  477
             AG+   +K G I V+  QTT+  NV+A+GDV     LTPVAI AGR LS RL+      +
Sbjct  1333  AGIA-TDKHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAK  1509

Query  478   MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-----AEQTRI  532
             + YD I T VF+    G  GL+E +++E++GD  ++ Y   FV + + L     A+    
Sbjct  1510  ISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAK  1689

Query  533   AAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                   +K+VC   ++  V+G H +G  A E+ Q  G+A+K+G T     + V IHP
Sbjct  1690  PKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHP  1857

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 12/97 (12%)
 Frame = +3

Query  126  YDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            YD +VIG GSGG+A S+ AA +   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  342  YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  494

Query  185  QSSLIGEILHHDCASFGW--NVGSVNGQVPTFDWKQL  219
             ++ +  +LH D   +G+    G   G    F W +L
Sbjct  495  LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKL  605

>PYAP:scaffold_610 pag1_scaffold_610 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_610:1:19546:1 
REF
Length=19546

 Score = 150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 141/478 (29%), Positives = 223/478 (47%), Gaps = 38/478 (8%)
 Frame = +3

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
              AS +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  12453  ASSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSK  12608

Query  182    LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               +  ++ +     HD + +G  V  V       ++  ++ +    +K+++   +   +  
Sbjct  12609  ALLHATHMYHAAQHDFSKYGIEVSDVK-----MNFDGMMKSKEKAVKTLTGGIEGLFKKN  12773

Query  242    QVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVS  296
              +V Y    G  V  + + +     G + +  ++++IA G       P  +    G++ V 
Sbjct  12774  KVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI-VD  12950

Query  297    SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIG  355
              S     +K K P   +V+G   + LE     K +G  V V+  +  +  G DQ++  +  
Sbjct  12951  STGALELK-KVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFT  13127

Query  356    EYMEMQSGIEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAK  414
              + ++ Q G++F   T V  S    D   L V+          E  DTVL ATGR P    
Sbjct  13128  KLLKKQ-GLQFEFSTKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKG  13301

Query  415    LGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYN-  472
              LGL++ G++  +K GRI V+N  +T  PN++AIGDVI  P L   A + G      +   
Sbjct  13302  LGLEQMGIQ-TDKLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGL  13478

Query  473    EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRI  532
               G V  +YD I   ++T  E    G +EE  KEE        Y+    P+  +   + R 
Sbjct  13479  HGHV--NYDAIPGVIYTYPEVASVGKTEEQLKEEG-----VAYNVGKFPMMAN--SRARA  13631

Query  533    AAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               AES  +VKV+ DKT +  +LG H +  NAGE+     L M+ G   + +  T   HP
Sbjct  13632  VAESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  13802

>PLHA:NW_020190027.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_3124, whole genome shotgun sequence
Length=220491

 Score = 150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 169/330 (51%), Gaps = 36/330 (11%)
 Frame = -1

Query  290    GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQ  348
              G EL + SD  F + +  P K  +VGA Y+A+E AG L  +G    V  R   +LR FD 
Sbjct  55947  GKELCIDSDGFFEL-ETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDV  55771

Query  349    D-------MASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQL----LVKWITEDGDCFE-  396
                      +A+ I  ++   +    +R T+ +++   D   L     V  + E  D  + 
Sbjct  55770  GINYSLFALANSI--FLIFFTAKNILRTTLEEAMAN-DGVHLRPNSTVARVKEAADGTKT  55600

Query  397    ---------ETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAI  446
                         FD V+ ATGR P  + L L++AG+  ++  G I VN  ++TT  NVYA+
Sbjct  55599  LVLTNGSEHRGFDVVICATGRVPLTSTLNLEKAGITTDDN-GYIRVNEFQETTKNNVYAV  55423

Query  447    GDVIDAPELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKE  505
              GDV + P LTPVAI AGR LS RL+      ++ Y+ I T +F+    G  GL+EE +++
Sbjct  55422  GDVCNTPALTPVAIAAGRRLSDRLFGGMKDAKLSYENIPTVIFSHPPIGTIGLTEEGARK  55243

Query  506    EYGDDSVEVYHKNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGP  559
              +YGD++++VY   FV + + L  +T  A           +K+VC   +   V+G H +G 
Sbjct  55242  KYGDNNIKVYSSRFVNMYYGLINETIEATGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGM  55066

Query  560    NAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               A E+ Q  G+A+K+G T     + + IHP
Sbjct  55065  AADEILQGFGVAVKMGATKADFDNCIAIHP  54976

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 13/99 (13%)
 Frame = -2

Query  125    DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
              +YD +VIG GSGG+A ++ AAS+ G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  56567  EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  56415

Query  184    HQSSLIGEILHHDCASFGWNVGSVNGQVP---TFDWKQL  219
              + ++ +   LHHD   +G+   +  G +     F+W +L
Sbjct  56414  YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKL  56298

>PYUU:scaffold_1352 scf1117875581352 dna:supercontig supercontig:pug:scf1117875581352:1:165876:1 
REF
Length=165876

 Score = 145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 177/354 (50%), Gaps = 35/354 (10%)
 Frame = -1

Query  268     KEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFL  327
               KE+  ++++IAVGG+P      G E  + SD  F + +  P K  VVGA Y+A+E AG L
Sbjct  133809  KEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFFEL-EVLPKKVAVVGAGYIAVELAGVL  133633

Query  328     KGMGYAVKVMVRSI-LLRGFDQDMASKIGEYMEMQSGI--------EFIRKTVPQSITK-  377
                G+G    +  R   +LR FD   +  +  ++ +            + +R  +  ++ K 
Sbjct  133632  NGLGSDTTIFCRKHGVLRTFDVSRSVLLDVHLTLMYPALNLSIFM*DSVRDMLHDAMAKD  133453

Query  378     ---LDSGQLLVKW-ITEDG-------DCFEET-FDTVLNATGRDPDVAKLGLDEAGVKLN  425
                  L +   + +  +  DG       D  E T FDT++ A GR P  + L L  AG+K +
Sbjct  133452  GITLRANSNVARVELAADGTKTLALQDGSEHTGFDTIIYAAGRVPLTSSLNLSAAGIKTD  133273

Query  426     EKTGRIWVNNEQTTT-PNVYAIGDVIDAPELTPVAIQAGRLLSRRLY---NEGTVQMDYD  481
                  G I V+  Q T+  NV+A+GDV     LTPVAI AGR LS RL+        ++ YD
Sbjct  133272  SH-GFIKVDAYQATSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGERHADAKISYD  133096

Query  482     KICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC----  537
                I T VF+    G  GL+E +++++YGD +++ Y   FV + + L  +     ++     
Sbjct  133095  NIPTVVFSHPPIGTIGLTEIEARKKYGDAAIKTYTSRFVNMYYGLVNEVADDGKAAKPKP  132916

Query  538     --YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                  +K+VC    +  V+G H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  132915  MTAMKLVC-LGDDEKVVGLHIIGMAADEMLQGFGVAVKMGATKADFDNCIAIHP  132757

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 12/98 (12%)
 Frame = -2

Query  125     DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
               +YD +VIG GSGG+A S+ AAS+   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  134291  EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  134139

Query  184     HQSSLIGEILHHDCASFGWNV--GSVNGQVPTFDWKQL  219
               + ++ +  +LH D   +G+    G   G+  +F W +L
Sbjct  134138  YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKL  134025

>PYIR:scaffold_544 pir_scaffold_544 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_544:1:21581:1 
REF
Length=21581

 Score = 144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 138/484 (29%), Positives = 215/484 (44%), Gaps = 40/484 (8%)
 Frame = -1

Query  120   DDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIP  179
               AS +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP
Sbjct  6308  SSASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIP  6153

Query  180   KKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELR  239
              K +  S+ +     HD A +G  V  V     + ++ +++ +    +K+++   +   +
Sbjct  6152  SKALLHSTHLYHSAQHDFAKYGIEVSEV-----SMNFGKMMKSKEKAVKTLTGGIEQLFK  5988

Query  240   SKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELA  294
               +V Y    G  V  + + +     G + +T ++++IA G       P  +    G++ 
Sbjct  5987  KNKVTYIKGHGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKI-  5811

Query  295   VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLR---GFDQDMA  351
             V S     +K K P   +VVGA  + LE     K +G   KV V   L R   G D ++ 
Sbjct  5810  VDSTGALELK-KVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELG  5640

Query  352   SKIGEYMEMQS-GIEFIRKTVPQSIT----KLDSGQLLVKWITEDGDCFEETFDTVLNAT  406
              +  + ++ Q  G EF  K     +      L             G       D VL AT
Sbjct  5639  KEFTKLLKKQGLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVAT  5460

Query  407   GRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRL  465
             GR P    LGL+  G++  +K GRI V++  +T  PN++AIGDVI  P L   A + G  
Sbjct  5459  GRRPYTNGLGLENMGIQ-TDKFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA  5283

Query  466   LSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS  525
              +  +  +    ++Y+ I   ++T  E    G +EE  KEE     V      F  L  S
Sbjct  5282  CAETIAGKHG-HVNYNAIPGVIYTFPEVASVGKTEEQLKEE----GVTYNVGKFPMLANS  5118

Query  526   LAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTV  585
              A    +      VKV+ DK  +  +LG H +  NAGE+     L M+ G + + +  T 
Sbjct  5117  RARA--VGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTC  4947

Query  586   GIHP  589
               HP
Sbjct  4946  HAHP  4935

>ALCA:scaffold_262 AcNc2_CONTIG_262_length_36549 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_262_length_36549:1:36549:1 
REF
Length=36549

 Score = 141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 139/481 (29%), Positives = 225/481 (47%), Gaps = 44/481 (9%)
 Frame = -3

Query  123    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182
              S +YDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K 
Sbjct  18145  SSEYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKA  17990

Query  183    MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
              +  SS +     HD  S G  V  +       ++ +++      +K ++   +   +  +
Sbjct  17989  LLHSSHLFHTAQHDFKSIGIEVSDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKKNK  17825

Query  243    VKYENVLGSFVDPH--TLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
              V Y    G  V  +  ++ L    KG + IT ++++IA G       P  +    G++  
Sbjct  17824  VAYIKGHGKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVD  17645

Query  296    SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
              S+  +    +  P + +VVGA  + LE     + +G  V V+   + +  G D ++  + 
Sbjct  17644  STGALVL--KSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREF  17471

Query  355    GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF---DTVLNATGRDPD  411
               + ++ Q G++F   T   S TK++   + +    ED     ET    D VL ATGR P 
Sbjct  17470  AKTLQKQ-GLKFKFATRVTS-TKVNGDNVTITM--EDAKGGNETSMECDVVLVATGRRPF  17303

Query  412    VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAG-RLLSRR  469
                 LGL+  G++  +K GRI V++  +T  P++YAIGDVI  P L   A + G   +   
Sbjct  17302  TNGLGLESMGIQ-TDKMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEGIAAVEIM  17126

Query  470    LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
              L   G V  +Y+ I   ++T  E  C G +EE  KEE        Y+    P+  +   +
Sbjct  17125  LGKHGHV--NYNAIPGVIYTHPEVACVGKTEEQLKEEGIS-----YNVGKFPMIAN--SR  16973

Query  530    TRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIH  588
               R   E+  +VKV+  K  N+ +LG H +  NAGE+     L ++ G   + +  T   H
Sbjct  16972  ARAVGETDGFVKVLAQKD-NDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAH  16796

Query  589    P  589
              P
Sbjct  16795  P  16793

>ALLA:FR824220 dna:supercontig supercontig:ENA1:FR824220:1:54737:1 
REF
Length=54737

 Score = 141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 224/482 (46%), Gaps = 44/482 (9%)
 Frame = -1

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
              +S +YDL+VIGGG GG   + +AA  G K VC+         GT   LGGTC+NVGCIP 
Sbjct  26078  SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPS  25926

Query  181    KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              K +  SS +     HD  + G     +       ++ +++      +K ++   +   + 
Sbjct  25925  KALLHSSHMFHTAQHDFKAIGIEASDLR-----LNFGKMMKAKEKSVKVLTSGIEGLFKK  25761

Query  241    KQVKYENVLGSFV--DPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGEL  293
               +V Y    G+ V  D  ++      KG + I  ++++IA G       P  +    G +
Sbjct  25760  NKVAYIKGHGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI  25581

Query  294    AVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMAS  352
                S+  +    +  P + +VVGA  + LE     + +G  V V+   + +  G D ++  
Sbjct  25580  VDSTGALVL--KSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGR  25407

Query  353    KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEET---FDTVLNATGRD  409
              +  + ++ Q G +F   T   S TK++  ++ +    ED     ET    D VL ATGR 
Sbjct  25406  EFAKTLQKQ-GFKFKFATKVTS-TKVNEDRVTITM--EDAKGGNETNMECDVVLVATGRR  25239

Query  410    PDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAG-RLLS  467
              P    LGL+  G++  +K GRI V+N  +T  PN+YAIGDVI  P L   A + G   + 
Sbjct  25238  PFTQNLGLENLGIQ-TDKLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEGIAAVE  25062

Query  468    RRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLA  527
                L  +G V  +Y+ I   ++T  E  C G +EE  KEE     V      F  +  S A
Sbjct  25061  IMLGKQGHV--NYNAIPGVIYTFPEVACVGRTEEQLKEE----GVSYNVGKFPMIANSRA  24900

Query  528    EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
                  +     +VKV+  K  N+ +LG H +  NAGE+     L ++ G + + +  T   
Sbjct  24899  RA--VGETDGFVKVLAQKD-NDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHA  24729

Query  588    HP  589
              HP
Sbjct  24728  HP  24723

>PHKE:scaffold_8 scf_22126_8.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_8.1_contig_1:1:276008:1 
REF
Length=276008

 Score = 140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 130/480 (27%), Positives = 230/480 (48%), Gaps = 38/480 (8%)
 Frame = -3

Query  117     VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
               +V  DAS    L+VIGGGSGG   +  AA  GKKV +++  +         LGG C+N G
Sbjct  165384  MVVGDASMHTQLLVIGGGSGGYVAAIRAAQLGKKVLLVEKSE---------LGGVCLNCG  165232

Query  177     CIPKKLMHQSSLIGEILHHDCASFGWNVGSVN---GQVPTFDWKQLVSNVssyiksisfk  233
               C+P K +  ++   E +     S G     V+    Q+  +   ++V+ + + I+S+   
Sbjct  165231  CVPSKALISAAHRYEQMLESGIS-GLKAKGVDIDFSQIQQWKQTKVVNRLKTGIQSL---  165064

Query  234     ykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLG-GE  292
                   L+  ++        F++    +L++ ++  +       ++AVG RP +L     G 
Sbjct  165063  ----LKKHEISVFKGEALFINDREARLYNEQESLR-YQFDDCIVAVGSRPIELKAFPYGN  164899

Query  293     LAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQDMA  351
                 +SS +   + +  P + +V+G  Y+ +E        G  V ++  S  +L GF+ ++ 
Sbjct  164898  RILSSTEALTLTEI-PERMVVIGGGYIGIELGQMYAKFGTKVTILEGSPSILPGFESEIT  164722

Query  352     SKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPD  411
                 + + ++   G+      + QS  +  S   +    T D    + T D VL   GR P+
Sbjct  164721  RIVKKNLD-SLGVTVYTNAMAQSAQQ--SADEITVTFTVDQTEQQVTADYVLVTVGRRPN  164551

Query  412     V-AKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
                  +LGLD  GVK+ E+ G + V+ + +T+ P++YAIGD+I  P L   A   G++++  
Sbjct  164550  TDGELGLDRIGVKIGER-GLVEVDQQGRTSIPHIYAIGDIIAGPALAHKASYEGKVVAEA  164374

Query  470     LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
               +  + +   DY  I   VF+  E    GLSE D+KE+  D  V  +     P   + A  
Sbjct  164373  IAGQPSA-FDYKVIPAVVFSDPEIASVGLSEPDAKEKGYDIMVGKF-----PFAAN-ARA  164215

Query  530     TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 ++A   +VK+V DK +   +LG   +G NA ++   + LA+++G T + L  T+  HP
Sbjct  164214  LSLSASEGFVKLVGDK-KTGLILGGQIVGTNASDLIPEIALAIEMGTTMEDLALTIHAHP  164038

 Score = 136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 130/498 (26%), Positives = 229/498 (46%), Gaps = 64/498 (13%)
 Frame = -1

Query  106     SELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTS  165
               +E+ +S T P++ ++    DYD ++IG G    + + +A  +G KV +++       GT 
Sbjct  156593  AEVLDSHTVPVLSDEG---DYDFLIIGSGGAAFSAAIQAVEYGAKVAIIE------RGT-  156444

Query  166     WGLGGTCVNVGCIPKKLMHQSSLIGEILH--HDCASFGWNVGSVNGQVPTFDWKQLVSNV  223
                 +GGTCVN+GC+P K + ++   GEI H   +    G N  +V       D  QLV   
Sbjct  156443  --VGGTCVNIGCVPSKTLLRA---GEINHFAKNNPFLGLNTSAV-----AVDLDQLVEQ-  156297

Query  224     ssyiksisfkykVELRSKQVKYENVLG-----------SFVDPHTLKLWHPKKGTKEITT  272
                        +   E+R +  KYE+++G            FVD  T+ +     G +++T 
Sbjct  156296  -------KNELVAEMREQ--KYEHLIGEYGFELIRGEAKFVDEKTIVV-----GGRKLTA  156159

Query  273     RHVVIAVGGRPR--QLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGM  330
               +  ++A G  P    +  L     ++S  +  +KQ  P    V+G+ Y+A+E       +
Sbjct  156158  KRFLLATGAAPSIPDIPGLTDVDYLTSTSLLDLKQL-PKTLAVIGSGYIAMELGQLFHNL  155982

Query  331     GYAVKVMVRS-ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWIT  389
               G  V ++ RS  + + +D +++  + + +  Q GI  I       +    +G L    ++
Sbjct  155981  GTEVTLIQRSPRIFKEYDPEISEAVTKALTEQ-GIHLITGATYDRVET--TGNLKHVHLS  155811

Query  390     EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGD  448
                +G+      + +L ATGR P+   L L  A V +  K G I V++  +T+ P +YA GD
Sbjct  155810  VNGEKKVIEAEQLLIATGRKPNTEALNLRAANVIIGSK-GEIVVDDVLKTSNPRIYAAGD  155634

Query  449     VIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYG  508
               V   P+   VA   GR+ +         +++ + +    FT       GL+EE +K +  
Sbjct  155633  VTMGPQFVYVAAYEGRIAADNAVGGLEKKVNLETVPGVTFTSPALATVGLTEEQAKAKGY  155454

Query  509     DDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
               +    +   + VP      E T +       K+V D +++  VLG H +  NAG+V  A 
Sbjct  155453  EVKTSILPLDSVPRALVNRETTGV------FKLVAD-SKSLKVLGVHIVAENAGDVIYAA  155295

Query  569     GLAMKLGFTYDQLVDTVG  586
                LA+K G T + L D++ 
Sbjct  155294  TLAVKFGLTVEDLRDSLA  155241

 Score = 101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 110/468 (24%), Positives = 210/468 (45%), Gaps = 40/468 (9%)
 Frame = -3

Query  127    DLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQS  186
              + +VIG G GG   +  +   G K  +++  +         LGG C +VGCIP K     
Sbjct  91089  NTLVIGSGPGGYVAALRSVQLGMKTAIVERKQ---------LGGVCTHVGCIPSK-----  90952

Query  187    SLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYE  246
              +LI E   +D       V +        ++KQ V N  +            L++  V   
Sbjct  90951  ALIAESHRYDLFKPFNPVDAAATFKNAQNFKQGVVNKQAGGVHYL------LKNAGVTIL  90790

Query  247    NVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLAC--LGGELAVSSDDIFWMK  304
                  S VD HT  L         I+ +++++A G RP +L    +GG +  S++ +   +
Sbjct  90789  EGEASLVDEHT-ALIQQAGQDHSISFKNLILATGSRPIELPAFPVGGRILSSTEALSLAE  90613

Query  305    QKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEYMEMQSG  363
                 P   +V+G  Y+ +E        G  V ++   + +L GF+ + A+ + + ++   G
Sbjct  90612  V--PSSLVVIGGGYIGVELGQMYAKFGTKVTILEGGAQVLPGFETEFAAPVVKQLKA-DG  90442

Query  364    IEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDV-AKLGLDEAGV  422
              I+ +   + + + + ++  + + + ++  +  + T + VL   GR P+   +LGL+  G+
Sbjct  90441  IQIVTGAIAEKVEQ-NADSITLHY-SKSQEQHQVTAEYVLVTIGRKPNTDGQLGLERMGL  90268

Query  423    KLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYD  481
               +  K G +  + + +T  P++YAIGD+   P L   A    ++ +  +    T ++DY 
Sbjct  90267  PVTSK-GLVETDEQCRTMIPHIYAIGDITAGPALAHKASYEAKVAAEAIAGL-TSKVDYK  90094

Query  482    KICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKV  541
               I   VF+  E    G+SE ++K +     V +   +F     +LA    +     +VK+
Sbjct  90093  VIPLVVFSDPELSSVGVSETEAKAQ--AIPVVIGKSSFGINGRALA----LRETEGFVKI  89932

Query  542    VCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              V D   +  V+G   +G  A  +   + LA+++G T + L  T+  HP
Sbjct  89931  VADPA-SGIVIGAQIVGVEASTLISELALAIEMGATVEDLAMTIHPHP  89791

>APIN:scaffold_30 supercont1.30 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.30:1:728126:1 
REF
Length=728126

 Score = 102 bits (253),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = -1

Query  111     SRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGG  170
               S  P ++    ++  YD +V+GGGSGG+A ++ AAS+G KV V   V+        GLGG
Sbjct  476879  SSFPQLLRRPMSTTSYDYIVLGGGSGGIASARRAASYGAKVLV---VERGRTLGGAGLGG  476709

Query  171     TCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNG-QVPTFDWKQLVSNVssyiks  229
               TCVNVGC+PKK+M+ ++ + EI+H   ++  +    V G +  +FDW  + S   +Y+  
Sbjct  476708  TCVNVGCVPKKVMYNAAFLAEIMH---SAKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTR  476538

Query  230     isfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACL  289
               +   Y+  L    +   + + +FVD HT+ +     G K  T  H+++AVGG P+  +  
Sbjct  476537  LHGIYERNLAKDGISLVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIP  476373

Query  290     GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQ  348
               G ELA+SSD  F + + +P K  VVGA Y+A+E AG    +     +  R   +LR FD 
Sbjct  476372  GIELAISSDGFFAL-ETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDP  476196

Query  349     DMASKIGEYME  359
                +   + + M 
Sbjct  476195  LVRDHVNKEMR  476163

 Score = 62.4 bits (150),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 11/143 (8%)
 Frame = -3

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVKWI--TEDGDCFEETF---DTVLNATGRDPDVAKL  415
               ++G+ F+ ++   SI K  +G L ++     E+G    + F   D V+ A GR P     
Sbjct  476106  RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDC  475927

Query  416     GLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLYNE  473
               G D   +  + K G I V+  E TT P VYAIGD      ELTPVAI AGR L+ RL+  
Sbjct  475926  GFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGG  475750

Query  474     GTVQMDYDKICTAVFTPIEYGCC  496
                  ++     C A  + I  G C
Sbjct  475749  ---EVHSTVTCPARRSRIRLGWC  475690

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = -1

Query  478     MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC  537
               ++Y +I T VF+    G  G +E D+  +YG  +V+VY  +FV L ++L     +   S 
Sbjct  475640  INYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDM--PST  475467

Query  538     YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                +KVVC   +   V+G H  G  A E+ Q  G+A+K+G     L + + IHP
Sbjct  475466  AMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHP  475314

>PHRA:scaffold_60
Length=327626

 Score = 137 bits (344),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 106/328 (32%), Positives = 158/328 (48%), Gaps = 31/328 (9%)
 Frame = +3

Query  290     GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQ  348
               G EL + SD  F ++   P K  VVGA Y+A+E AG L  +G    +  R   +LR FD 
Sbjct  187239  GKELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDV  187415

Query  349     -----DMASKIGEYMEMQSGIEFIRKTV-------------PQS-ITKLDSGQLLVKWIT  389
                    D+   I   + +   I+ I +T              P S +T+++      K + 
Sbjct  187416  SWINVDLFRSILNVLLIMHWIQGIVRTTLEDAMAKDGVHLRPHSNVTRVEQVADGTKTLV  187595

Query  390     EDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGD  448
                        +D V+ A GR P  + L LD A +   +K G I VN  ++T+   V A+GD
Sbjct  187596  LADGSEHSGYDVVIYAAGRVPLTSNLQLDNADIA-TDKHGFIQVNEFQETSNSKVLAVGD  187772

Query  449     VIDAPELTPVAIQAGRLLSRRLYN-EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEY  507
               V   P LTPVAI AGR LS RL+      ++ Y+ I T VF+    G  GL+EE ++ +Y
Sbjct  187773  VCGTPALTPVAIAAGRRLSDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQY  187952

Query  508     GDDSVEVYHKNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNA  561
               GDD+ +VY   FV + + L  +   A           +K+VC   +   V+G H +G  A
Sbjct  187953  GDDNTKVYASRFVNMYYGLINEVDEATGEPKDKPKTAMKLVC-VGKEEKVVGLHMIGMAA  188129

Query  562     GEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                E+ Q  G+A+K+G T     + + IHP
Sbjct  188130  DEILQGFGVAVKMGATKADFDNCIAIHP  188213

 Score = 25.8 bits (55),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 36/87 (41%), Gaps = 14/87 (16%)
 Frame = +2

Query  197     CASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPH  256
               CA+  WN+  V  +     W   ++++  +        KVEL     K+       VD  
Sbjct  186935  CAATQWNLRKVTSRTVRLLWP--IADIELHCYRNLANSKVELIHGSAKFNEKGNVEVD--  187102

Query  257     TLKLWHPKKGTKEITTRHVVIAVGGRP  283
                          KE+  ++V++AVGG+P
Sbjct  187103  ----------GKELLAKNVLVAVGGKP  187153

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 64/117 (55%), Gaps = 17/117 (15%)
 Frame = +3

Query  111     SRTPPIVVEDDASY----DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTS  165
               SR P       +S     +YD +VIG GSGG+A ++ AAS+ G +V V++  +       
Sbjct  186591  SRVPRFARARSSSRTLQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR-------  186749

Query  166     WGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQL  219
                 LGGTCVNVGC+PKKLM  ++ +   L HD   +G+     G   GQ   FDW +L
Sbjct  186750  --LGGTCVNVGCVPKKLMFIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKL  186914

>PHKE:scaffold_1 scf_22126_1.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_1.1_contig_1:1:510348:1 
REF
Length=510348

 Score = 134 bits (337),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 128/482 (27%), Positives = 235/482 (49%), Gaps = 43/482 (9%)
 Frame = -1

Query  117     VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
               +V  DAS + D +VIG G GG   +  AA  G+ V ++D  +         LGG C+N G
Sbjct  393453  MVVGDASLNIDTLVIGAGPGGYVAAIRAAQLGQSVLIVDKSE---------LGGVCLNRG  393301

Query  177     CIPKKLMHQSSLIGEILHHDCASFG--WNVGSVNGQVPTFDWKQLVSNVssyiksisfky  234
               CIP K     +LI     ++ A  G  + + + N +V     ++  + V   +       
Sbjct  393300  CIPSK-----ALISAAHQYESALHGEAFGISAENVKVDFSKTQEFKNGVVKKMTGGVAGL  393136

Query  235     kVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLA--CLGGE  292
                  L+  +V+  N    F++ +  ++++  + +     ++ +IA G RP +L     GG 
Sbjct  393135  ---LKGNKVEVFNGECMFINENEARVFNDHE-SPRYKFKNAIIATGSRPIELKPFPFGGR  392968

Query  293     LAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMV-RSILLRGFDQDMA  351
               +  S++ +     + P   +V+G  Y+  E        G  V ++     +L GFD+DM 
Sbjct  392967  ILSSTEALNL--PEVPKSMIVIGGGYIGAELGQMYSKFGAKVTIIEGLDTVLPGFDKDMT  392794

Query  352     SKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPD  411
               S + + M+ ++GIE +     +S  + D   + VK+ + +G+  E T D +L   GR P+
Sbjct  392793  SLVAKNMK-KTGIEIVTGAKAESAEQTDK-DVTVKY-SVNGESKEVTADYLLVTVGRRPN  392623

Query  412     V-AKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
                  +LGLD  GV ++E+ G + V+++ +T+ P+++AIGD++    L   A   G++ +  
Sbjct  392622  TDGELGLDLIGVDVDER-GFVKVDHQGRTSIPHIFAIGDIVSGLALAHKASYEGKVAAEA  392446

Query  470     LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEE-YGDDSVEV-YHKNFVPLEWSLA  527
               +  + +V +DY  +   VFT  E    G +E+++KE+ Y   + +  Y  N   +  + A
Sbjct  392445  IAGQPSV-VDYKCMPAVVFTDPECSSVGYTEKEAKEKGYKVKAGKFPYAGNGRAVSLNHA  392269

Query  528     EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
               E         +VK+V D+  +  VLG   +G  A  +   +GLA+++G T + L  T+  
Sbjct  392268  EG--------FVKIVADE-ESGLVLGCQIVGLEASNLIAELGLAIEMGATLEDLALTIHA  392116

Query  588     HP  589
               HP
Sbjct  392115  HP  392110

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 108/238 (45%), Gaps = 30/238 (13%)
 Frame = -3

Query  254    DPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAV-----SSDDIFWMKQK--  306
              D  T+++   ++G  E +   ++++ G RP      G +  +     S  DI  +K++  
Sbjct  98986  DNRTVQVQSHERGQYEESYDELILSPGARPIIPDLPGKDNPLIFTVRSIPDIDRIKEQVN  98807

Query  307    --EPGKTLVVGASYVALECAGFLKGMGYAVKVMV-RSILLRGFDQDMASKIGEYMEMQSG  363
                     +V+G  ++ +E A  LK  G  V ++     LL  FD ++A+ + + ME Q G
Sbjct  98806  SDNNASVIVIGGGFIGVEMAENLKEAGLDVTLVEGNGQLLTPFDPELAASLAQEME-QHG  98630

Query  364    IEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVK  423
              ++ +     Q +    S +  +     DG       D V+ A G  PD + L    +GV 
Sbjct  98629  VKLL---FSQRVQGFQSREQGIGVELADGRVL--AADLVILAIGVAPDTSFL--QHSGVS  98471

Query  424    LNEKTGRIWVNNE-QTTTPNVYAIGDVID----------APELTPVAIQAGRLLSRRL  470
              L  + G I VN   +++ P++YA+GD I+          A  L   A + GR+++ R+
Sbjct  98470  LGAR-GHIMVNEALESSVPHIYAVGDAIEVKDYIHGTKTAIPLAGPANKQGRIVADRI  98300

>HYAP:scaffold_208 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_208:1:99469:1 
REF
Length=99469

 Score = 132 bits (332),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 133/479 (28%), Positives = 220/479 (46%), Gaps = 45/479 (9%)
 Frame = +2

Query  125    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
              DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  38045  DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  38200

Query  185    QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
               S+ +     H+  S+G +  +V    P     Q++      +++++   +      +V 
Sbjct  38201  HSTHLLHTAQHEFKSYGIDAPNVTANFP-----QMMKAKEKAVRTLTAGIESLFSKNKVT  38365

Query  245    YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQLACL-----GGELAVSSD  298
              Y   +G       + +    ++G   +T +++++A G     L  +      G++  S+ 
Sbjct  38366  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  38545

Query  299    DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKIGEY  357
               +   +   P   +VVGA  + LE     K +G  V V+        G D+    +  + 
Sbjct  38546  ALALTRV--PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKL  38719

Query  358    MEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGRDPD  411
              ++ Q G+EF      Q  TK+ + ++   +V   TE    GD      DTVL ATGR   
Sbjct  38720  LKKQ-GLEF------QFGTKVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAF  38878

Query  412    VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
               A LGL++ G++  +K GRI V++  QT  P V+AIGDVI    L   A + G      +
Sbjct  38879  TAGLGLEQMGIQ-TDKQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENI  39055

Query  471    YNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
                +    ++Y  I   ++T  E+   G +EE+ K E     VE Y+    P+  +   +T
Sbjct  39056  AGKHG-HVNYGAIPNVIYTFPEFASVGKTEEELKAE----GVE-YNVGKFPMMANSRART  39217

Query  531    RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               +A     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  39218  -VAEADGMVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  39388

>PHKE:scaffold_35 scf_22126_35.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_35.1_contig_1:1:159504:1 
REF
Length=159504

 Score = 129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 136/484 (28%), Positives = 217/484 (45%), Gaps = 56/484 (12%)
 Frame = +2

Query  127     DLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK-LMHQ  185
               D+ ++GGG+GG   +  AA  GK+V +++  K         LGGTC++ GCIP K L+  
Sbjct  106043  DVAILGGGTGGYVAAIRAAQLGKQVVIIEKDK---------LGGTCLHRGCIPSKALLRS  106195

Query  186     SSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKY  245
               + +  EI   +  ++G       G    F   Q   +          +Y ++    QV +
Sbjct  106196  AEVYAEI--QESEAYGIETA---GATLVFPKVQARKDAIVEQLHQGVQYLMKKNKIQVVH  106360

Query  246     ENVLGSFVDPHTLKLWHPKKGT----------KEITTRHVVIAVGGRPRQLACL--GGEL  293
                N  G  + P    ++ P+ G             +   +++IA G RPR L  L   G  
Sbjct  106361  AN--GRVIGP---SIFSPQSGAVAVEFEDGEMDTVVPTNLIIATGSRPRVLPGLEPDGRY  106525

Query  294     AVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMAS  352
                +SSD+   M +  P   ++VG   + LE A  L   G  V V+   + +L   D+D+A 
Sbjct  106526  IMSSDEALRMDEL-PASLIIVGGGVIGLEWASMLNDFGVEVTVVEAAAHVLPAEDEDVAK  106702

Query  353     KIGEYMEMQSGIEFIRK----TVPQSITKLDSGQLLVKWITEDGDCFEETF--DTVLNAT  406
               ++ + +  + G+ F+      T   S+ K D  Q+ VK     GD  +ET   D +L + 
Sbjct  106703  EM-QRLLGKRGVRFLTGASVLTETYSVEK-DGIQIDVKL----GDEKQETLRADKMLVSV  106864

Query  407     GRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRL  465
               GR  +V  +GL+   +KL+   G I VNN  QT   ++YAIGDVI   +L   A   G L
Sbjct  106865  GRQANVENIGLENTDIKLDR--GFIAVNNHLQTGEGHIYAIGDVIGGLQLAHAASHEGIL  107038

Query  466     LSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS  525
                   L  E    ++  +I   V+T  E    G +E ++KE      V+     F  +  S
Sbjct  107039  AVNHLAGETVHAVESHRIPRCVYTRPEAASIGFTEREAKER--GYEVKTGKFPFQAIGKS  107212

Query  526     LAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTV  585
               L   +R      +VKV+ D  + N +LG H +G +  E+     LA  L  T  ++  T+
Sbjct  107213  LVHGSR----DGFVKVIAD-AKTNDILGVHMIGTHVTELIAEASLAQMLDATPWEVGQTI  107377

Query  586     GIHP  589
                 HP
Sbjct  107378  HPHP  107389

>HYAP:scaffold_32 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_32:1:492606:1 
REF
Length=492606

 Score = 125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 111/199 (56%), Gaps = 10/199 (5%)
 Frame = -2

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
               FD V+ A GR P   KL LD AGV  N K G I VN  ++T+   V+A+GDV   P LTP
Sbjct  182690  FDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYIVVNEFQETSNSKVFAVGDVCGTPALTP  182514

Query  458     VAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               VA+ AGR LS RL+ N    ++ Y+ I T VF+    G  GL+E+ ++ +YGDD ++VY 
Sbjct  182513  VAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQAQGKYGDDDIKVYT  182334

Query  517     KNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGL  570
                +FV + + L  +   A           +K+VC   +   V+G H +G  A E+ Q  G+
Sbjct  182333  SHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEK-VVGLHMIGMAADEILQGFGV  182157

Query  571     AMKLGFTYDQLVDTVGIHP  589
               A+K+G T     + + IHP
Sbjct  182156  AVKMGATKADFDNCIAIHP  182100

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 15/100 (15%)
 Frame = -3

Query  125     DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
               +YD +VIGGGSGG+A ++ AAS+   +V V+++ +         LGGTCVNVGC+PKKLM
Sbjct  183745  EYDYLVIGGGSGGIASARRAASYPNTRVAVVEHAR---------LGGTCVNVGCVPKKLM  183593

Query  184     HQSSLIGEILHHDCASFGWNV----GSVNGQVPTFDWKQL  219
                 ++ +   L HD   +G+      GS+  Q+  FDW +L
Sbjct  183592  FLAADMSHKLQHDVVHYGFEKEGTGGSLGAQMH-FDWTKL  183476

 Score = 38.9 bits (89),  Expect(2) = 0.005, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 2/59 (3%)
 Frame = -3

Query  290     GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
               G EL + SD  F +    P K  V+GA Y+A+E AG L  +G    +  R   +LR FD
Sbjct  183073  GKELCIDSDGFFEL-DTLPKKVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFD  182900

 Score = 25.4 bits (54),  Expect(2) = 0.005, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = -2

Query  268     KEITTRHVVIAVGGRP  283
               KE+  ++V+IAVGG+P
Sbjct  183215  KEVLAKNVMIAVGGKP  183168

>PHKE:scaffold_66 scf_22126_66.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_66.1:1:120469:1 
REF
Length=120469

 Score = 125 bits (314),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 113/199 (57%), Gaps = 10/199 (5%)
 Frame = -2

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
               +D V+ A GR P  + L LD+AG+   +K G I VN  ++T+   V A+GDV   P LTP
Sbjct  106788  YDVVIYAAGRVPLTSTLKLDKAGIA-TDKNGFIQVNKFQETSNSKVLAVGDVCGTPALTP  106612

Query  458     VAIQAGRLLSRRLYN-EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               VAI AGR LS RL+   G  ++ Y+ I T VF+    G  GL+EE ++++YGDDS++VY 
Sbjct  106611  VAIAAGRRLSDRLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYT  106432

Query  517     KNFVPLEWSLA-EQTRIAAE-----SCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGL  570
                 FV + + L  E      E        +K+VC   ++  V+G H +G  A E+ Q  G+
Sbjct  106431  SRFVNMYYGLINEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGFGV  106255

Query  571     AMKLGFTYDQLVDTVGIHP  589
               A+K+G T     + + IHP
Sbjct  106254  AVKMGATKADFDNCMAIHP  106198

 Score = 96.7 bits (239),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 90/305 (30%), Positives = 131/305 (43%), Gaps = 83/305 (27%)
 Frame = -3

Query  111     SRTPPIVVEDDASY----DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTS  165
               SR P +     AS     +YD +VIG GSGG+A ++ AAS+ G +V V++  +       
Sbjct  107879  SRVPHLARALSASRALQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR-------  107721

Query  166     WGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQV---PTFDWKQLVS-  221
                 LGGTCVNVGC+PKKLM  ++ +G  LHHD   +G+   +  G V     FDW +L + 
Sbjct  107720  --LGGTCVNVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTR  107547

Query  222     ------------------------------NVssyiksisfkykVELRSKQVKYENVLGS  251
                                             NV      ++      L + +V+      +
Sbjct  107546  RDAYVLRLNGIYERLEHNRSKTKGDQLSDTNVVFASLFVALGGCRNLANSKVELIRGSAA  107367

Query  252     FVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPR---------------------------  284
               F D   + +       KE+  ++V+IAVGG+P                            
Sbjct  107366  FNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPGTCLVG*QIAADCED*TGSWYL  107202

Query  285     QLAC-LGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-L  342
                LAC  G EL + SD  F ++   P K  VVGA Y+A+E AG L  +G    +  R   +
Sbjct  107201  LLAC*TGKELCIDSDGFFELEML-PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGV  107025

Query  343     LRGFD  347
               LR FD
Sbjct  107024  LRTFD  107010

>PYUU:scaffold_2032 scf1117875582032 dna:supercontig supercontig:pug:scf1117875582032:1:863081:1 
REF
Length=863081

 Score = 124 bits (310),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 140/478 (29%), Positives = 218/478 (46%), Gaps = 40/478 (8%)
 Frame = +3

Query  123     SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKL  182
               S DYD+VVIGGG GG   + +AA  G K   ++       GT   LGGTC+NVGCIP K 
Sbjct  652233  SSDYDVVVIGGGPGGYVAAIKAAQLGLKTACIE-----SRGT---LGGTCLNVGCIPSKA  652388

Query  183     MHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQ  242
               +  S+ +     HD + +G  V  V     + D+ +L+ +    +K+++   +   +  +
Sbjct  652389  LLHSTHLYHSAQHDFSKYGIEVSGV-----SMDFGKLMKSKDKAVKTLTGGIEQLFKKNK  652553

Query  243     VKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSS  297
               V Y    G  V  + + +     G + ++ ++++IA G       P  +    G++ V S
Sbjct  652554  VTYIKGHGKIVAKNEIAVTLNDSGNQTVSAKNILIATGSEVTPLPPVPVDNAAGKI-VDS  652730

Query  298     DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLR---GFDQDMASKI  354
                    +K K P   +V+GA  + LE     K +G   KV V   L R   G D ++  + 
Sbjct  652731  TGALELK-KVPEHLVVIGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEF  652901

Query  355     GEYMEMQS-GIEFIRKTVPQSITKLDSGQL-LVKWITEDGDCFEETFDTVLNATGRDPDV  412
                + ++ Q  G EF  K    + +K+D  ++ L       G       D VL ATGR P  
Sbjct  652902  TKLLKKQGLGFEFSTKV---TASKVDGDKVTLTTEPAAGGAASTIECDAVLVATGRRPFT  653072

Query  413     AKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLY  471
                 LGL+  G++  +K GRI V+   +T  PN++AIGDVI  P L   A + G      + 
Sbjct  653073  GGLGLENMGIQ-TDKFGRIQVDEHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVETIA  653249

Query  472     NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTR  531
                +    ++Y+ I   ++T  E    G +EE  KEE     V      F  L  S A    
Sbjct  653250  GKHG-HVNYNAIPGVIYTFPEVASVGKTEEQLKEE----GVAYNVGKFPMLANSRARA--  653408

Query  532     IAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               +      VKV+ DK  +  +LG H +  NAGE+     L M+ G   + +  T   HP
Sbjct  653409  VGEADGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  653579

>PYVX:scaffold_632 pve_scaffold_632 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_632:1:17512:1 
REF
Length=17512

 Score = 122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 121/441 (27%), Positives = 198/441 (45%), Gaps = 47/441 (11%)
 Frame = +1

Query  168   LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
             LGGTC+NVGCIP K +  S+ +     HD A +G  V  V       +   ++      +
Sbjct  8434  LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKA-----NLGGMMKAKEKAV  8598

Query  228   ksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQL  286
              +++   +   +  +V Y    G  V  + + +  +  KG + +T ++++IA G  P  L
Sbjct  8599  TTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPAPL  8778

Query  287   ACL---GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILL  343
               +     +  +          K P   +VVGA  + LE     K +G   KV V   L 
Sbjct  8779  PPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEFLD  8952

Query  344   R---GFDQDMASKIGEYMEMQSGIEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETF  399
             R   G D +++ +  + ++ Q G+EF   T V  S  K D+  L V+  +  G       
Sbjct  8953  RACPGLDLEVSKEFTKLLKKQ-GLEFQFSTKVTASEVKGDNVTLTVEP-SAGGSAASIEC  9126

Query  400   DTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPV  458
             DTVL ATGR P    LGL++ G++  +K GR+ V++  +T  PN+YA GDVI        
Sbjct  9127  DTVLVATGRRPFTEGLGLEQMGIQ-TDKQGRVEVDSHFRTQIPNIYAFGDVIK-------  9282

Query  459   AIQAGRLLSRRLYNEGTV----------QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYG  508
                 G +L+ +   EG             ++YD I   ++T  E    G +EE+ K E  
Sbjct  9283  ----GAMLAHKAEEEGVACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEELKNEG-  9447

Query  509   DDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
                   Y+    P+  +   +T IA    +VK++ DK  +  +LG H +  NAGE+    
Sbjct  9448  ----VTYNVGKFPMMANSRART-IAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEG  9609

Query  569   GLAMKLGFTYDQLVDTVGIHP  589
              L ++ G + + +  T   HP
Sbjct  9610  VLGLEYGASSEDIARTCHAHP  9672

>PHSO:scaffold_4
Length=7609242

 Score = 121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 109/199 (55%), Gaps = 10/199 (5%)
 Frame = +1

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
               +D V+ A GR P  + L LD+AGV   +K G I VN  ++T+   V A+GDV   P LTP
Sbjct  400513  YDVVIYAAGRVPLTSNLQLDKAGVD-TDKNGFIQVNEFQETSNSKVLAVGDVCGTPALTP  400689

Query  458     VAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               VAI AGR LS RL+      ++ Y+ I T VF+    G  GL+EE ++ +YGDD ++VY 
Sbjct  400690  VAIAAGRRLSDRLFGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYT  400869

Query  517     KNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGL  570
                 FV + + L  +   A           +K+VC   +   V+G H +G  A E+ Q  G+
Sbjct  400870  SRFVNMYYGLINEMDEATGEPKDKPKTAMKLVC-AGKEEKVVGLHMIGMAADEILQGFGV  401046

Query  571     AMKLGFTYDQLVDTVGIHP  589
               A+K+G T     + V IHP
Sbjct  401047  AVKMGATKADFDNCVAIHP  401103

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 13/99 (13%)
 Frame = +1

Query  125     DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
               +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  399487  EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  399639

Query  184     HQSSLIGEILHHDCASFGW---NVGSVNGQVPTFDWKQL  219
                 ++ +   LHHD   +G+     G   GQ   FDW +L
Sbjct  399640  FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKL  399756

 Score = 39.7 bits (91),  Expect(2) = 0.002, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +3

Query  290     GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
               G EL + SD  F + +  P K  VVGA Y+A+E AG L  +G    +  R   +LR FD
Sbjct  400128  GKELCIDSDGFFEL-ETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD  400301

 Score = 25.8 bits (55),  Expect(2) = 0.002, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +2

Query  268     KEITTRHVVIAVGGRP  283
               KEI  ++V+IAVGG+P
Sbjct  399989  KEILAKNVMIAVGGKP  400036

>PHIF:NW_003303731.1 Phytophthora infestans T30-4 supercont1.28 
genomic scaffold, whole genome shotgun sequence
Length=2122445

 Score = 119 bits (299),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 110/199 (55%), Gaps = 10/199 (5%)
 Frame = +3

Query  399      FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
                +D V+ A GR P  + L LD+AG+  +E  G I VN  ++T+   V A+GDV   P LTP
Sbjct  1898991  YDVVIYAAGRVPLTSNLQLDKAGITTDEH-GFIPVNELQETSNSKVLAVGDVCGTPALTP  1899167

Query  458      VAIQAGRLLSRRLYN-EGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
                VAI AGR LS RL+      ++ Y+ I T VF+    G  GL+EE ++ +YGDD+++VY 
Sbjct  1899168  VAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDAIKVYT  1899347

Query  517      KNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGL  570
                  FV + + L  +   +           +K+VC   +   V+G H +G  A E+ Q  G+
Sbjct  1899348  SRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC-AGKEEKVVGLHMIGMAADEILQGFGV  1899524

Query  571      AMKLGFTYDQLVDTVGIHP  589
                A+K+G T     + + IHP
Sbjct  1899525  AVKMGATKADFDNCIAIHP  1899581

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 59/99 (60%), Gaps = 13/99 (13%)
 Frame = +2

Query  125      DYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
                +YD +VIG GSGG+A ++ AAS+ G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  1897976  EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  1898128

Query  184      HQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQL  219
                  ++ +   L HD   +G+     G   G+   FDW +L
Sbjct  1898129  FIAADMSHKLRHDLLHYGFEDEATGGHLGKRTHFDWPKL  1898245

 Score = 39.3 bits (90),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = +1

Query  290      GGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
                G EL + SD  F + +  P K  VVGA Y+A+E AG L  +G    +  R   +LR FD
Sbjct  1898614  GKELCIDSDGFFEL-ETLPKKVAVVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFD  1898787

 Score = 27.3 bits (59),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 10/18 (56%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +2

Query  266      GTKEITTRHVVIAVGGRP  283
                G KE+  ++V+IAVGG+P
Sbjct  1898471  GGKELLAKNVLIAVGGKP  1898524

>PHPA:scaffold_79 NW_008649065.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.79, whole genome shotgun 
sequence
Length=269151

 Score = 117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 110/199 (55%), Gaps = 10/199 (5%)
 Frame = +3

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
               +D V+ A GR P  + L LD+AGV  +E  G I VN  ++T+   V A+GDV   P LTP
Sbjct  100587  YDVVMYAAGRVPLTSNLQLDKAGVTTDEH-GFIPVNEFQETSNSKVLAVGDVCGTPALTP  100763

Query  458     VAIQAGRLLSRRLYNE-GTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               VAI AGR LS RL+      ++ Y+ I T VF+    G  GL+E+ ++ +YGDD+V+VY 
Sbjct  100764  VAIAAGRRLSDRLFGGLNNSKVSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYT  100943

Query  517     KNFVPLEWSLAEQTRIAA------ESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGL  570
                 FV + + L  +   +           +K+VC   +   V+G H +G  A E+ Q  G+
Sbjct  100944  SRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC-VGKEEKVVGLHMIGMAADEILQGFGV  101120

Query  571     AMKLGFTYDQLVDTVGIHP  589
               A+K+G T     + + IHP
Sbjct  101121  AVKMGATKADFDNCIAIHP  101177

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 64/116 (55%), Gaps = 21/116 (18%)
 Frame = +2

Query  108    LNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSW  166
              L+ SR P          +YD +VIG GSGG+A ++ AAS+ G +V V++  +        
Sbjct  99554  LSASRAPQT--------EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR--------  99685

Query  167    GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQL  219
               LGGTCVNVGC+PKKLM  ++ +   L HD   +G+     G   G+   FDW +L
Sbjct  99686  -LGGTCVNVGCVPKKLMFIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKL  99850

 Score = 39.3 bits (90),  Expect(2) = 0.003, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 34/63 (54%), Gaps = 2/63 (3%)
 Frame = +2

Query  286     LACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLR  344
               L+  G EL + SD  F + +  P K  VVGA Y+A+E AG L  +G    +  R   +LR
Sbjct  100190  LSLAGKELCIDSDGFFEL-EILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLR  100366

Query  345     GFD  347
                FD
Sbjct  100367  SFD  100375

 Score = 25.4 bits (54),  Expect(2) = 0.003, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +1

Query  268     KEITTRHVVIAVGGRP  283
               KE+  ++V+IAVGG+P
Sbjct  100069  KELLAKNVLIAVGGKP  100116

>PHSO:scaffold_2
Length=11587142

 Score = 116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 137/490 (28%), Positives = 225/490 (46%), Gaps = 67/490 (14%)
 Frame = -3

Query  125      DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
                DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  1302051  DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  1301896

Query  185      QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
                 S+ +     HD  S+G +   V    P     Q++      +K+++   +   +  +V 
Sbjct  1301895  HSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVKTLTGGIESLFKKNKVT  1301731

Query  245      YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSD  298
                Y    G       + +  +  KG + +  ++++IA G       P  +    G++ + S 
Sbjct  1301730  YIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKI-IDST  1301554

Query  299      DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKIGEY  357
                    +K + P   +VVGA  + LE     K +G  V V+  +     G D++   +  + 
Sbjct  1301553  GALSLK-RVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKL  1301377

Query  358      MEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGRDPD  411
                ++ Q G+EF      Q  TK+ + ++   +VK  TE    GD      DTVL ATGR   
Sbjct  1301376  LKKQ-GLEF------QFGTKVTASEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRRAF  1301218

Query  412      VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
                 A LGL++ G++  +K GRI V++  +T  P ++AIGDVI            G +L+ + 
Sbjct  1301217  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIK-----------GAMLAHKA  1301074

Query  471      YNEGTV----------QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
                  EG             ++Y  I   ++T  E+   G +EE+ K E     +E Y+    
Sbjct  1301073  EEEGVACVENIAGKHGHVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKF  1300909

Query  521      PLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYD  579
                P+  +   + R  AES   VKV+ DK + + +LG H +  NAGE+     + ++ G   +
Sbjct  1300908  PMMAN--SRARTVAESDGLVKVLADK-KTDKLLGVHIIASNAGEMIAEGVIGIEYGAASE  1300738

Query  580      QLVDTVGIHP  589
                 L  T   HP
Sbjct  1300737  DLARTCHAHP  1300708

>PHRA:scaffold_109
Length=149230

 Score = 116 bits (291),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 134/480 (28%), Positives = 222/480 (46%), Gaps = 41/480 (9%)
 Frame = +1

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
              AS DYD+VVIGGG GG   + +AA  G K  CV    K         LGGTC+NVGCIP 
Sbjct  67354  ASSDYDVVVIGGGPGGYVAAIKAAQLGFKTACVESRGK---------LGGTCLNVGCIPS  67506

Query  181    KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
              K +  S+ +     HD  S+G +   V    P     Q++      + +++   +   + 
Sbjct  67507  KALLHSTHLLHTAQHDFKSYGIDAPGVTANFP-----QMMKAKEKAVTTLTGGIESLFKK  67671

Query  241    KQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELA  294
               +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++ 
Sbjct  67672  NKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKII  67851

Query  295    VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASK  353
               S+  +   +   P   +VVGA  + LE     K +G  V V+  +     G D++   +
Sbjct  67852  DSTGALALTRV--PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKEAVKE  68025

Query  354    IGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRDP  410
                + ++ Q G++F   T    +T  +    +VK  TE    G+      DTVL ATGR  
Sbjct  68026  FTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGNAATIECDTVLVATGRRA  68193

Query  411    DVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRR  469
                A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G      
Sbjct  68194  FTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVEN  68370

Query  470    LYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQ  529
              +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +   +
Sbjct  68371  IAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMANSRAR  68532

Query  530    TRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              T +A     VKV+ DK + + +LG H +  NAGE+     +A++ G + + +  T   HP
Sbjct  68533  T-VAEADGLVKVLADK-KTDKMLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHP  68706

>PHCA:scaffold_20 PHYCAscaffold_20
Length=899172

 Score = 115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/201 (37%), Positives = 110/201 (55%), Gaps = 14/201 (7%)
 Frame = +1

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
               ++ V+ A GR P    L LD+AGV  +   G I V+  +QT+  NV+A+GD    P LTP
Sbjct  776398  YEVVIYAAGRVPLTTSLQLDKAGVTTDNH-GFIQVDEYQQTSNSNVFAVGDACGTPALTP  776574

Query  458     VAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               VAI AGR LS RL+      ++ Y+ I T VF+    G  GL+E  ++ +YGDD ++VY 
Sbjct  776575  VAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHPPIGTIGLTEAQARCKYGDDEIKVYT  776754

Query  517     KNFVPLEWSLAEQTRIAAES--------CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
                 FV + + L  +  I  E+          +K+VC   ++  V+G H +G  A E+ Q  
Sbjct  776755  SRFVNMYYGLINE--IDEETGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQGF  776925

Query  569     GLAMKLGFTYDQLVDTVGIHP  589
               G+A+K+G T     D + IHP
Sbjct  776926  GVAVKMGATKADFDDCIAIHP  776988

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 21/119 (18%)
 Frame = +1

Query  105     ASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHG  163
               A  LN SRT            YD +VIG GSGG+A ++ AAS+ G +V V++  +     
Sbjct  775378  ARALNASRT--------LETKYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR-----  775518

Query  164     TSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWN---VGSVNGQVPTFDWKQL  219
                   LGGTCVNVGC+PKKLM  ++ +   LHHD   +G+     G   G+   FDW +L
Sbjct  775519  ----LGGTCVNVGCVPKKLMFIAADMSHKLHHDFLHYGFEDEVTGGHLGKRTHFDWPKL  775683

 Score = 45.8 bits (107),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 20/99 (20%)
 Frame = +2

Query  268     KEITTRHVVIAVGGRP------------------RQLACLGGELAVSSDDIFWMKQKEPG  309
               KEI   +V+IAVGG+P                        G EL + SD  F + +  P 
Sbjct  775892  KEILADNVMIAVGGKPLIPDIPGAYLFTTGKLGGTDFVLAGKELCIDSDGFFEL-ETLPK  776068

Query  310     KTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
               K  VVGA Y+A+E AG L  +G    +  R   +LR FD
Sbjct  776069  KVAVVGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFD  776185

>PHIF:NW_003303722.1 Phytophthora infestans T30-4 supercont1.37 
genomic scaffold, whole genome shotgun sequence
Length=1588622

 Score = 114 bits (286),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 134/482 (28%), Positives = 225/482 (47%), Gaps = 45/482 (9%)
 Frame = -2

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
              +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  56233  SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  56078

Query  182    LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
               +  S+ +     HD  S+G +   V    P     Q++ +    +K+++   +   +  
Sbjct  56077  ALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIESLFKKN  55913

Query  242    QVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
              +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++ +
Sbjct  55912  KVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-I  55736

Query  296    SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
               S     +K + P   +VVGA  + LE     K +G  V V+        G D++   + 
Sbjct  55735  DSTGALELK-RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEF  55559

Query  355    GEYMEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEETFDTVLNATGR  408
               + ++ Q G++F      Q  TK+ + ++   +VK  TE    GD      DTVL ATGR
Sbjct  55558  TKLLKKQ-GLDF------QFNTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGR  55400

Query  409    DPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLS  467
                  + LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G    
Sbjct  55399  RAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACV  55223

Query  468    RRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLA  527
                +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+    P+  +  
Sbjct  55222  ENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMANSR  55061

Query  528    EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
               +T IA     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   
Sbjct  55060  ART-IAEADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHA  54887

Query  588    HP  589
              HP
Sbjct  54886  HP  54881

>PHCA:scaffold_51 PHYCAscaffold_51
Length=529628

 Score = 114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 131/479 (27%), Positives = 218/479 (46%), Gaps = 39/479 (8%)
 Frame = +2

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               ++ DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K
Sbjct  380126  STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  380281

Query  182     LMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
                +  S+ +     HD  S+G +   V    P     Q++      + +++   +   +  
Sbjct  380282  ALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVTTLTGGIESLFKKN  380446

Query  242     QVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAV  295
               +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++  
Sbjct  380447  KVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIID  380626

Query  296     SSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMASKI  354
               S+  +   +   P   +VVGA  + LE     K +G  V V+        G D+    + 
Sbjct  380627  STGALSLTRV--PEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEF  380800

Query  355     GEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRDPD  411
                + ++ Q G++F   T    +T  +    +VK  TE    GD      DTVL ATGR   
Sbjct  380801  TKLLKKQ-GLDFKFST---KVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAF  380968

Query  412     VAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRL  470
                A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G      +
Sbjct  380969  TAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENI  381145

Query  471     YNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQT  530
                 +    ++Y  I   ++T  E+   G +EE+ K E     VE Y+    P+  +   +T
Sbjct  381146  AGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GVE-YNVGKFPMMANSRART  381307

Query  531     RIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                +A     VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  381308  -VAEADGLVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  381478

>PHKE:scaffold_531 scf_22126_531.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_531.1:1:20776:1 
REF
Length=20776

 Score = 113 bits (283),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 115/433 (27%), Positives = 201/433 (46%), Gaps = 31/433 (7%)
 Frame = -1

Query  168   LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
             LGGTC+NVGCIP K +  S+ +     HD  S+G +   V    P     Q++      +
Sbjct  4354  LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVKANFP-----QMMKAKEKAV  4190

Query  228   ksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR----  282
             K+++   ++  +  +V Y    G       + +     KG + +  ++++IA G      
Sbjct  4189  KTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPL  4010

Query  283   -PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRS  340
              P  +    G++  S+  +    ++ P   +VVGA  + LE     K +G  V V+  + 
Sbjct  4009  PPVPVDNEAGKIIDSTGALVL--KRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQD  3836

Query  341   ILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEE  397
                 G D++   +  + ++ Q G++F   T    +T  +    +VK  TE    GD    
Sbjct  3835  AACPGMDKECVKEFTKLLKKQ-GLDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASI  3668

Query  398   TFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELT  456
               DTVL ATGR    A LGL++ G++  +K GR+ V++  +T  P ++AIGDVI    L 
Sbjct  3667  ECDTVLVATGRRAYTAGLGLEQMGIQ-TDKLGRVEVDDAFRTQVPGIFAIGDVIKGAMLA  3491

Query  457   PVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYH  516
               A + G      +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+
Sbjct  3490  HKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YN  3329

Query  517   KNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGF  576
                 P+  +   +T +A     VKV+ DK + + +LG H +  NAGE+     +A++ G 
Sbjct  3328  VGKFPMMANSRART-VAEADGLVKVLSDK-KTDKMLGVHIIASNAGEMIAEGVIALEYGA  3155

Query  577   TYDQLVDTVGIHP  589
             + + +  T   HP
Sbjct  3154  SSEDIARTCHAHP  3116

>PHKE:scaffold_13 scf_22126_13.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_13.1_contig_1:1:238434:1 
REF
Length=238434

 Score = 111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 127/474 (27%), Positives = 203/474 (43%), Gaps = 67/474 (14%)
 Frame = +2

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDL+ IG GS   +     A  G K+ V+D  +          GGTC   GC PKK++  
Sbjct  17492  YDLIAIGTGSAASSVISRCAEAGWKIAVIDERE---------FGGTCALRGCDPKKVLAG  17644

Query  186    SSLIGEILHHDCASFGWNV----GSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSK  241
              ++ +            WN       V G   +  W +L++       + S     E + K
Sbjct  17645  AAEL----------IDWNERMKGKGVEGNA-SIRWSELMA--FKRTFTESVPRASEDKFK  17785

Query  242    QVKYENVLG--SFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDD  299
              Q   +   G  SFVD       H + G + +  +H++IA G RP  L   G E  + SDD
Sbjct  17786  QAGMDTFHGKASFVDED-----HIRVGDEILQGKHILIATGARPAPLPIDGAEHLIYSDD  17950

Query  300    IFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDM-------A  351
                 ++Q  P K ++VG  Y+A E A      G  V ++ R    L+ FD ++       +
Sbjct  17951  FLDLEQL-PDKLVLVGGGYIAFEFAHIAARAGTEVHIIHRGEEPLKQFDSELVDLLLKKS  18127

Query  352    SKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPD  411
               ++G ++ + + ++ IR+   Q  T + SG       T +G   +     V++  GR P+
Sbjct  18128  EEVGIHVHLNAEVKAIRQ---QGNTYVVSG-------TRNGADHQWQCGLVVHGAGRIPN  18277

Query  412    VAKLGLDEAGVKLNEKTGRIWVNN--EQTTTPNVYAIGDV--IDAPELTPVAIQAGRLLS  467
              +  L L++  V   +K   I VN   +  +   V+A GDV   +   LTP+A Q  R +S
Sbjct  18278  IEGLELEKGNVSYTKKG--IIVNEYLQSESNSRVFAAGDVSATEGLPLTPLAGQESRAVS  18451

Query  468    RRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLA  527
                L      + +Y  + + VFT    G  GL  E +K+E  +  V    K      W   
Sbjct  18452  LNLLEGNHHKPNYKVMPSIVFTVPSLGSVGLDVEQAKKEGYEVKVNDMSK------WYTY  18613

Query  528    EQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQL  581
              ++T    +    KV+ DK     +LG H LG    E+     +A++   T DQL
Sbjct  18614  KRTN--EKFAMAKVITDKASGR-ILGAHVLGGKTEELINLFAMAIQFDLTTDQL  18766

>PLHA:NW_020187357.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_437, whole genome shotgun sequence
Length=396479

 Score = 108 bits (269),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 140/504 (28%), Positives = 228/504 (45%), Gaps = 46/504 (9%)
 Frame = -1

Query  101     DTASASELNESRTPPIVVED-DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKP  159
               + AS S  +  R   I +    +S +YD+VVIGGG GG   + +AA  G K   ++    
Sbjct  300566  NIASISRRSAIRHHSITLRAFSSSSEYDVVVIGGGPGGYVAAIKAAQLGMKTACIE----  300399

Query  160     SPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQL  219
                   +   LGGTC+NVGCIP K +  S+ +     H+  ++G +   V    P     Q+
Sbjct  300398  ----SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGIDAPEVTANFP-----QM  300246

Query  220     VSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIA  278
               +      +K+++   +   +  +V Y    G       + +  H  KG + +  ++++IA
Sbjct  300245  MKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIA  300066

Query  279     VGGR-----PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYA  333
                G       P  +    G++ V S     +K + P   +VVGA  + LE     K +G  
Sbjct  300065  TGSEVTPLPPVPVDNAAGKI-VDSTGALELK-RIPDHLVVVGAGVIGLELGSVYKRLG--  299898

Query  334     VKVMVRSIL---LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE  390
                KV V   L     G D+       + ++ Q G+EF   T    +T  +    +VK  TE
Sbjct  299897  AKVTVVEYLDDACTGMDKGSVKDFIKLLKKQ-GLEFKFGT---KVTASEINGDVVKLTTE  299730

Query  391     ---DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAI  446
                   GD      DTVL ATGR    A LGL++ G++  +K GRI V+   +T  P ++AI
Sbjct  299729  PSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQ-TDKFGRIEVDEAFRTQVPGIFAI  299553

Query  447     GDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEE  506
               GDVI    L   A + G   +  +  +    ++Y  I   ++T  E+   G +EE+ K E
Sbjct  299552  GDVIKGAMLAHKAEEEGIACAEIIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE  299376

Query  507     YGDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVT  565
                    +E Y+    P+  +   + R   ES   VKV+ DK + + +LG H +  NAGE+ 
Sbjct  299375  ----GIE-YNVGKFPMMAN--SRARTVGESDGMVKVLADK-KTDKLLGVHIIASNAGEMI  299220

Query  566     QAMGLAMKLGFTYDQLVDTVGIHP  589
                   + ++ G   + +  T   HP
Sbjct  299219  SEGVIGIEYGAASEDVARTSHAHP  299148

>SAPA:scaffold_54 supercont2.54 dna:supercontig supercontig:ASM15154v2:supercont2.54:1:242776:1 
REF
Length=242776

 Score = 105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 129/496 (26%), Positives = 217/496 (44%), Gaps = 57/496 (11%)
 Frame = +2

Query  114     PPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTC  172
               P          DYDLVV+GGG GG   + +AA  G K  CV         GT   LGGTC
Sbjct  116558  PKFAAAFSTGSDYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTC  116710

Query  173     VNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisf  232
               +NVGCIP K +  ++       HD  + G  V  +       D+ +L+++    +K ++ 
Sbjct  116711  LNVGCIPSKALLSATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTG  116875

Query  233     kykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLA  287
                 +   +  +V Y    G  V  + + +   + G K ++T++++IA G       P  + 
Sbjct  116876  GIEGLFKKNKVDYIKGFGKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVD  117055

Query  288     CLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFD  347
                  G++  S+  +    ++ P   +V+G   + LE       +G  + V+          
Sbjct  117056  NEAGKIIDSTGALSL--KRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV----------  117199

Query  348     QDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE------------DGDCF  395
                + A KI   M+ ++G EF +K + +       GQ +     E             G+  
Sbjct  117200  -EYADKICPTMDFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEAT  117373

Query  396     EETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDVIDAP  453
                   DTVL ATGR P    LGL+E G++  +K GRI V+  N +T   N++AIGD I+  
Sbjct  117374  TIECDTVLVATGRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGA  117550

Query  454     ELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVE  513
                L   A + G      +   G   ++Y+ I   V+T  E    G +EE+ K      +  
Sbjct  117551  MLAHKAEEEGISCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKA-----ANV  117712

Query  514     VYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMK  573
                Y+    P+  +   +T +     +VK++  K  ++ +LG H +  NAGE+     L ++
Sbjct  117713  AYNVGKFPMMANSRART-VGETDGFVKILAAKD-DDKILGIHIIASNAGEMISEGVLGLE  117886

Query  574     LGFTYDQLVDTVGIHP  589
                G + + +  T   HP
Sbjct  117887  YGASAEDIGRTCHAHP  117934

>SADI:scaffold_19 supercont1.19 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.19:1:748253:1 
REF
Length=748253

 Score = 103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 127/485 (26%), Positives = 215/485 (44%), Gaps = 57/485 (12%)
 Frame = +3

Query  125     DYDLVVIGGGSGGLACSKEAASFG-KKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
               DYDLVV+GGG GG   + +AA  G K  CV         GT   LGGTC+NVGCIP K +
Sbjct  491571  DYDLVVVGGGPGGYVAAIKAAQLGLKTACV------ESRGT---LGGTCLNVGCIPSKAL  491723

Query  184     HQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
                 ++       HD  + G  V  +       D+ +L+++    +K ++   +   +  ++
Sbjct  491724  LSATHKYHAAQHDFKNVGIEVDGLR-----IDFAKLMASKDKSVKILTGGIEGLFKKNKI  491888

Query  244     KYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELAVSSD  298
                Y    G  V  + + +     G K ++T++++IA G       P  +    G++  S+ 
Sbjct  491889  DYIKGFGKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTG  492068

Query  299     DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358
                +    ++ P   +V+G   + LE       +G  + V+           + A KI   M
Sbjct  492069  ALSL--KRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTM  492209

Query  359     EMQSGIEFIRKTVPQSITKLDSGQLLVKWITE------------DGDCFEETFDTVLNAT  406
               + ++G EF +K + +       GQ +     E             G+      DTVL AT
Sbjct  492210  DFETGREF-QKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVAT  492386

Query  407     GRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDVIDAPELTPVAIQAGR  464
               GR P    LGL+E G++  +K GRI V+  N +T   N++AIGD I+   L   A + G 
Sbjct  492387  GRRPFTKGLGLEEMGIQ-TDKFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGI  492563

Query  465     LLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEW  524
                    +   G   ++Y+ I   V+T  E    G +EE+ K      +   Y+    P+  
Sbjct  492564  SCVESIAG-GHGHVNYNAIPGVVYTFPEVASVGKTEEELKA-----AGVAYNVGKFPMMA  492725

Query  525     SLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDT  584
               +   +T +     +VK++  K  ++ +LG H +  NAGE+     L ++ G + + +  T
Sbjct  492726  NSRART-VGETDGFVKILAAKD-DDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRT  492899

Query  585     VGIHP  589
                  HP
Sbjct  492900  CHAHP  492914

>PYAR:scaffold_425 par_scaffold_425 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_425:1:18937:1 
REF
Length=18937

 Score = 102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 123/509 (24%), Positives = 211/509 (41%), Gaps = 79/509 (16%)
 Frame = -1

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDLVVIG G     C+ E+A  GK+V V+D        T  G+GG CV+ G IP K   +
Sbjct  15862  YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  15707

Query  186    SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
              + L +    HH      +++ +V      +  K++V +            K +L++ ++ 
Sbjct  15706  AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDS-------EVDVIKAQLKAARID  15548

Query  245    YENVLGSFVDPHTLKLW-------HPKKGTKEITTRHVVIAVGGRPRQ--LACLGGELAV  295
              Y   L  F + H + +                +     +IA G RP    L  + G++ +
Sbjct  15547  YLPGLARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVIL  15368

Query  296    SSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-----VRSILLRGFDQ  348
               SD I     +E P   +VVGA  + +E A  L  + G++V V+     VR++L     +
Sbjct  15367  DSDQILSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SR  15197

Query  349    DMASK------------------IGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE  390
              DM+ +                  I   ++ +  ++  R  + ++I K++     VK    
Sbjct  15196  DMSLRPQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLT  15017

Query  391    DGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDV  449
               G     + D +L   GR      L L+  G+  N K G + VN   QT  P++YA+GD 
Sbjct  15016  SGKV--TSGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYAVGDC  14846

Query  450    IDAPELTPVAIQAGRLLSRRLYNEG---TVQMDYDKICTAVFTPIEYGCCGLSEEDSKEE  506
              I AP L   +++ GRL +  ++ +    T Q++       ++T  E    G +E+    E
Sbjct  14845  IGAPSLASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE  14666

Query  507    YGDDSVEVYHKNFVPLEWSLAEQTRIAAESC------YVKVVCDKTRNNFVLGFHYLGPN  560
                           V  E  LA+ + +A           +K++ D      V G H +G  
Sbjct  14665  K------------VNYEIGLAKYSELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEG  14525

Query  561    AGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              A E+     +A+ +G +     D V  +P
Sbjct  14524  ATEIIHIGQVAIAMGCSLTYFRDAVFNYP  14438

>PHIF:NW_003303667.1 Phytophthora infestans T30-4 supercont1.92 
genomic scaffold, whole genome shotgun sequence
Length=551618

 Score = 74.3 bits (181),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 123/252 (49%), Gaps = 23/252 (9%)
 Frame = -1

Query  345     GFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQL---LVKWITE---DGDCFEET  398
               G D++   +  + ++ Q G++F      Q  TK+ + ++   +VK  TE    GD     
Sbjct  230744  GSDKEAVKEFTKLLKKQ-GLDF------QFNTKVTASEVNGDVVKLTTEPSKGGDASSIE  230586

Query  399     FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTP  457
                DTVL ATGR    + LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L  
Sbjct  230585  CDTVLVATGRRAFTSGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAH  230409

Query  458     VAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHK  517
                A + G      +  +    ++Y  I   ++T  E+   G +EE+ K E     +E Y+ 
Sbjct  230408  KAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFPEFASVGKTEEELKAE----GIE-YNV  230247

Query  518     NFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFT  577
                  P+  +   +T IA     VKV+ DK + + +LG H +  NAGE+     + ++ G  
Sbjct  230246  GKFPMMANSRART-IAEADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAA  230073

Query  578     YDQLVDTVGIHP  589
                + L  T   HP
Sbjct  230072  SEDLARTCHAHP  230037

 Score = 49.3 bits (116),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 100/217 (46%), Gaps = 21/217 (10%)
 Frame = -3

Query  121     DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180
                +S DYD+VVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP 
Sbjct  231393  SSSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPS  231238

Query  181     KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRS  240
               K +  S+ +     HD  S+G +   V    P     Q++ +    +K+++   ++  + 
Sbjct  231237  KALLHSTHLLHTAQHDFKSYGIDAPEVKANFP-----QMMKSKEKAVKTLTGGIELLFKK  231073

Query  241     KQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGELA  294
                +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++ 
Sbjct  231072  NKVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-  230896

Query  295     VSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMG  331
               + S     +K + P   +VVGA  + LE     K +G
Sbjct  230895  IDSTGALELK-RVPEHLVVVGAGVIGLELGSVYKRLG  230788

>APAS:scaffold_24 supercont1.24 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.24:1:781221:1 
REF
Length=781221

 Score = 101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 124/231 (54%), Gaps = 12/231 (5%)
 Frame = -3

Query  118     VEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGC  177
               V   ++  YD +V+GGGSGG++ ++ AAS+G  V V++  +    G + GLGGTCVNVGC
Sbjct  417919  VRGMSTTSYDYIVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGC  417749

Query  178     IPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVE  237
               +PKK+M+ ++   EILH   A     V  V     +FDW  + +   SY+  +   Y+  
Sbjct  417748  VPKKVMYNAAFHAEILHSAKAYAFKGVQDVG--FGSFDWATMKTKRDSYVARLHGIYERN  417575

Query  238     LRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSS  297
               L    +   +   SFVD HT+ +          T  H+++AVGG P+  +  G E A+SS
Sbjct  417574  LAKDNITLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISS  417410

Query  298     DDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
               D  F + + +P K  V+GA Y+A+E AG    +     V  R   +LR FD
Sbjct  417409  DGFFGL-ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFD  417260

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 10/119 (8%)
 Frame = -1

Query  361     QSGIEFIRKTVPQSITKLDSGQLLVK--WITEDGDCFEET----FDTVLNATGRDPDVAK  414
               +SG++F+  +  QSI K   G L ++    TEDG          FD ++ A GR P  + 
Sbjct  417069  RSGVQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSG  416890

Query  415     LGLDEAGVKLNEKTGRIWVN-NEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY  471
                 ++   +  NEK G I V+  E T+ P VYAIGDV +   ELTPVAI AGR L+ RL+
Sbjct  416889  F-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLF  416719

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 60/113 (53%), Gaps = 5/113 (4%)
 Frame = -3

Query  478     MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS-LAEQTRIAAES  536
               + Y +I T VF+    G  G +E D+  ++G  +V+VY  +FV L +S LA + +     
Sbjct  415819  LHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENK---PK  415649

Query  537     CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 +K++C   +   V+G H  G  A E+ Q  G+A+K+G     L + V IHP
Sbjct  415648  TAMKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHP  415493

>APIN:scaffold_4 supercont1.4 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.4:1:2763071:1 
REF
Length=2763071

 Score = 100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 119/441 (27%), Positives = 194/441 (44%), Gaps = 47/441 (11%)
 Frame = +2

Query  168    LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
              LGGTC+NVGCIP K +   + +     HD  S G  V +V     + D+ QL+ +    +
Sbjct  44333  LGGTCLNVGCIPSKALLHGTHLYHAAQHDFKSVGIKVDNV-----SIDFNQLMKSKEKTV  44497

Query  228    ksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----  282
              K ++   +   +  +V Y    G  V    L +     G + + T++++IA G       
Sbjct  44498  KILTGGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLP  44677

Query  283    PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSIL  342
              P  +   GG++ V S     +K + P   +VVG   + LE       +G  + V+     
Sbjct  44678  PVPVDNEGGKI-VDSTGALSLK-RIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  44836

Query  343    LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSIT----------KLDSGQL-LVKWITED  391
                    + A KI   M+ +   EF +    Q +T          K+D   + L       
Sbjct  44837  ------EYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAG  44998

Query  392    GDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIGDV  449
              GD      D VL ATGR P  A LGL++ G++  ++ GRI VN  N QT    +YAIGDV
Sbjct  44999  GDATTIEADCVLVATGRRPYTAGLGLEDMGIQ-TDRFGRIKVNLSNFQTNVDGIYAIGDV  45175

Query  450    IDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGD  509
              I+   L   A + G  +   +  +    ++YD I   ++T  E    G +EE+ K     
Sbjct  45176  IEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELKA----  45340

Query  510    DSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAM  568
               +   Y+    P+  +   + R   E+  +VKV+  K  ++ +LG H +  NAGE+    
Sbjct  45341  -ANVAYNVGKFPMMAN--SRARAVGETDGFVKVLAAKD-DDKILGIHIIASNAGEMISEG  45508

Query  569    GLAMKLGFTYDQLVDTVGIHP  589
               L ++ G + + +  T   HP
Sbjct  45509  VLGIEYGASAEDIGRTCHAHP  45571

>SAPA:scaffold_473 supercont2.473 dna:supercontig supercontig:ASM15154v2:supercont2.473:1:8349:1 
REF
Length=8349

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 97/184 (53%), Gaps = 5/184 (3%)
 Frame = +3

Query  408   RDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLL  466
             R P    LGL+   + L+          E T+ PNV+A+GDV     ELTPVAI AGR L
Sbjct  3111  RTPRTNDLGLETTDIALSADKFIQVDAQENTSVPNVHAVGDVTTTGWELTPVAIAAGRRL  3290

Query  467   SRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWS  525
             + RL+ NE    ++Y +I T VF+    G  GL+E  +  +YG  +V+VY  +F  + ++
Sbjct  3291  ADRLFGNEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVKVYTSSFFNMFYA  3470

Query  526   LAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTV  585
             ++EQ     +   +K++C       V+G H  G  A E+ Q  G+A+K+G       + V
Sbjct  3471  MSEQDD--KQKTAMKLICIGEEET-VIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIV  3641

Query  586   GIHP  589
              IHP
Sbjct  3642  AIHP  3653

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 57/118 (48%), Gaps = 3/118 (3%)
 Frame = -3

Query  472   NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTR  531
             NE    ++Y +I T VF+    G  GL+E  +  +YG  +V  +  +F  + +++  +  
Sbjct  1741  NEPNACINYHQIPTVVFSHPPIGTIGLTEPQAIAQYGAHNVTTHTSSFSNMFYAMCPEKE  1562

Query  532   IAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 +  +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  1561  KVQTA--MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  1397

>PYVX:scaffold_675 pve_scaffold_675 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_675:1:16155:1 
REF
Length=16155

 Score = 59.7 bits (143),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  399    FDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNN-EQTTTPNVYAIGDVIDAPELTP  457
              F++V+ A GR P    LGLD AGV  +E+ G I V+  +QTT P++ A+GD      LTP
Sbjct  10554  FESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTP  10730

Query  458    VAIQAGRLLS  467
              VAI AGR L+
Sbjct  10731  VAIAAGRRLA  10760

 Score = 59.3 bits (142),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 13/125 (10%)
 Frame = +1

Query  477    QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
              ++ Y+ + T VF+    G  GL+E+ ++ ++GD+ +++Y   FV + + +  +   A   
Sbjct  10798  KISYENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFVNMYYGVVNEVDSATGE  10977

Query  537    C------------YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDT  584
                             K+VC       V G H +G  A E+ Q  G+A+K+G T   L   
Sbjct  10978  AKPKPXXXXXXXXXXKLVCAGPDEKIV-GLHVIGMGADEMLQGFGVAVKMGATKADLDSC  11154

Query  585    VGIHP  589
              V IHP
Sbjct  11155  VAIHP  11169

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 14/117 (12%)
 Frame = +2

Query  108   LNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASF-GKKVCVLDYVKPSPHGTSW  166
             L   R  P+      + ++DL+VIG GSGG+A S+ AAS+   +V V++  +        
Sbjct  9515  LALPRGLPLARALSTAREFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR--------  9670

Query  167   GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGW----NVGSVNGQVPTFDWKQL  219
              LGGTCVNVGC+PKK+M+  + +   LH D   +G+    + G   G    FDW++L
Sbjct  9671  -LGGTCVNVGCVPKKIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKL  9838

 Score = 42.7 bits (99),  Expect(2) = 0.004, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 35/64 (55%), Gaps = 2/64 (3%)
 Frame = +1

Query  285    QLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSI-LL  343
               +A  G EL + SD  F ++Q  P K  VVGA Y+A+E AG L  +G    +  R   +L
Sbjct  10144  SVAATGKELCIDSDGFFELEQL-PRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVL  10320

Query  344    RGFD  347
              R FD
Sbjct  10321  RSFD  10332

 Score = 21.9 bits (45),  Expect(2) = 0.004, Method: Compositional matrix adjust.
 Identities = 7/15 (47%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = +2

Query  269    EITTRHVVIAVGGRP  283
              E+  + V++AVGG+P
Sbjct  10031  EVRAKKVLLAVGGKP  10075

>APAS:scaffold_88 supercont1.88 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.88:1:223208:1 
REF
Length=223208

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 119/443 (27%), Positives = 194/443 (44%), Gaps = 51/443 (12%)
 Frame = -3

Query  168    LGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyi  227
              LGGTC+NVGCIP K +   + +     H+  S G  V +V     + D+ QL+ +    +
Sbjct  46416  LGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSVGIKVDNV-----SIDFDQLMKSKDKTV  46252

Query  228    ksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR-----  282
              K ++   +   +  +V Y    G  V    + +     G + + T++++IA G       
Sbjct  46251  KILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLP  46072

Query  283    PRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSIL  342
              P  +   GG++ + S     +K + P   +VVG   + LE       +G  + V+     
Sbjct  46071  PVPVDNEGGKI-IDSTGALALK-RVPKHLVVVGGGVIGLEMGSVYGRLGSKITVV-----  45913

Query  343    LRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETF---  399
                    + A KI   M+ +   EF +    Q +T    GQ  V     DGD    T    
Sbjct  45912  ------EYADKICPTMDHEVTKEFQKLLTKQGMT-FKLGQ-KVTASKVDGDVVTLTVEPA  45757

Query  400    ----------DTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVN--NEQTTTPNVYAIG  447
                        D VL ATGR P  A LGL+E G++  +K GRI VN  N QT    ++AIG
Sbjct  45756  AGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQ-TDKFGRIKVNLSNFQTNVDGIFAIG  45580

Query  448    DVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEY  507
              DVI+   L   A + G  +   +  +    ++YD I   ++T  E    G +EE+ K   
Sbjct  45579  DVIEGAMLAHKAEEEGIAVVETIAGKHG-HVNYDAIPGVIYTFPEVASVGKTEEELK---  45412

Query  508    GDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQ  566
                 +   Y+    P+  +   + R   E+  +VKV+  K  ++ +LG H +  NAGE+  
Sbjct  45411  --TANVAYNVGKFPMMAN--SRARAVGETDGFVKVLAAKD-DDKILGIHIIASNAGEMIS  45247

Query  567    AMGLAMKLGFTYDQLVDTVGIHP  589
                 L ++ G + + +  T   HP
Sbjct  45246  EGVLGIEYGASAEDIGRTCHAHP  45178

>PYIW:scaffold_3308 piw_scaffold_3308 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_3308:1:3352:1 
REF
Length=3352

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 93/187 (50%), Gaps = 5/187 (3%)
 Frame = +2

Query  405  ATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDV-IDAPELTPVAIQAG  463
            A GR+P    LGL+  GVKLN+    +    E T+   +YAIGD  I   ELTPVAI AG
Sbjct  2    AIGREPLTKDLGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAG  181

Query  464  RLLSRRLY-NEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPL  522
            R L+ RL+  E    + Y +I T VF+    G  G +E  + E++G  +V+ Y   FV L
Sbjct  182  RRLADRLFGGEPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNL  361

Query  523  EWSLAEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLV  582
              ++A+          +K+V        V   H  G  A E+ Q  G+AMK+  T     
Sbjct  362  LHAMADPDHKG--KTAMKLVTVGEDEVVVG-VHVAGEGADEMIQGFGVAMKMNATKADFD  532

Query  583  DTVGIHP  589
            + V IHP
Sbjct  533  NIVAIHP  553

>APAS:scaffold_96 supercont1.96 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.96:1:223693:1 
REF
Length=223693

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 73/228 (32%), Positives = 119/228 (52%), Gaps = 14/228 (6%)
 Frame = -3

Query  141     SKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASF  200
               +  A  +G KV V++  +   +G + G+GGTCVNVGC+PKK+M+ +    EIL H    +
Sbjct  203267  ASRAVEYGAKVLVIE--RGRANGGA-GMGGTCVNVGCVPKKIMYNAGFHAEIL-HSAKDY  203100

Query  201     GWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKL  260
                +    VN +  +FDW  + +   +Y+  ++  Y+  L  + + +     +FVD HT+++
Sbjct  203099  SFK-EVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV  202923

Query  261     WHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVA  320
                    G +  T  H++IAVGG P+     G E A+SSD  F +   +P K  VVGA Y+A
Sbjct  202922  ----NGLR-FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPT-QPKKVAVVGAGYIA  202761

Query  321     LECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIGEYMEMQSGIEFI  367
               +E AG    +     V  R   +LR FD  +   + +  EM   ++F 
Sbjct  202760  VELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVND--EMAKYVDFF  202623

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = -3

Query  357     YMEM-QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKL  415
               Y+ M +SG+ F+ ++  QSI K   G L +     D       F+ +++A GR P    +
Sbjct  202109  YLYMSRSGVTFVTQSHLQSIRKEADGTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDV  201930

Query  416     GLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGD-VIDAPELTPVAIQAGRLLSRRLY  471
               GLD+  V+L+     +    E TT P VYAIGD  I   ELTPVAI AGR L+ RL+
Sbjct  201929  GLDKTTVELSTDGFVVVDAQENTTVPGVYAIGDATITGWELTPVAIAAGRRLADRLF  201759

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 2/112 (2%)
 Frame = -3

Query  478     MDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESC  537
               + Y +I T +F+    G  GL+E ++  +YG  +V  Y  +F  L +SL +      ++ 
Sbjct  201362  IHYHQIPTVIFSHPPIGTIGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA  201183

Query  538     YVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                +K+VC       V+G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  201182  -MKLVCIGVEET-VVGAHVAGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHP  201033

>SAPA:scaffold_11 supercont2.11 dna:supercontig supercontig:ASM15154v2:supercont2.11:1:752600:1 
REF
Length=752600

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 87/157 (55%), Gaps = 7/157 (4%)
 Frame = -2

Query  436     EQTTTPNVYAIGDVIDAP-ELTPVAIQAGRLLSRRLY-NEGTVQMDYDKICTAVFTPIEY  493
               E TT PNVYAIGDV     ELTPVAI AGR L+ RL+ NE    ++Y +I T VF+    
Sbjct  400513  ENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIPTVVFSHPPI  400334

Query  494     GCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL-AEQTRIAAESCYVKVVCDKTRNNFVL  552
               G  GL+E  +  +YG  +V  +  +F  + +++ AE+ ++      +K+VC       V+
Sbjct  400333  GTIGLTEPQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKV---HTAMKLVCIGVEET-VV  400166

Query  553     GFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               G H  G  A E+ Q  G+A+K+G       + V IHP
Sbjct  400165  GVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  400055

>PHPA:scaffold_31 NW_008649017.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.31, whole genome shotgun 
sequence
Length=700024

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 109/422 (26%), Positives = 189/422 (45%), Gaps = 34/422 (8%)
 Frame = -3

Query  180     KKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELR  239
               K L+H + L+     HD  S+G +   V    P     Q++      +K+++   +   +
Sbjct  248426  KALLHSTHLL-HTAQHDFKSYGIDAPEVKANFP-----QMMKAKEKAVKTLTGGIESLFK  248265

Query  240     SKQVKYENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGR-----PRQLACLGGEL  293
                 +V Y    G       + +  +  KG + +  ++++IA G       P  +    G++
Sbjct  248264  KNKVTYIKGHGKISAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI  248085

Query  294     AVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM-VRSILLRGFDQDMAS  352
                + S     +K + P   +VVGA  + LE     K +G  V V+        G D++   
Sbjct  248084  -IDSTGALELK-RVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVK  247911

Query  353     KIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITE---DGDCFEETFDTVLNATGRD  409
               +  + ++ Q G++F   T    +T  +    +VK  TE    GD      DTVL ATGR 
Sbjct  247910  EFTKLLKKQ-GLDFKFGT---KVTSSEVNGDVVKLTTEPSKGGDASTIECDTVLVATGRR  247743

Query  410     PDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSR  468
                  A LGL++ G++  +K GRI V++  +T  P ++AIGDVI    L   A + G     
Sbjct  247742  AFTAGLGLEQMGIQ-TDKLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVE  247566

Query  469     RLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE  528
                +  +    ++Y  +   ++T  E+   G +EE+ K E     +E Y+    P+  +   
Sbjct  247565  NIAGKHG-HVNYGAVPGVIYTFPEFASVGKTEEELKAE----GIE-YNVGKFPMMAN--S  247410

Query  529     QTRIAAES-CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGI  587
               + R  AES   VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   
Sbjct  247409  RARTVAESDGLVKVLADK-KTDKLLGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHA  247233

Query  588     HP  589
               HP
Sbjct  247232  HP  247227

>PYAR:scaffold_1175 par_scaffold_1175 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_1175:1:9874:1 
REF
Length=9874

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 135/290 (47%), Gaps = 18/290 (6%)
 Frame = -2

Query  305   QKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRS-ILLRGFDQDMASKIGEYMEMQSG  363
             +K P   +V+G   + LE     K +G  V V+  +  +  G D ++  +  + ++ Q G
Sbjct  4002  KKAPEHLVVIGGGVIGLELGSVYKRLGSKVTVVEYADRVCPGLDLELGKEFAKLLKKQ-G  3826

Query  364   IEFIRKT-VPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGV  422
             ++   KT V  S    D   L V+     G+      DTVL ATGR P    LGL++ G+
Sbjct  3825  LDLQFKTKVTASQVNGDKVTLTVEP-AAGGEATTIEADTVLVATGRRPFTNGLGLEQMGI  3649

Query  423   KLNEKTGRIWVNNE-QTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYN-EGTVQMDY  480
             +  +K GRI V+   +T  P++YAIGDVI  P L   A + G      +    G V  +Y
Sbjct  3648  Q-TDKMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAGLHGHV--NY  3478

Query  481   DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES-CYV  539
             + I   ++T  E    G +EE  KEE        Y+    P+  +   + R   E   +V
Sbjct  3477  NAIPGVIYTHPEVASVGKTEEQLKEEG-----IAYNVGKFPMMAN--SRARAVGEGDGFV  3319

Query  540   KVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
             KV+ DKT +  +LG H +  NAGE+     L ++ G   + +  T   HP
Sbjct  3318  KVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHP  3172

 Score = 41.6 bits (96),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 8/83 (10%)
 Frame = -3

Query  125   DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
             +YDLVV+GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  4562  EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  4407

Query  185   QSSLIGEILHHDCASFGWNVGSV  207
              S+ +     HD   +G  V  V
Sbjct  4406  HSTHLFHTAQHDFKKYGIEVSDV  4338

>PYAP:scaffold_255 pag1_scaffold_255 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_255:1:39624:1 
REF
Length=39624

 Score = 74.3 bits (181),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 150/337 (45%), Gaps = 40/337 (12%)
 Frame = -1

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDLVVIG G     C+ E+A  GK+V V+D       G+S  +GG CV+ G IP K   +
Sbjct  35358  YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  35203

Query  186    SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
              + L +    HH      +++ +V      +  K++V +            K +L++ +V 
Sbjct  35202  AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDS-------EVDVIKAQLKAARVD  35044

Query  245    YENVLGSFVDPHTLKLWHPKKGTK-------EITTR----HVVIAVGGRPRQ--LACLGG  291
              Y      F + H + +      T         + TR      +IA G RP    L  + G
Sbjct  35043  YIPGFARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDG  34864

Query  292    ELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGFDQ  348
              ++   SD I     +E P   +VVGA  + +E A  L  + G++V V+  R  +L   D 
Sbjct  34863  KVVFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDN  34684

Query  349    DMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGR  408
              ++ S +   M ++ G  F+   + +SI K++     VK +   G     + D +L   GR
Sbjct  34683  EVVSMLQHEMRVK-GARFL---LGESIQKVEKTAKGVKVLLNSGKV--TSADALLYTVGR  34522

Query  409    DPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVY  444
                +   L ++  G+  N++ G + VN   QT   ++Y
Sbjct  34521  QANTDGLNIEAVGLSRNQR-GLLNVNKSYQTDKAHMY  34414

 Score = 32.0 bits (71),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/151 (23%), Positives = 65/151 (43%), Gaps = 12/151 (8%)
 Frame = -2

Query  444    YAIGDVIDAPELTPVAIQAGRLLSRRLYNE----GTVQMDYDKICTAVFTPIEYGCCGLS  499
              YA+GD I AP L   +++ GRL +  +++      T Q++       ++T  E    G +
Sbjct  34346  YAVGDCIGAPALASTSMEQGRLAACHMWDGNCDIATSQLENGNYPYGIYTIPEISMVGKT  34167

Query  500    EEDSKEEYGDDSVEVYHKNFVPLEWSLAE-QTRIAAESCYVKVVCDKTRNNFVLGFHYLG  558
              E+    E      +V ++  +     LA+ Q    + +  +K++ D        G H +G
Sbjct  34166  EQQLTAE------KVNYEIGIAKYSELAKGQMGGGSHNGILKILFDPDTLKL-HGVHAIG  34008

Query  559    PNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                A E+     +A+ +G +     D V  +P
Sbjct  34007  EGATEIIHIGQVAIAMGCSLTYFRDAVFNYP  33915

>HYAP:scaffold_73 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_73:1:324626:1 
REF
Length=324626

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 56/219 (26%), Positives = 101/219 (46%), Gaps = 21/219 (10%)
 Frame = -3

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               DYDLVVIGGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  161544  DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  161389

Query  185     QSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
                S+ +     H+  S+G +  +V     T ++ Q++      +++++   +      +V 
Sbjct  161388  HSTHLLHTAQHEFKSYGIDAPNV-----TANFPQMMKAKEKAVRTLTAGIESLFSKNKVT  161224

Query  245     YENVLGSFVDPHTLKL-WHPKKGTKEITTRHVVIAVGGRPRQLACL-----GGELAVSSD  298
               Y   +G       + +    ++G   +T +++++A G     L  +      G++  S+ 
Sbjct  161223  YIKGVGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKIVDSTG  161044

Query  299     DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVM  337
                +     + P   +VVGA  + LE     K +G  V V+
Sbjct  161043  ALAL--TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  160933

 Score = 40.4 bits (93),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (48%), Gaps = 7/113 (6%)
 Frame = -2

Query  477     QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
                ++Y  I   ++T  E+   G +EE+ K E     VE Y+    P+  +   +T +A   
Sbjct  160126  HVNYGAIPNVIYTFPEFASVGKTEEELKAE----GVE-YNVGKFPMMANSRART-VAEAD  159965

Query  537     CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
                 VKV+ DK + + +LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  159964  GMVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  159809

>SADI:scaffold_47 supercont1.47 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.47:1:482683:1 
REF
Length=482683

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 21/116 (18%)
 Frame = +2

Query  106     SELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTS  165
               +  N   TPP  ++      YDLVV+GGGSGG+A ++ AA++GKKV V++  +       
Sbjct  262079  THCNLRPTPPRTMQRV----YDLVVMGGGSGGIASARRAATYGKKVLVVERGR-------  262225

Query  166     WGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVP--TFDWKQL  219
                 LGGTCVNVGC+PKK+M+ ++ +   + HD  ++G+        VP  T DW  L
Sbjct  262226  --LGGTCVNVGCVPKKVMYAAADLAHSMRHDAPAYGFPA------VPNTTVDWATL  262369

 Score = 32.3 bits (72),  Expect(2) = 0.21, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 1/41 (2%)
 Frame = +3

Query  313     VVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFDQDMAS  352
               VVGA Y+A+E AG L+G+G    +  R   +LR FD    S
Sbjct  262782  VVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDVRRCS  262904

 Score = 25.8 bits (55),  Expect(2) = 0.21, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (58%), Gaps = 1/40 (3%)
 Frame = +1

Query  274     HVVIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLV  313
               +V++AVGG+P      G E  +SSD  F + ++ P +  V
Sbjct  262621  NVLVAVGGQPVMPDIPGIEHCISSDGFFELDER-PARVAV  262737

>SAPA:scaffold_72 supercont2.72 dna:supercontig supercontig:ASM15154v2:supercont2.72:1:180208:1 
REF
Length=180208

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 61/96 (64%), Gaps = 17/96 (18%)
 Frame = +3

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDLVV+GGGSGG+A ++ AA++GKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  87396  YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  87548

Query  186    SSLIGEILHHDCASFGWNVGSVNGQVP--TFDWKQL  219
              ++ +   + HD  ++G+        VP  T DW  L
Sbjct  87549  AADLAHSMRHDAPAYGFPA------VPNTTVDWATL  87638

 Score = 33.1 bits (74),  Expect(2) = 0.56, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 1/38 (3%)
 Frame = +3

Query  311    TLVVGASYVALECAGFLKGMGYAVKVMVRSI-LLRGFD  347
              T VVGA Y+A+E AG L+G+G    +  R   +LR FD
Sbjct  88059  T*VVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD  88172

 Score = 23.9 bits (50),  Expect(2) = 0.56, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (3%)
 Frame = +1

Query  276    VIAVGGRPRQLACLGGELAVSSDDIFWMKQKEPGKTLV  313
              ++AVGG+P      G E  +SSD  F + ++ P +  V
Sbjct  87901  LVAVGGQPVMPDIPGIEHCISSDGFFELDER-PARVAV  88011

>PHRA:scaffold_5
Length=827719

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 91/371 (25%), Positives = 153/371 (41%), Gaps = 65/371 (18%)
 Frame = -3

Query  270     ITTRHVVIAVGGRPRQLACL--GGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGF  326
               +T    ++ VG RP +   +   GE    SD + W K K  P + +VVGA  V +E A  
Sbjct  354020  LTADKFLVCVGTRPARHPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASM  353841

Query  327     LKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLL  384
               +  + G  V V+  R  +L   D++++  +  Y   Q+G  F+ +   +S+ K D+G++ 
Sbjct  353840  MTIIPGTDVTVIDGRKEILNMADKEVSEGLC-YSMAQTGTRFLTEETIKSVEKADNGEIF  353664

Query  385     VKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNV  443
               V    E G       D +L   GR  +V  L L+  G+   +K GRI V NN QT  P++
Sbjct  353663  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLA-PDKRGRIKVDNNFQTAAPHM  353499

Query  444     Y------------------------AIGDVIDAPELTPVAIQAGRL----------LSRR  469
               Y                        A GD+I  P L   +++ GRL          L+ +
Sbjct  353498  YVMVLSEQQVKR*TETHVFVFLGSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNNQ  353319

Query  470     LYNEGTVQMDYDKICT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNF  519
               + ++     D D++ T           ++T  E    G +E+   +E      EV    +
Sbjct  353318  VLSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE--QTPYEVGMARY  353145

Query  520     VPLEWSLAEQTRIAAESCYVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTY  578
                     LA    +     ++K++ C  T    +LG H +G  A E+     + M  G   
Sbjct  353144  ----EELARGQMLGGVPGFLKIIFCPDTLK--ILGVHAIGEGATEIIHIGQVVMSTGGNL  352983

Query  579     DQLVDTVGIHP  589
               +   + V  +P
Sbjct  352982  EYFRNAVFNYP  352950

 Score = 45.1 bits (105),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = -1

Query  119     EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
               E  AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +
Sbjct  354622  ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRD--------MLGGVCVHTGTV  354467

Query  179     PKKL  182
               P K+
Sbjct  354466  PSKV  354455

>PHPA:scaffold_1 NW_008634126.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.1, whole genome shotgun 
sequence
Length=4724858

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 91/370 (25%), Positives = 148/370 (40%), Gaps = 64/370 (17%)
 Frame = -1

Query  270      ITTRHVVIAVGGRP--RQLACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGF  326
                +T    ++ VG RP  R      GE    SD++ W K K  P + ++VGA  V +E A  
Sbjct  3435242  LTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASM  3435063

Query  327      LKGM-GYAVKVM-VRSILLRGFDQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLL  384
                +  + G  V V+  R  +L   D+ ++  +  Y   Q+G  F+     +S+ K   G++ 
Sbjct  3435062  MTIIPGTDVTVIDGRQEILNMADKQVSEALC-YSMTQTGTRFLTGETIKSVEKSPKGEVF  3434886

Query  385      VKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWV-NNEQTTTPNV  443
                V    E G       D +L   GR  +V  L L+  G+   +K GRI V NN QT  P++
Sbjct  3434885  VHL--ESGKTV--VGDGLLYTVGRQGNVEGLNLEAVGLS-PDKRGRIKVDNNFQTAVPHM  3434721

Query  444      Y-----------------------AIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQ---  477
                Y                       A GD+I  P L   +++ GRL S  +     +    
Sbjct  3434720  YVRVMAYTG*HNIRT*PVRLFCSYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLE  3434541

Query  478      -------MDYDKICT----------AVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFV  520
                        D D++ T           ++T  E    G +E+   +E      +V ++  V
Sbjct  3434540  LSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE------QVPYEVGV  3434379

Query  521      PLEWSLAEQTRIAAESCYVKVV-CDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYD  579
                     LA    +     ++K++ C  T   F  G H +G  A E+     + M  G T +
Sbjct  3434378  ARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGGTLE  3434205

Query  580      QLVDTVGIHP  589
                   + V  +P
Sbjct  3434204  YFRNAVFNYP  3434175

 Score = 46.2 bits (108),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = -2

Query  119      EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
                E  AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +
Sbjct  3435844  ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRD--------MLGGVCVHTGTV  3435689

Query  179      PKKL  182
                P K+
Sbjct  3435688  PSKV  3435677

>ALLA:FR824069 dna:supercontig supercontig:ENA1:FR824069:1:177300:1 
REF
Length=177300

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 164/395 (42%), Gaps = 48/395 (12%)
 Frame = +2

Query  237    ELRSKQVKYENVLGSFVDPHTLKLWHP-----KKGTKEITTRHVVIAVGGRPRQLACL--  289
              + +S ++ Y +    F D H + +        +K TK +     ++A G RP     +  
Sbjct  94907  QFKSARIDYISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPI  95086

Query  290    GGELAVSSDDIF-WMKQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM-VRSILLRGF  346
               G++   SD I  W  ++ P   +VVGA  + +E A  L  + G++V V+  R  +L   
Sbjct  95087  DGKVIFDSDQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFC  95266

Query  347    DQDMASKIGEYMEMQSG-------IEFIRKTVPQSITKLD----SGQLLVKWITEDGDCF  395
              D ++ S +   M            IE +   V Q  ++L          V    + G   
Sbjct  95267  DDEIISTLTHEMRNHGARFLLGEIIESVEVGVHQYFSRLHIS**KSSRGVSVGLKSGKKV  95446

Query  396    EETFDTVLNATGRDPDVAKLGLDEAGVKLNEKTGRIWVNNE-QTTTPNVY----------  444
                  D +L   GR  +   L L+ AG+  N + G + VN + QT  P+++          
Sbjct  95447  HG--DALLYVVGRQANTDGLNLEAAGLSRNPR-GLLSVNTKYQTKKPHMFVFISFFDSST  95617

Query  445    ------AIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFT-PIEYGCCG  497
                    A+GD I AP L   +++ GRL S  ++NE   + + D I + + T    YG   
Sbjct  95618  NANFSFAVGDCIGAPSLASTSMEQGRLASCYMWNEN--EANDDSIPSQLTTGNFPYGIYT  95791

Query  498    LSEED--SKEEYGDDSVEVYHKNFVPLEWSLAE-QTRIAAESCYVKVVCDKTRNNFVLGF  554
              + E     K E    S+++ ++  V     LA+ Q   A+    +K++ D      + G 
Sbjct  95792  IPEISMVGKTEKELTSLKMNYEIGVAKYSELAKGQMSGASADGMLKILFDPISLK-LYGV  95968

Query  555    HYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              H +G  A E+     +A+ +G T     D V  +P
Sbjct  95969  HAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYP  96073

 Score = 45.8 bits (107),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 42/87 (48%), Gaps = 9/87 (10%)
 Frame = +1

Query  115    PIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVN  174
              P+     +   YDL+VIG G     C+ +AA  GK V ++D  K S       +GG CV+
Sbjct  94525  PLKWNSSSIISYDLIVIGSGPSASNCALDAAKRGKHVAIID--KKS------SVGGVCVH  94680

Query  175    VGCIPKKLMHQSSL-IGEILHHDCASF  200
               G IP K   ++ L +    HH   SF
Sbjct  94681  TGTIPSKTFREAVLHLSGYRHHGYISF  94761

>PHIF:NW_003303668.1 Phytophthora infestans T30-4 supercont1.91 
genomic scaffold, whole genome shotgun sequence
Length=525183

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 99/232 (43%), Gaps = 35/232 (15%)
 Frame = +2

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  92588  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  92743

Query  186    SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
              + L +    HH      +++ +V  +   +  +++VS+            + +L++ +V 
Sbjct  92744  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARVD  92902

Query  245    YENVLGSFVDPHTLKLWH---PKKGTKEITTRHVV------------IAVGGRPRQ--LA  287
                     F + H + +      KK    +T R  V            IA G RP    L 
Sbjct  92903  VVPGFARFENEHEISIVRDEDDKKKNSSVTGRSNVDSLSRIKADKFLIACGTRPAHNPLI  93082

Query  288    CLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               + G++ + SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  93083  PIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVV  93238

>PYIW:scaffold_2918 piw_scaffold_2918 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_2918:1:3973:1 
REF
Length=3973

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 96/184 (52%), Gaps = 11/184 (6%)
 Frame = +3

Query  100   DDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKP  159
             +D  ++S  N+    P +  D     YD + IGGGSGG+A ++ AA+FG KV V++  + 
Sbjct  2892  NDLQASSPSNKQHHSPTMSADTV---YDYISIGGGSGGMASARRAATFGAKVLVVE--RG  3056

Query  160   SPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQL  219
               +G + GLGGTCV+ GC+PKK+M  ++   E L+          G+   Q   FDW  +
Sbjct  3057  RKYGGA-GLGGTCVHYGCVPKKIMFNAATHVEHLNRAADYSITTNGAHKYQFGDFDWANM  3233

Query  220   VSNVssyiksisfkykVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAV  279
              +   +YI  ++  Y+  L + QV     +   V  + +++          T +H+++AV
Sbjct  3234  KTKRDAYILRLNGIYERNLGNAQVDLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAV  3398

Query  280   GGRP  283
             GG+P
Sbjct  3399  GGKP  3410

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 54/113 (48%), Gaps = 2/113 (2%)
 Frame = +3

Query  299   DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVR-SILLRGFDQDMASKIGEY  357
             D F+  + +P K  VVGA Y+A+E AG    +     +  R   +LR FD  +   I E 
Sbjct  3636  DGFFKLEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEE  3815

Query  358   MEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDP  410
              E ++GI F+R +  + I K   G L +       +     FD VL A GR+P
Sbjct  3816  GE-KAGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFDQVLYAIGREP  3971

>PHRA:scaffold_32
Length=498572

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 99/231 (43%), Gaps = 34/231 (15%)
 Frame = +1

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  210832  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  210987

Query  186     SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
               + L +    HH      +++ +V  +   +  +++VS+            + +L++ +V 
Sbjct  210988  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARVD  211146

Query  245     YENVLGSFVDPHTLKLWH-----PKKGTKEITTR---------HVVIAVGGRPRQ--LAC  288
                      F   H + +        KKG    +T            +IA G RP    L  
Sbjct  211147  VVPGFARFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVP  211326

Query  289     LGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               + G++ + SD I      + P   +VVGA  + +E A  +  + G++V V+
Sbjct  211327  IDGQVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV  211479

>PLHA:NW_020187364.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_444, whole genome shotgun sequence
Length=1242542

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 101/231 (44%), Gaps = 33/231 (14%)
 Frame = +3

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               +YDL+VIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   
Sbjct  456369  NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  456524

Query  185     QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
               ++ L +    HH      +++ +V  +   +  +++VS+            + +L++ +V
Sbjct  456525  EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARV  456683

Query  244     KYENVLGSFVDPHTLKLWH--PKKGTKEITTRHV-----------VIAVGGRPRQ--LAC  288
                       F + H + +      +  KEI+   V           +IA G RP    L  
Sbjct  456684  DVIPGFARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIP  456863

Query  289     LGGELAVSSDDIFWMKQK-EPGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               + G++ + SD I        P   +V+GA  + +E A  +  + G++V V+
Sbjct  456864  IDGKVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  457016

>PHPA:scaffold_17 NW_008649003.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.17, whole genome shotgun 
sequence
Length=1143538

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/234 (24%), Positives = 97/234 (41%), Gaps = 37/234 (16%)
 Frame = -1

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  318436  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  318281

Query  186     SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
               + L +    HH      +++ +V  +   +  +++VS+            + +L++ +V 
Sbjct  318280  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------EEDVVRAQLKAARVD  318122

Query  245     YENVLGSFVDPHTLKLWHPKKGTKE-----------------ITTRHVVIAVGGRPRQ--  285
                      F + H + +       K+                 I     +IA G RP    
Sbjct  318121  VVPGFARFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNP  317942

Query  286     LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               L  + G++ + SD I      + P   +V+GA  + +E A  +  + G+ V V+
Sbjct  317941  LIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVV  317780

>PHSO:scaffold_7
Length=4006126

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 96/231 (42%), Gaps = 34/231 (15%)
 Frame = +2

Query  126     YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               YDLVVIG G     C+ E+A  GKKV ++D            LGG CV+ G IP K   +
Sbjct  963470  YDLVVIGSGPSATQCALESAKRGKKVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  963625

Query  186     SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
               + L +    HH      +++ +V  +   +  +++V +            + +L++ +V 
Sbjct  963626  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVRS-------EEDVVRAQLKAARVD  963784

Query  245     YENVLGSFVDPHTLKLWHPKKGTK--------------EITTRHVVIAVGGRPRQ--LAC  288
                      F   H + +   +   K               +     +IA G RP    L  
Sbjct  963785  VIPGFARFESEHEISVVRDEADAKRSSSNSSSNLDSLSRVMADKFLIACGTRPAHNPLVP  963964

Query  289     LGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               + G++ + SD I      + P   +V+GA  + +E A  +  + G++V V+
Sbjct  963965  IDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  964117

>PHKE:scaffold_794 scf_22126_794.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_794.1_contig_1:1:8282:1 
REF
Length=8282

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 98/232 (42%), Gaps = 35/232 (15%)
 Frame = +3

Query  126   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
             YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  2292  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  2447

Query  186   SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
             + L +    HH      +++ +V  +   +  +++VS+        +   + +L++ +V 
Sbjct  2448  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSS-------ETDVVRAQLKAARVD  2606

Query  245   YENVLGSFVDPHTLKLWHPK---------------KGTKEITTRHVVIAVGGRPRQ--LA  287
                    F + H + +   +                    +     +IA G RP    L 
Sbjct  2607  VIPGFARFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLV  2786

Query  288   CLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
              + G++ + SD I      + P   +VVGA  + +E A  +  + G++V V+
Sbjct  2787  PIDGKVIIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV  2942

>HYAP:scaffold_298 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_298:1:33810:1 
REF
Length=33810

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 54/226 (24%), Positives = 102/226 (45%), Gaps = 21/226 (9%)
 Frame = -2

Query  125    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               YDLVVIG G     C+ ++A  GK+V ++D            LGG CV+ G IP K   
Sbjct  13826  SYDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  13671

Query  185    QSSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQV  243
              ++ L +    HH      +++ +V  +   +  +++VS+    +++     +V++     
Sbjct  13670  EAVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  13491

Query  244    KYENVL-------GSFVD-PHTLKLWHPKKGTKEITTRHVVIAVGGRPRQ--LACLGGEL  293
              ++E+         G+  D   T +  +       +     ++A G RP    L  + G++
Sbjct  13490  RFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKI  13311

Query  294    AVSSDDIFWM-KQKEPGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
               + SD I     Q+ P   +VVGA  + +E A  +  + G++V V+
Sbjct  13310  VIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  13173

>PHPA:scaffold_175 NW_008649161.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.175, whole genome 
shotgun sequence
Length=46572

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = -1

Query  117    VVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
              ++  D  YDY  +VIGGGSGG+A ++ AA+FG KV V   V+        GLGGTCVN G
Sbjct  35616  IMSTDVVYDY--MVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFG  35452

Query  177    CIPKKLMHQSSLIGEILHHD  196
              C+PKK+M  ++   E L+ +
Sbjct  35451  CVPKKVMFNTAAHVEHLNRN  35392

>PHCA:scaffold_71 PHYCAscaffold_71
Length=252329

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/239 (24%), Positives = 101/239 (42%), Gaps = 44/239 (18%)
 Frame = -3

Query  126    YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
              YDLVVIG G     C+ E+A  GK+V ++D            LGG CV+ G IP K   +
Sbjct  40593  YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  40438

Query  186    SSL-IGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVssyiksisfkykVELRSKQVK  244
              + L +    HH      +++ +V  +   +  +++VS+    +++     +V++     +
Sbjct  40437  AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFAR  40258

Query  245    YE----------------------NVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGR  282
              +E                      N  GS  +  +L   H  K          +IA G R
Sbjct  40257  FENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADK---------FLIACGTR  40105

Query  283    PRQ--LACLGGELAVSSDDIFWMKQKE-PGKTLVVGASYVALECAGFLKGM-GYAVKVM  337
              P    L  + G++ + SD I      + P   +V+GA  + +E A  +  + G++V V+
Sbjct  40104  PAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVV  39928

>APIN:scaffold_1 supercont1.1 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.1:1:2817317:1 
REF
Length=2817317

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 8/64 (13%)
 Frame = -3

Query  125      DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
                +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  1831887  EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  1831732

Query  185      QSSL  188
                ++ L
Sbjct  1831731  EAVL  1831720

>APAS:scaffold_2 supercont1.2 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.2:1:2059303:1 
REF
Length=2059303

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 8/64 (13%)
 Frame = -1

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               +YDL+VIG G  GL C+ E+A  GK V ++D         S  +GG CV+ G IP K   
Sbjct  924529  EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  924374

Query  185     QSSL  188
               ++ L
Sbjct  924373  EAVL  924362

>APIN:scaffold_14 supercont1.14 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.14:1:1185136:1 
REF
Length=1185136

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -1

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   H      GG CV+ G IP K
Sbjct  866872  ASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIID--KKDMH------GGVCVHTGTIPSK  866717

Query  182     LMHQSSL  188
                  ++ L
Sbjct  866716  TFREAVL  866696

>APAS:scaffold_15 supercont1.15 dna:supercontig supercontig:Apha_asta_APO3_V1:supercont1.15:1:1122121:1 
REF
Length=1122121

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 8/84 (10%)
 Frame = +2

Query  105     ASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGT  164
               ++E+  S    ++    AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   H  
Sbjct  846638  SAEVKPSDFSEVLRNLRASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIID--KKDMH--  846805

Query  165     SWGLGGTCVNVGCIPKKLMHQSSL  188
                   GG CV+ G IP K   ++ L
Sbjct  846806  ----GGVCVHTGTIPSKTFREAVL  846865

>PYIR:scaffold_818 pir_scaffold_818 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_818:1:15072:1 
REF
Length=15072

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 9/80 (11%)
 Frame = +3

Query  125  DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
            +YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   
Sbjct  534  NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  689

Query  185  QSSL-IGEILHHDCASFGWN  203
            ++ L +    HH  A + +N
Sbjct  690  EAVLHLSGYRHHGYARYLYN  749

>PHIF:NW_003303629.1 Phytophthora infestans T30-4 supercont1.130 
genomic scaffold, whole genome shotgun sequence
Length=314235

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (45%), Gaps = 8/158 (5%)
 Frame = -1

Query  432    WVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDYDKICTAVFTPI  491
              W      + P ++AIGDVI    L   A + G      +  +    ++Y  I   ++T  
Sbjct  50982  WPLERIKSVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG-HVNYGAIPGVIYTFP  50806

Query  492    EYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVKVVCDKTRNNFV  551
              E+   G +EE+ K E     +E Y+    P+  +   +T IA     VKV+ DK + + +
Sbjct  50805  EFASVGKTEEELKAE----GIE-YNVGKFPMMANSRART-IAEADGLVKVLADK-KTDKL  50647

Query  552    LGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              LG H +  NAGE+     + ++ G   + L  T   HP
Sbjct  50646  LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  50533

>SAPA:scaffold_87 supercont2.87 dna:supercontig supercontig:ASM15154v2:supercont2.87:1:167146:1 
REF
Length=167146

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 16/99 (16%)
 Frame = +1

Query  90     GETLDGTAPMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGK  149
              G + +  A  DD +S +         I+    AS  +DLVVIG G  G  C+ ++A  GK
Sbjct  57790  GLSTEAEAKADDASSFTN--------ILRNLRASEHFDLVVIGSGPSGQKCAIDSAKHGK  57945

Query  150    KVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSL  188
              KV ++D  K   H      GG CV+ G IP K   ++ L
Sbjct  57946  KVAIID--KKDMH------GGVCVHTGTIPSKTFREAVL  58038

>SADI:scaffold_13 supercont1.13 dna:supercontig supercontig:Sap_diclina_VS20_V1:supercont1.13:1:908568:1 
REF
Length=908568

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = -2

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   H      GG CV+ G IP K
Sbjct  323285  ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID--KKDMH------GGVCVHTGTIPSK  323130

Query  182     LMHQSSL  188
                  ++ L
Sbjct  323129  TFREAVL  323109

>PYVX:scaffold_528 pve_scaffold_528 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_528:1:20845:1 
REF
Length=20845

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 37/72 (51%), Gaps = 9/72 (13%)
 Frame = -3

Query  125    DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
              DYDLVVIG G     C+ E+A  GK+V ++D            +GG CV+ G IP K   
Sbjct  12209  DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  12054

Query  185    QSSL-IGEILHH  195
              ++ L +    HH
Sbjct  12053  EAVLHLSGYRHH  12018

>PYUU:scaffold_2014 scf1117875582014 dna:supercontig supercontig:pug:scf1117875582014:1:494327:1 
REF
Length=494327

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = +3

Query  125     DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
               DYDLVVIG G     C+ E+A  GK+V ++D            +GG CV+ G IP K   
Sbjct  329151  DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  329306

Query  185     QSSL  188
               ++ L
Sbjct  329307  EAVL  329318

 Score = 35.8 bits (81),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 66/157 (42%), Gaps = 24/157 (15%)
 Frame = +2

Query  444     YAIGDVIDAPELTPVAIQAGRLLSRRLYNEG----TVQMDYDKICTAVFTPIEYGCCGLS  499
               YA+GD I AP L   +++ GRL +  ++++     T Q++       ++T  E    G +
Sbjct  330518  YAVGDCIGAPSLASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKT  330697

Query  500     EEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIA-------AESCYVKVVCDKTRNNFVL  552
               E+   +E             V  E  +A+ + +A            +K++ D T    + 
Sbjct  330698  EQQLTKE------------GVNFEIGIAKYSELAKGQMSGSTAGGMLKILFDPTTLK-LF  330838

Query  553     GFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               G H +G  A E+     +A+ +G +     D V  +P
Sbjct  330839  GVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFNYP  330949

>PHIF:NW_003303757.1 Phytophthora infestans T30-4 supercont1.2 
genomic scaffold, whole genome shotgun sequence
Length=5928454

 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 33/61 (54%), Gaps = 8/61 (13%)
 Frame = -1

Query  122      ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
                AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G +P K
Sbjct  4157920  ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRD--------MLGGVCVHTGTVPSK  4157765

Query  182      L  182
                +
Sbjct  4157764  V  4157762

>PYVX:scaffold_1272 pve_scaffold_1272 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1272:1:5190:1 
REF
Length=5190

 Score = 46.2 bits (108),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 14/87 (16%)
 Frame = +2

Query  105  ASELNESRTPP------IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVK  158
            A+   + R PP       + E  AS  +DL+V+G G  G  C+ ++A  GK V ++D   
Sbjct  2    AATATDPRVPPGKPLSETLRELKASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIIDK--  175

Query  159  PSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
                     LGG CV+ G +P K+  Q
Sbjct  176  ------RDMLGGVCVHTGTVPSKVSIQ  238

>PHPA:scaffold_139 NW_008649125.1 Phytophthora parasitica INRA-310 
unplaced genomic scaffold supercont2.139, whole genome 
shotgun sequence
Length=64693

 Score = 46.2 bits (108),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 65/141 (46%), Gaps = 27/141 (19%)
 Frame = +2

Query  72    RSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVEDDASYDYDLVVI  131
             R  I++  +++VAS R        +  M  + +A   +            +S DYD+VVI
Sbjct  1049  RHQISINMLRNVASLRR-------SVAMRSSVTARAFS------------SSSDYDVVVI  1171

Query  132   GGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGE  191
             GGG GG   + +AA  G K   ++        +   LGGTC+NVGCIP K +  S+ +  
Sbjct  1172  GGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLH  1327

Query  192   ILHHDCASFGWNVGSVNGQVP  212
                HD  S+G +   V    P
Sbjct  1328  TAQHDFKSYGIDAPEVKANFP  1390

>PYAP:scaffold_246 pag1_scaffold_246 dna:supercontig supercontig:pag1_scaffolds_v1:pag1_scaffold_246:1:40681:1 
REF
Length=40681

 Score = 45.4 bits (106),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 14/94 (15%)
 Frame = -2

Query  94     DGTAPMDDTASASELNESRTP--PIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKV  151
              D T P    + A+E    R P   ++ E  AS  +DL+VIG G  G  C+ + A  GK V
Sbjct  21981  DATGPAPQASGATE----RKPLSEMLRELKASEHFDLIVIGSGPAGQKCAIDHAKHGKSV  21814

Query  152    CVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
               ++D  K   H      GG CV+ G +P K+  Q
Sbjct  21813  AIID--KKDMH------GGVCVHTGTVPSKVR*Q  21736

>ALCA:scaffold_5 AcNc2_CONTIG_5_length_245754 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_5_length_245754:1:245754:1 
REF
Length=245754

 Score = 45.4 bits (106),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 34/61 (56%), Gaps = 8/61 (13%)
 Frame = +1

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
              AS  YDL+VIG G  G  C+ ++A  GK V ++D  K   H      GG CV+ G +P K
Sbjct  10921  ASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIID--KNEMH------GGVCVHTGTVPSK  11076

Query  182    L  182
              +
Sbjct  11077  V  11079

>PYIW:scaffold_924 piw_scaffold_924 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_924:1:12606:1 
REF
Length=12606

 Score = 45.1 bits (105),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (52%), Gaps = 8/64 (13%)
 Frame = +3

Query  125   DYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMH  184
              YDLVVIG G     C+ E+A  GK+V V+D            +GG CV+ G IP K   
Sbjct  1485  SYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  1640

Query  185   QSSL  188
             ++ L
Sbjct  1641  EAVL  1652

>PYIW:scaffold_1034 piw_scaffold_1034 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_1034:1:11717:1 
REF
Length=11717

 Score = 45.1 bits (105),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 33/64 (52%), Gaps = 8/64 (13%)
 Frame = -1

Query  119   EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
             E  AS  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ G +
Sbjct  3839  ELKASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVIDK--------RDMLGGVCIHTGTV  3684

Query  179   PKKL  182
             P K+
Sbjct  3683  PSKV  3672

>PHKE:scaffold_65 scf_22126_65.1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_65.1:1:120598:1 
REF
Length=120598

 Score = 45.1 bits (105),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 40/85 (47%), Gaps = 17/85 (20%)
 Frame = -1

Query  97     APMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDY  156
              AP++ +     L E R         AS  +DL+VIG G  G  C+ ++A  GK V ++D 
Sbjct  39457  APVEKSVLVDTLRELR---------ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD-  39308

Query  157    VKPSPHGTSWGLGGTCVNVGCIPKK  181
                         LGG CV+ G +P K
Sbjct  39307  -------KRDMLGGVCVHTGTVPSK  39254

>ALCA:scaffold_1003 AcNc2_CONTIG_1003_length_4568 dna:supercontig 
supercontig:ASM107853v1:AcNc2_CONTIG_1003_length_4568:1:4568:1 
REF
Length=4568

 Score = 44.3 bits (103),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 32/63 (51%), Gaps = 8/63 (13%)
 Frame = -1

Query  126   YDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQ  185
             YDL+VIG G     C+ +AA  GK V ++D            +GG CV+ G IP K   +
Sbjct  4160  YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  4005

Query  186   SSL  188
             + L
Sbjct  4004  AVL  3996

 Score = 35.0 bits (79),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 15/154 (10%)
 Frame = -1

Query  444   YAIGDVIDAPELTPVAIQAGRLLSRRLYNEGT-------VQMDYDKICTAVFTPIEYGCC  496
             +A+GD I AP L   +++ GRL S  ++NE          Q+        ++T  E    
Sbjct  3002  FAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSIPSQLKTGNFPYGIYTIPEISMV  2823

Query  497   GLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAE-QTRIAAESCYVKVVCDKTRNNFVLGFH  555
             G +E+    +      ++ ++  V     LA+ Q   A+    +K++ D      + G H
Sbjct  2822  GHTEKQLTSQ------QINYEIGVAKYSELAKGQMSGASADGMLKILFDPHSLK-LFGVH  2664

Query  556   YLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
              +G  A E+     +A+ +G T     D V  +P
Sbjct  2663  AIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYP  2562

>PYAR:scaffold_398 par_scaffold_398 dna:supercontig supercontig:par_scaffolds_v1:par_scaffold_398:1:19540:1 
REF
Length=19540

 Score = 44.3 bits (103),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (49%), Gaps = 13/90 (14%)
 Frame = -3

Query  100    DDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKP  159
              D  A+   L+E     ++ +  AS  +DL+VIG G  G  C+ + A  GK V ++D    
Sbjct  11075  DSAATRKPLSE-----LLQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKRD-  10914

Query  160    SPHGTSWGLGGTCVNVGCIPKKLMHQSSLI  189
                      +GG C++ G +P K+    SL+
Sbjct  10913  -------MVGGVCIHTGTVPSKVRSYPSLL  10845

>PLHA:NW_020187508.1 Plasmopara halstedii genome assembly, contig: 
Scaffold_589, whole genome shotgun sequence
Length=103710

 Score = 44.3 bits (103),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 8/61 (13%)
 Frame = -1

Query  122    ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
              AS  +DL+VIG G  G  C+ ++A  GK V ++D            LGG CV+ G IP K
Sbjct  88512  ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSK  88357

Query  182    L  182
              +
Sbjct  88356  V  88354

>HYAP:scaffold_26 dna:scaffold scaffold:HyaAraEmoy2_2.0:scaffold_26:1:584877:1 
REF
Length=584877

 Score = 44.3 bits (103),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 61/141 (43%), Gaps = 27/141 (19%)
 Frame = +3

Query  81      QDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVEDDASYDYDLVVIGGGSGGLAC  140
               + VAS+R +   L             E N+      + E  AS  +DL+VIG G  G  C
Sbjct  151317  RAVASSRSNSPNL-------------EANKQLLTETLRELRASEHFDLIVIGSGPAGQKC  151457

Query  141     SKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASF  200
               + ++A  G  V ++D            LGG CV+ G +P K+ ++      ++   C  +
Sbjct  151458  AIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKVPYR------VMSVHCCCY  151595

Query  201     GWNVGSVNGQVPTFDWKQLVS  221
                  VG  +G + T    Q+++
Sbjct  151596  C*LVG*RDG*ITTISRDQIIT  151658

>PHSO:scaffold_3
Length=10773376

 Score = 43.9 bits (102),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 34/64 (53%), Gaps = 8/64 (13%)
 Frame = +2

Query  119      EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
                E  AS  +DL+VIG G  G  C+ ++A  GK V ++D            +GG CV+ G +
Sbjct  5403842  ELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMMGGVCVHTGTV  5403997

Query  179      PKKL  182
                P K+
Sbjct  5403998  PSKV  5404009

>PYIR:scaffold_33 pir_scaffold_33 dna:supercontig supercontig:pir_scaffolds_v1:pir_scaffold_33:1:77351:1 
REF
Length=77351

 Score = 43.9 bits (102),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 8/65 (12%)
 Frame = +1

Query  119    EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178
              E  AS  +DL+VIG G  G  C+ + A  GK V V+D            LGG C++ G +
Sbjct  59287  ELKASEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTV  59442

Query  179    PKKLM  183
              P K++
Sbjct  59443  PSKVL  59457

>ALLA:FR824046 dna:supercontig supercontig:ENA1:FR824046:1:580768:1 
REF
Length=580768

 Score = 43.9 bits (102),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (56%), Gaps = 8/61 (13%)
 Frame = -1

Query  122     ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKK  181
               AS  YDL+V+G G  G  C+ ++A  GK V ++D  K   H      GG CV+ G +P K
Sbjct  456160  ASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIID--KNEMH------GGVCVHTGTVPSK  456005

Query  182     L  182
               +
Sbjct  456004  V  456002

>PYUU:scaffold_1402 scf1117875581402 dna:supercontig supercontig:pug:scf1117875581402:1:979788:1 
REF
Length=979788

 Score = 43.9 bits (102),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 8/67 (12%)
 Frame = +3

Query  116     IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNV  175
               ++ E  AS  +DL+VIG G  G  C+ ++A  GK V ++D  K   H      GG CV+ 
Sbjct  621231  MLRELKASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--KRDMH------GGVCVHT  621386

Query  176     GCIPKKL  182
               G +P K+
Sbjct  621387  GTVPSKV  621407

 Score = 30.0 bits (66),  Expect(2) = 4.9, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 10/43 (23%)
 Frame = +3

Query  185     QSSLIGEILHHDCASFGWNVGSVN----GQVPTF------DWK  217
               Q+ L+G+   H C SFG+ VGS+      Q+P F       WK
Sbjct  344607  QAKLLGQSTSHGCCSFGYEVGSLTLRLALQMPRFVKIGPWSWK  344735

 Score = 23.1 bits (48),  Expect(2) = 4.9, Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 11/20 (55%), Gaps = 0/20 (0%)
 Frame = +2

Query  152     CVLDYVKPSPHGTSWGLGGT  171
               C L  +KP P  T+W L  +
Sbjct  344549  CSLAILKPRPSATNWRLSKS  344608

>PYIW:scaffold_7307 piw_scaffold_7307 dna:supercontig supercontig:piw_scaffolds_v1:piw_scaffold_7307:1:686:1 
REF
Length=686

 Score = 40.0 bits (92),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 51/114 (45%), Gaps = 9/114 (8%)
 Frame = +3

Query  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536
             ++Y+ I   ++T  E    G +EE  KEE        Y+    P+  +   + R   E+
Sbjct  21   HVNYNAIPGVIYTFPEVASVGKTEEQLKEEG-----VAYNVGKFPMMAN--SRARAVGEA  179

Query  537  -CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHP  589
               VKV+ DK  +  +LG H +  NAGE+     L M+ G   + +  T   HP
Sbjct  180  DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  338

>SAPA:scaffold_1351 supercont2.1351 dna:supercontig supercontig:ASM15154v2:supercont2.1351:1:2108:1 
REF
Length=2108

 Score = 41.2 bits (95),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 31/55 (56%), Gaps = 8/55 (15%)
 Frame = +1

Query  122   ASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVG  176
             AS  +DLVVIG G  G  C+ ++A  GKKV ++D  K   H      GG CV+ G
Sbjct  1966  ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID--KKDMH------GGVCVHTG  2106

>PHKE:scaffold_15 scf_22126_15.1_contig_1 dna:supercontig supercontig:PhyKer238_432v1:scf_22126_15.1_contig_1:1:227166:1 
REF
Length=227166

 Score = 39.3 bits (90),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 86/203 (42%), Gaps = 34/203 (17%)
 Frame = -3

Query  265    KGTKEITTRHVVIAVGGRPRQLACLGGELAV-------SSDDIFWMKQKEPGKTLVVGAS  317
              +G  E+ +  ++++ G   + L   G E  V       ++ D F+ + KE    +V+G  
Sbjct  78346  EGMGELVSETLILSTGASAKYLGIPGEETNVGRGVSTCATCDGFFFRNKE---IIVIGGG  78176

Query  318    YVALECAGFLKGMGYAVKVMVRSILLRG--FDQDMASKIGEYMEMQSGIEFIRKTVPQSI  375
                ALE A FL   G  V ++ R   LRG    QD A +  E +EM      + +T P  +
Sbjct  78175  DSALEEASFLSRFGSKVTLVHRREELRGSKIMQDRA-RSNEKVEMA-----LNRT-PLEV  78017

Query  376    TKLDSGQLLVKWI-TEDGDCFEETFDT--VLNATGRDPDVAKLG----LDEAGVKLNEKT  428
                 D+G   +K +  E G+  EE      V  A G  P+   LG     DE G  L    
Sbjct  78016  LAGDNGVTGLKVLNNETGE--EEIIPASGVFVAIGHTPNTGFLGGQITTDEHGYILTTP-  77846

Query  429    GRIWVNNEQTTTPNVYAIGDVID  451
                      +T  P V+A GDV D
Sbjct  77845  -----GTSETNIPGVFACGDVQD  77792

>PHIF:NW_003303230.1 Phytophthora infestans T30-4 supercont1.538 
genomic scaffold, whole genome shotgun sequence
Length=43771

 Score = 38.9 bits (89),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (51%), Gaps = 9/57 (16%)
 Frame = +3

Query  127   DLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPKKLM  183
             D +VIG G GG   +  ++  G K  +++  +         LGG C +VGCIP K M
Sbjct  6387  DTLVIGSGPGGYVAALHSSRLGLKTVIVERDQ---------LGGVCTHVGCIPSKAM  6530

>PYVX:scaffold_1471 pve_scaffold_1471 dna:supercontig supercontig:pve_scaffolds_v1:pve_scaffold_1471:1:3688:1 
REF
Length=3688

 Score = 34.7 bits (78),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  116  IVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLD  155
            IV+ D+ +  +D++V+GGG  G++ +   A+ GKKV +++
Sbjct  45   IVMSDNGNNKFDVIVVGGGFAGVSAAIALATKGKKVALVE  164

>APIN:scaffold_12 supercont1.12 dna:supercontig supercontig:Apha_inva_NJM9701_V1:supercont1.12:1:1527504:1 
REF
Length=1527504

 Score = 34.7 bits (78),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 0/44 (0%)
 Frame = -3

Query  37      FGLDSKATTHVTSPFVWISNPTTFVGGCDDLLAVFRSGIAVGNI  80
               F   SK  +HV      +S+P+TFV  C++   + RSGI    I
Sbjct  643192  FAYGSKVASHVKPSHSCLSSPSTFVSDCEEGKTIVRSGIRTQGI  643061

Lambda      K        H        a         alpha
   0.318    0.136    0.415    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 203963205849

  Database: OGOB_genomes.fna
    Posted date:  Sep 16, 2018  3:46 PM
  Number of letters in database: 1,297,559,224
  Number of sequences in database:  64,241

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 13
Window for multiple hits: 40