Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_063551475871371335760.0
SDRG_017631475873671733510.0
PYIR_13418147587475687387e-86
PHYCA_511415147587445707352e-85
PPTG_17129147587455707212e-83
PHYSO_348903147587665727101e-81
PYU1_G001733147587325647062e-81
PHYRA_81098147587415626993e-80
HYAP_07104147587215796964e-80
PITG_18458147587474206451e-72
PYIW_19969147587334126292e-70
CCA22843147585865675895e-66
PHYKE_83951475814204216101e-65
CCI44111147585765595763e-64
PHALS_06476147587263845685e-62
PYAP_17763147587944135505e-59
PYAR_13571147586664135305e-57
PYVX_23590147586894174593e-47
SPRG_1903013355510003151944e-14
SDRG_079831335559913131936e-14
PHYSO_4705331382110843051882e-13
H257_0193413355510223081873e-13
PYVX_215131382114462111865e-13
PITG_172501382110464081767e-12
PPTG_113651382111064131703e-11
SPRG_126211382110031781694e-11
H310_082921382110073071695e-11
SDRG_045751382110031781651e-10
PYU1_G002110138219993691571e-09
H257_117731382110261791481e-08
PYAR_14788138217951511372e-07
PYIR_141071382111762001363e-07
PYAP_222301382111162251274e-06
PYIW_157171382111212131231e-05
PYU1_G00954315640140861870.23
PYIR_13773156401486195840.54
H310_095889898280140791.2
PYIW_1720869019846771.4
SPRG_08282126277125052782.8
SDRG_0974813658375080782.8
PYIW_2082415640143559783.0
PYAP_23079387358375763.8
SPRG_1461413009699342764.2
SDRG_0974913241999255764.7
PYU1_G01437669019845735.3
CCA2177369019643736.0
CCI4133369019643726.4
PHYSO_3593101832715125756.5
SDRG_094801052456552746.6
H257_06450128696125924747.0
PPTG_146041832608125747.1
SPRG_080531052456352747.7
SDRG_1674611641439159738.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_06355

Length=713
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SPRG_06355                                                            1382       0.0  
SDRG_01763                                                            1295       0.0  
PYIR_13418                                                            288        7e-86
PHYCA_511415                                                          287        2e-85
PPTG_17129                                                            282        2e-83
PHYSO_348903                                                          278        1e-81
PYU1_G001733                                                          276        2e-81
PHYRA_81098                                                           273        3e-80
HYAP_07104                                                            272        4e-80
PITG_18458                                                            253        1e-72
PYIW_19969                                                            246        2e-70
CCA22843                                                              231        5e-66
PHYKE_8395                                                            239        1e-65
CCI44111                                                              226        3e-64
PHALS_06476                                                           223        5e-62
PYAP_17763                                                            216        5e-59
PYAR_13571                                                            208        5e-57
PYVX_23590                                                            181        3e-47
SPRG_19030                                                            79.3       4e-14
SDRG_07983                                                            79.0       6e-14
PHYSO_470533                                                          77.0       2e-13
H257_01934                                                            76.6       3e-13
PYVX_21513                                                            76.3       5e-13
PITG_17250                                                            72.4       7e-12
PPTG_11365                                                            70.1       3e-11
SPRG_12621                                                            69.7       4e-11
H310_08292                                                            69.7       5e-11
SDRG_04575                                                            68.2       1e-10
PYU1_G002110                                                          65.1       1e-09
H257_11773                                                            61.6       1e-08
PYAR_14788                                                            57.4       2e-07
PYIR_14107                                                            57.0       3e-07
PYAP_22230                                                            53.5       4e-06
PYIW_15717                                                            52.0       1e-05
PYU1_G009543                                                          38.1       0.23 
PYIR_13773                                                            37.0       0.54 
H310_09588                                                            35.0       1.2  
PYIW_17208                                                            34.3       1.4  
SPRG_08282                                                            34.7       2.8  
SDRG_09748                                                            34.7       2.8  
PYIW_20824                                                            34.7       3.0  
PYAP_23079                                                            33.9       3.8  
SPRG_14614                                                            33.9       4.2  
SDRG_09749                                                            33.9       4.7  
PYU1_G014376                                                          32.7       5.3  
CCA21773                                                              32.7       6.0  
CCI41333                                                              32.3       6.4  
PHYSO_359310                                                          33.5       6.5  
SDRG_09480                                                            33.1       6.6  
H257_06450                                                            33.1       7.0  
PPTG_14604                                                            33.1       7.1  
SPRG_08053                                                            33.1       7.7  
SDRG_16746                                                            32.7       8.3  

>SPRG_06355
Length=713

 Score = 1382 bits (3576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 713/713 (100%), Positives = 713/713 (100%), Gaps = 0/713 (0%)

Query  1    MRFATYTLQSFLQPRRHAHAMAKFFRRSASKMSLRGDDVTASMPRERVTLSGVTASAITA  60
            MRFATYTLQSFLQPRRHAHAMAKFFRRSASKMSLRGDDVTASMPRERVTLSGVTASAITA
Sbjct  1    MRFATYTLQSFLQPRRHAHAMAKFFRRSASKMSLRGDDVTASMPRERVTLSGVTASAITA  60

Query  61   SNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAK  120
            SNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAK
Sbjct  61   SNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAK  120

Query  121  AYRDEPTGFENTsdapapsmamdaaVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG  180
            AYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG
Sbjct  121  AYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG  180

Query  181  AVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVP  240
            AVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVP
Sbjct  181  AVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVP  240

Query  241  YLPAASRTPSPPKRESTVVREsirassklsressklsresskisressklFRESTRQPIK  300
            YLPAASRTPSPPKRESTVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIK
Sbjct  241  YLPAASRTPSPPKRESTVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIK  300

Query  301  DQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVG  360
            DQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVG
Sbjct  301  DQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVG  360

Query  361  GAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQLVRL  420
            GAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQLVRL
Sbjct  361  GAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQLVRL  420

Query  421  NLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVAL  480
            NLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVAL
Sbjct  421  NLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVAL  480

Query  481  EFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNIL  540
            EFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNIL
Sbjct  481  EFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNIL  540

Query  541  FLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVW  600
            FLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVW
Sbjct  541  FLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVW  600

Query  601  QKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETG  660
            QKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETG
Sbjct  601  QKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETG  660

Query  661  VYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTKGNVPYKPSKKPKVTFDI  713
            VYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTKGNVPYKPSKKPKVTFDI
Sbjct  661  VYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTKGNVPYKPSKKPKVTFDI  713

>SDRG_01763
Length=736

 Score = 1295 bits (3351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/717 (91%), Positives = 671/717 (94%), Gaps = 11/717 (2%)

Query  8    LQSFLQPRRHAHAMAKFFRRSASKMS-LRGDDVTASMPRERVTLSGVTASAITASNYSSY  66
            + SFLQ RRHAHAMAKFFRRS+SKM  LRGDDVTASMPRERVTLSGVTASA+TASNYSSY
Sbjct  20   IASFLQQRRHAHAMAKFFRRSSSKMGGLRGDDVTASMPRERVTLSGVTASAVTASNYSSY  79

Query  67   QLDTLHETVASMNKQLDEYKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAKAYRDEP  126
            QLDTLHETVASMNKQLDEYKRETIARLDHVEG+VR+STRRAISNQATNHIVPAKAYRDEP
Sbjct  80   QLDTLHETVASMNKQLDEYKRETIARLDHVEGSVRESTRRAISNQATNHIVPAKAYRDEP  139

Query  127  TGFENTsdapapsmamdaaVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV  186
            TGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV
Sbjct  140  TGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV  199

Query  187  DAMHQQ--PRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPA  244
            DAMHQQ  PRA ATPLLRTEDRKLSVMSDATVSSEADSE ST EEPEVFEPNPKVPYLPA
Sbjct  200  DAMHQQSTPRAVATPLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPA  259

Query  245  ASRTPSPPKRESTVVREsirassk--------lsressklsresskisressklFRESTR  296
            ASRTPSPPKRESTV RES RASSK            S      S      S  LFRESTR
Sbjct  260  ASRTPSPPKRESTVFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTR  319

Query  297  QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL  356
            QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL
Sbjct  320  QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL  379

Query  357  NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQ  416
            NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHA SAILMSLAHQISCKLPD+QQQ
Sbjct  380  NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAILMSLAHQISCKLPDYQQQ  439

Query  417  LVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLA  476
            LVRLNL YLIQEPDP+VLATKLLIEPLRSMPAPLESQVIVLDAVDED STPG NLISLLA
Sbjct  440  LVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLA  499

Query  477  DVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD  536
            DVALEFPSWVLFLLSSR V+SVLKALP HDVLHFHMEHRPFAADCTIAVQS+MDKHGLDD
Sbjct  500  DVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDD  559

Query  537  KNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGR  596
            KNILFLLKAKSQGSFLYLQFVDQAF+MIHSEIDAGMILELPKTL+EIYDQVFEEKYGKGR
Sbjct  560  KNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKYGKGR  619

Query  597  RRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVD  656
            RRVWQKVQ VLEAIVGAAT+SHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIV VD
Sbjct  620  RRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVD  679

Query  657  EETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTKGNVPYKPSKKPKVTFDI  713
            E+TGVYRLQSKGLFDYLVDT+RSQEV HINVERG+HYLTKGNVPYKPSKKPKVTFD+
Sbjct  680  EDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKGNVPYKPSKKPKVTFDV  736

>PYIR_13418
Length=747

 Score = 288 bits (738),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 184/568 (32%), Positives = 296/568 (52%), Gaps = 72/568 (13%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205
            + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +        +R+ D
Sbjct  176  LSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKG-------VRSLD  228

Query  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTP----SPPKRESTVVRE  261
                  S A V +EA  E S+ E             L   SRT     S   +E    RE
Sbjct  229  -----ASGAAVGAEAQPELSSDE-------------LDTISRTTALYTSKATKERRATRE  270

Query  262  sirassklsressklsresskisressklFRESTRQPIKDQALTQPW-ENVLNQHLPFLN  320
                    +                     R +   P+ D AL+ P  ++ +++  P + 
Sbjct  271  DSAPVLVRASS-------------------RLTQLAPVADDALSTPLLQHQIDEMFPLVE  311

Query  321  T----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  376
                 Q  A    PS+R WAI ++ +W           +L +VG  G+GKSTL   L   
Sbjct  312  CSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDK  371

Query  377  YPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVL  434
            + + ++A H   +D +  +S   +L+SL +Q+   LP F+ QL RLNL Y+++E DP+VL
Sbjct  372  FHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVL  431

Query  435  ATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFLLSSRP  494
            A K+L++PL ++  PL ++V V D +D+  S    +L+  LA +  E P+WV   ++S+P
Sbjct  432  ARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGVFITSKP  491

Query  495  VDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNI---LFLLKAKSQGSF  551
               +   L    +L F  ++  +  D  I +  ++      DK++     +LK KS G+F
Sbjct  492  SPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN--FSDKDVPQAREILKRKSGGNF  549

Query  552  LYLQFVDQAFAMIHSEIDAGMI-----LELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPV  606
             +L F  QA +    E D G I      +LP+++YEIY+++FE+K+GKGR R+W+KVQP+
Sbjct  550  TFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPL  609

Query  607  LEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQS  666
            LE IV AA+  +       +TE+  Q  F L + D+  I R+F DI+AV+   G YR+++
Sbjct  610  LELIVTAASGPY-----ALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNH--GTYRIET  662

Query  667  KGLFDYLVDTSRSQEVAHINVERGVHYL  694
              LF++LVD  R+ E  +++V  G++ L
Sbjct  663  SALFEWLVDPQRAGEQFYVDVSGGMNLL  690

>PHYCA_511415
Length=744

 Score = 287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 184/570 (32%), Positives = 294/570 (52%), Gaps = 70/570 (12%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205
            V E+K  V  IRR+VM ELH T+YD+LKE+T+L+GA+ QL  A H  P  ++T    ++ 
Sbjct  161  VLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSD-  219

Query  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsira  265
              LS    A ++ +  +++S      +      V       +TP P  R S         
Sbjct  220  -PLSAEERAALTRQTSTKTSAATRDRLAASRLNV------HKTPPPAARASV--------  264

Query  266  ssklsressklsresskisressklFRESTRQPIKDQALTQPWENV-LNQHLPFLNTQRP  324
                                      R +   P+ D AL+ P  +  +N+  P ++    
Sbjct  265  --------------------------RLTQLAPVADNALSTPLSSQQINEMFPLIDFTSD  298

Query  325  ----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQ  380
                A  + P +RTWA+ +  +W           +L VVG  G GKS  L  +   +   
Sbjct  299  LAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFLGTVAQQFRGN  358

Query  381  IMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKL  438
            ++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP++LA K+
Sbjct  359  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEEADPILLAGKV  418

Query  439  LIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFLLSSRPVD  496
            L++PL +M  P+ +  +++D +D+ ++ P G N L+   A V  + PSW+ FL+SS+P  
Sbjct  419  LVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWIGFLMSSKPSS  478

Query  497  SVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILFLLKAKSQGSFLYLQ  555
             + K LP   VL F  ++  F AD +  V  +      DD      +LK KS G+F YL+
Sbjct  479  KLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKHKSGGNFAYLE  538

Query  556  FVDQAFA-------MIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLE  608
            F  QA +            +  G++ ELP+TLY+IY ++FE+K+G+GR RVW K +P+L+
Sbjct  539  FTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  598

Query  609  AIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQS  666
             +VGAA+        P+  VTE   +  FKL   DL ++ RSF D+VAV    G YR++S
Sbjct  599  LVVGAAS-------GPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKH--GSYRIES  649

Query  667  KGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
              L  +L D +RS+E  + +++  +H L K
Sbjct  650  SALCAWLSDPARSEEQFYFSIDDALHALRK  679

>PPTG_17129
Length=745

 Score = 282 bits (721),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 182/570 (32%), Positives = 287/570 (50%), Gaps = 69/570 (12%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H  P + ++    + D
Sbjct  163  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSD  222

Query  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsira  265
              LS    A ++ +  +++S      +      +       +TP P  R S         
Sbjct  223  -PLSAEERAALTRQTSTKTSQATRDRLAASRTNI------HKTPPPAARASV--------  267

Query  266  ssklsressklsresskisressklFRESTRQPIKDQALTQPWE-NVLNQHLPFLNTQRP  324
                                      R +   P+ D AL+ P     +N+  P ++    
Sbjct  268  --------------------------RLTQLAPVADNALSTPLSPQQINEMFPLIDFTSE  301

Query  325  ----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQ  380
                A  + P TRTWA+ +  +W           +L VVG  G GKS     +   +   
Sbjct  302  LAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGN  361

Query  381  IMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKL  438
            ++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP +LA K+
Sbjct  362  LLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKV  421

Query  439  LIEPLRSMPAPLESQVIVLDAVDEDAST-PGTN-LISLLADVALEFPSWVLFLLSSRPVD  496
            L++PL +M  P+ +  +++D +D+ A+   G N L+   A V  + PSWV FL+SS+P  
Sbjct  422  LVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSS  481

Query  497  SVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILFLLKAKSQGSFLYLQ  555
             + K LP   VL F  ++  F AD +  V  +      DD      +LK KS G+F YL+
Sbjct  482  KLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLE  541

Query  556  FVDQAFA---MIHSEIDAGMIL----ELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLE  608
            F  QA +   M  +  +  + L    ELP+TLY+IY ++FE+K+G+GR RVW K +P+L+
Sbjct  542  FTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQ  601

Query  609  AIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQS  666
             IVGAA       A P+  +TE   +  FK    DL ++ RSF D+VAV    G YR++S
Sbjct  602  LIVGAA-------AGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKH--GAYRIES  652

Query  667  KGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
              L  +L D +RS+E  + +++  +  L K
Sbjct  653  SALCAWLSDPARSEEQFYFSIDDALQALRK  682

>PHYSO_348903
Length=766

 Score = 278 bits (710),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 182/572 (32%), Positives = 286/572 (50%), Gaps = 77/572 (13%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL-----  200
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H  P + ++       
Sbjct  181  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSSLD  240

Query  201  -LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVV  259
             L  +DR   V   +T +S A  E        V              +TP P  R S   
Sbjct  241  PLSADDRAKLVRQTSTKTSPATRERLAASRANV-------------QKTPPPFARASV--  285

Query  260  REsirassklsressklsresskisressklFRESTRQPIKDQALTQPWENV-LNQHLPF  318
                                            R +   P+ D AL+ P  +  +N+  P 
Sbjct  286  --------------------------------RLTQLAPVADDALSTPLTSQQINEMFPL  313

Query  319  LNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLV  374
            ++        A  + P +RTWA+ +  +W      T    +L VVG  G GKS     + 
Sbjct  314  IDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVA  373

Query  375  SNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPV  432
              +   ++A+H  ++D +  ++   +L+S+ HQI    P F+ QL RLNL Y+++E DP+
Sbjct  374  QQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPM  433

Query  433  VLATKLLIEPLRSMPAPLESQVIVLDAVDEDAS-TPGTN-LISLLADVALEFPSWVLFLL  490
            +LA K+L++PL ++  P+++  +++D +D+ A+   G N L+   A +  + P+WV FLL
Sbjct  434  LLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLL  493

Query  491  SSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD-KNILFLLKAKSQG  549
            SS+P   + K LP   VL F  E+  F AD    V+ +      DD      +LK KS G
Sbjct  494  SSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGG  553

Query  550  SFLYLQFVDQAF-------AMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQK  602
            +F YL+F  QA        A     +  G++ +LP+TLY+IY ++FE+K+G+GR RVW K
Sbjct  554  NFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGK  613

Query  603  VQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  662
             +P+L+ +VGAA+  +       VTE   +  F L   DL ++ RSF D+VAV    G Y
Sbjct  614  AKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAEDLRMLRRSFVDLVAVRH--GSY  666

Query  663  RLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  694
            R++S  L  +L D +RS+E  + +++  +  L
Sbjct  667  RIESSALCAWLSDPARSEEQFYFSIDDALQAL  698

>PYU1_G001733
Length=732

 Score = 276 bits (706),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 168/564 (30%), Positives = 297/564 (53%), Gaps = 65/564 (12%)

Query  148  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTEDRK  207
            EMK+ +  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +               
Sbjct  161  EMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKG--------------  206

Query  208  LSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsirass  267
                              TL+   V EP P++            P +  T+ R +   +S
Sbjct  207  ----------------VRTLDAGGVAEPQPELS-----------PAQLDTITRTTAVHTS  239

Query  268  klsressklsresskisressklFRESTRQPIKDQALTQPW-ENVLNQHLPFLN----TQ  322
            K +++       ++  +       R +   P+ D AL+ P  ++ ++   P ++     Q
Sbjct  240  KATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQ  299

Query  323  RPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIM  382
              A +  P++R WA  ++  W           +L +VG  G+GKSTL+  L   + + I+
Sbjct  300  LHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIV  359

Query  383  ASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLI  440
            A H  ++D +  +S   +L+SL +Q+   LP F+ QL RLNL Y+++E DP+VLA K+L+
Sbjct  360  ALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLV  419

Query  441  EPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVLK  500
            +PL ++  PL ++V+++D +D+  S    +L+  LA +  EFP+W+   ++S+P   +  
Sbjct  420  DPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPA  479

Query  501  ALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNI---LFLLKAKSQGSFLYLQFV  557
             L    +L F  ++  +  D  I +  ++      DK++     +LK KS G+F +L F 
Sbjct  480  KLAITSLLDFSPKNANYMNDTIILINDII--GNFSDKDVSEARDILKRKSGGNFTFLDFT  537

Query  558  DQAFAMIHSEIDAG-----MILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVG  612
             QA +    E + G     ++ +LP+++YEIYD++FE+K+GKG  R+W+KVQP+L+ IV 
Sbjct  538  KQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVT  597

Query  613  AATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDY  672
            AA+  +       +TE   Q  F L + D+ +I R+F DI  +D   G YR+++  ++++
Sbjct  598  AASGPY-----ALITEEQAQEQFSLSRDDIRMIRRAFTDI--IDVRHGTYRMETSAMYEW  650

Query  673  LVDTSRSQEVAHINVERGVHYLTK  696
            LVD  RS E  ++N+   +  L +
Sbjct  651  LVDPQRSGEQFYVNISASMDILRR  674

>PHYRA_81098
Length=741

 Score = 273 bits (699),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 175/562 (31%), Positives = 279/562 (50%), Gaps = 74/562 (13%)

Query  155  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTEDRKLSVMSDA  214
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H  P A+ +    +    LS    A
Sbjct  162  AIRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERA  221

Query  215  TVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsirassklsress  274
             ++ +  +++S+     +      +       +TP P  R S                  
Sbjct  222  ALTRQTSTKTSSATRERLAASRANI------HKTPPPAARASV-----------------  258

Query  275  klsresskisressklFRESTRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEML  329
                             R +   P+ D AL+ P     +N   P ++        A  + 
Sbjct  259  -----------------RLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARSLT  301

Query  330  PSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRY  389
            P +RTWA+ +  +W           +L VVG  G GKS  L  +   +   ++A+H  ++
Sbjct  302  PGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQF  361

Query  390  DERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMP  447
            D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP VLA K+L++PL +M 
Sbjct  362  DRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNAME  421

Query  448  APLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTH  505
             P+ +  +++D +D+ ++ P G N L+   A V    PSWV F++SS+P   + K LP  
Sbjct  422  EPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVS  481

Query  506  DVLHFHMEHRPFAADCTIAVQ----SLMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAF  561
             VL F  ++  F +D +  V+    +  D    + K +   LK KS G+F YL+F  QA 
Sbjct  482  SVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKV---LKQKSGGNFAYLEFTKQAL  538

Query  562  -------AMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAA  614
                   A     +   ++ ELP+TLY+IY ++FE+K+G+GR RVW K +P+L+ IVGAA
Sbjct  539  SHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAA  598

Query  615  TLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDY  672
                   A P+  VTE   +  F L   DL ++  SF D+VAV    G YR++S  L  +
Sbjct  599  -------AGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRH--GAYRIESSALCGW  649

Query  673  LVDTSRSQEVAHINVERGVHYL  694
            L D +RS+E  +  ++  +  L
Sbjct  650  LSDPARSEEQFYFAIDDAIQAL  671

>HYAP_07104
Length=721

 Score = 272 bits (696),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 181/579 (31%), Positives = 289/579 (50%), Gaps = 92/579 (16%)

Query  148  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL-------  200
            E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       P   + PL       
Sbjct  155  EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTF--PPPTTSVPLSIQRSVS  212

Query  201  --LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  258
              L + DR       +T++S A  +         ++P             P P  R S  
Sbjct  213  NPLSSADRGALTRQTSTMTSSATRDRLAASRVNTYKP-------------PPPAARASV-  258

Query  259  VREsirassklsressklsresskisressklFRESTRQPIKDQALTQPWENV-LNQHLP  317
                                             R +   P+ D AL+ P  +V +N   P
Sbjct  259  ---------------------------------RLTQLAPVADSALSTPLSSVQMNDLFP  285

Query  318  FLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  373
             ++        A  + P +RTWA+ +  +W +         +L VVG  G+GKS     +
Sbjct  286  LIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTV  345

Query  374  VSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDP  431
               Y  Q++A+H  ++D +  +S   +L+S+ HQ+   LP F+ QL RLNL Y+++E DP
Sbjct  346  AQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADP  405

Query  432  VVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GTN-LISLLADVALEFPSWVLFL  489
            V+LA+K+L++PL ++  P++   +++D +D+    P G N L+  LA +  + PSW+  +
Sbjct  406  VLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVI  465

Query  490  LSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGL-----DDKNILFLLK  544
            +SS+P   + K LP   VL F  ++  F AD    V SL+D+        D +    +LK
Sbjct  466  VSSKPSSKLAKRLPVSSVLDFSAKNEAFVAD----VSSLVDEIACHFKHEDVEEAKEVLK  521

Query  545  AKSQGSFLYLQFVDQAFAMIHSEIDAGMIL-----ELPKTLYEIYDQVFEEKYGKGRRRV  599
             KS G+F YL+F  QA + + S    G++      ELP+TLY+IY ++FE+K+G GR RV
Sbjct  522  HKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  581

Query  600  WQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVAVDE  657
            W K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+VAV  
Sbjct  582  WSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKH  634

Query  658  ETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
              G+YR+++  L  +L D +R++E  + N++  +  L K
Sbjct  635  --GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671

>PITG_18458
Length=747

 Score = 253 bits (645),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 232/420 (55%), Gaps = 32/420 (8%)

Query  298  PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  352
            P+ D AL+ P     +N+  P +++       A  + P TRTWA+ +  +W         
Sbjct  270  PVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGN  329

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410
              +L VVG  G GKST    +   +   ++A+H  ++D +  +S   +L+S+ HQ+   L
Sbjct  330  DTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSL  389

Query  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDA-STPGT  469
            P F+ QL RLNL Y+++E DP +LA K+L++PL ++  P+ +  I++D +D+ A  + G 
Sbjct  390  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGR  449

Query  470  N-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSL  528
            N L+ L A V  + PSWV FL+SS+P   + K LP   VL F  ++  F AD +  V  +
Sbjct  450  NELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDI  509

Query  529  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAG---------MILELPK  578
                  DD      +LK KS G+F YL+F  QA +  H  I A          ++ ELP+
Sbjct  510  ARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALS--HPGIAAASKEGAVPLEVLHELPE  567

Query  579  TLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFK  636
            TLY+IY ++FE+K+G+GR RVW K +P+L+ +VGAA       A P+  VTE   +  F 
Sbjct  568  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAA-------AGPYSPVTEEQAKEHFN  620

Query  637  LGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
            L   DL ++ RSF D+V+V    G YR++S  L  +L D +RS+E  + +V+  +  L K
Sbjct  621  LTTEDLRMLRRSFVDLVSVKH--GSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRK  678

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQP  193
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H  P
Sbjct  159  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAP  206

>PYIW_19969
Length=733

 Score = 246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 232/412 (56%), Gaps = 24/412 (6%)

Query  298  PIKDQALTQPW-ENVLNQHLPFLNTQRPAMEML----PSTRTWAINQYIKWAQDAGPTNE  352
            P+ D+AL+ P  ++ +++  P +      + +      S+R WA+ ++ +W         
Sbjct  274  PVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGV  333

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410
              +L +VG  G+GKSTL   L   + + I+A H   +D +  +S   +L+SL +Q+   L
Sbjct  334  DNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNL  393

Query  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN  470
            P F+ QL RLNL Y+++E DPVVLA KLL++PL ++  P+ ++V ++D +D+  S    +
Sbjct  394  PLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRND  453

Query  471  LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMD  530
            L+  LA +  E P+W+   ++S+P   +   L    +L F  ++  +  D  I +  ++ 
Sbjct  454  LLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIG  513

Query  531  KHGLDDKNI---LFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMI-----LELPKTLYE  582
                 DK++     +LK KS G+F +L F  QA +    E D G I      +LP+++YE
Sbjct  514  S--FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYE  571

Query  583  IYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDL  642
            IY+++FE+K+GKGR R+W+KVQP+LE IV AA+  +       +TE+  Q  F L + D+
Sbjct  572  IYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPY-----ALITETQAQEQFALSKEDI  626

Query  643  ALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  694
              I RSF DI  +D   G YR+++  LF++LVD  R+ E  +++V  G+  L
Sbjct  627  RTIRRSFVDI--IDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQ  192
            + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +
Sbjct  179  LSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETK  225

>CCA22843
Length=586

 Score = 231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 155/567 (27%), Positives = 301/567 (53%), Gaps = 66/567 (12%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205
            + +M+  +  +R++++  + +T+YDL+KE+  L+G V  + + +  +    ++P    E+
Sbjct  67   IQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGL-TKIDVKSSPTGTNEN  125

Query  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsira  265
                     T +  A SES+  E+ E+             SR  +P +  ST+V +    
Sbjct  126  H-------TTANKTAFSESA--EDDEII------------SRFITPER--STIVADCSYK  162

Query  266  ssklsressklsresskisressklFRESTRQPIKDQALTQPWE-NVLNQHLP----FLN  320
            S  ++   +                   ST  P+ +  L++P + +  ++  P    F +
Sbjct  163  SGFVTERLNTKDSSF-------------STSVPLDESQLSKPLDKDEFDEMFPCIDCFSD  209

Query  321  TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQ  380
             +  A+++   TR WA+++  +W +    +    +L ++G  G+GKSTL  ++   +  +
Sbjct  210  LKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAK  269

Query  381  IMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKL  438
            + A HF ++D +  +S+  +++SL  Q + K P +++QL  LNL Y+++E +P+V+A KL
Sbjct  270  LHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKL  329

Query  439  LIEPLRSMPAPLESQVIVL-DAVDED-ASTPGTNLISLLADVALEFPSWVLFLLSSRPVD  496
            LIEPLR++P    ++  VL D +D+        +L+ L++ +   FPS + F+++S+   
Sbjct  330  LIEPLRAIPVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASP  389

Query  497  SVLKALPTHDVLHFHMEHRPFAADCTIAVQ-SLMD---KHGLDDKNILFLLKAKSQGSFL  552
            +      +  ++H H  +  F  D  I ++ S+++   KH  +  +IL     KS G+ L
Sbjct  390  AFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEACDILM---RKSGGNGL  446

Query  553  YLQFVDQAFA--MIHSE---IDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVL  607
            YLQF ++A +  ++H E   +   ++ ELP ++ +I+  +FE+K+G+G +RVW+ V+P+L
Sbjct  447  YLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPIL  506

Query  608  EAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSK  667
            EAIV AA  SH     P V E  ++  F+LG+ +  ++ RSF DI+    E   YR+ + 
Sbjct  507  EAIVAAAAGSH-----PLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEG--YRIITS  559

Query  668  GLFDYLVDTSRSQEVAHINVERGVHYL  694
             LF +L+  +RSQ   +I+ + G+ +L
Sbjct  560  SLFAWLIVENRSQHF-YIDPKAGIKFL  585

>PHYKE_8395
Length=1420

 Score = 239 bits (610),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 138/421 (33%), Positives = 231/421 (55%), Gaps = 34/421 (8%)

Query  298   PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  352
             P+ D AL+ P     +N+  P ++        A  ++P TRTWA+ +  +W         
Sbjct  939   PVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGN  998

Query  353   SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410
               VL VVG  G GKS     +   +   ++A+H  ++D +  ++   +L+S  HQ+   L
Sbjct  999   DTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNL  1058

Query  411   PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTP-GT  469
             P F+ QL RLNL Y+++E DP +LA K+ ++PL ++  P+ +  ++++ +D+ ++ P G 
Sbjct  1059  PPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGR  1118

Query  470   N-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAV---  525
             N L+  L+ +  + PSWV F++SS+P     K LP   VL F  ++  F +D +  V   
Sbjct  1119  NELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDI  1178

Query  526   -QSLMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFA---MIHSEIDAGMILE----LP  577
              ++  D+   + K +   LK KS G+F YL+F  QA +   M  +  +  + LE    LP
Sbjct  1179  ARNFSDEDSAEAKRV---LKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLP  1235

Query  578   KTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIF  635
             ++L++IY ++FE+K+G+GR R+W K +P+L+ IVGAA       A P+  VTE   +  F
Sbjct  1236  QSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAA-------AGPYSPVTEGQAKEHF  1288

Query  636   KLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLT  695
                  DL ++ RSF D+V V    G YRL+S  L  +L D +RS+E  +++V+  +  L 
Sbjct  1289  GFTTEDLRMLRRSFVDLVEVKH--GAYRLESSALCSWLSDPARSEEQFYLSVDDALTALR  1346

Query  696   K  696
             K
Sbjct  1347  K  1347

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDA  188
            + E+K  V  IRR+VM ELH T+YD+LKE+T+L+GAV QL  A
Sbjct  830  LQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAA  872

>CCI44111
Length=576

 Score = 226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 158/559 (28%), Positives = 283/559 (51%), Gaps = 69/559 (12%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPLLRTED  205
            +  M++ +  +R++++  +  T+YD+LKE+  L+G V  +   +     A    L  T  
Sbjct  60   IKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTA  119

Query  206  RKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVREsira  265
               S  S+    +E  S   T +   V      +  L +          +S+++RES   
Sbjct  120  NG-SACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVS----------QSSILRESGL-  167

Query  266  ssklsressklsresskisressklFRESTRQPIKDQALTQPW-ENVLNQHLPFLNT---  321
                                         T   + +  L++P  ++ +++  P ++    
Sbjct  168  ----------------------------PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGD  199

Query  322  -QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQ  380
             +  A+++   TR WA++   KW Q        RVL +VG  GAGKSTL  ++   +   
Sbjct  200  VESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAAN  259

Query  381  IMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVVLATKL  438
            + A HF ++D +  +S+  +++SL  Q + KL  +++QL RLNL Y++ E +P+V+ATKL
Sbjct  260  LHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILAESNPLVMATKL  319

Query  439  LIEPLRSMPAPLESQVIVL-DAVDEDASTPGTN-LISLLADVALEFPSWVLFLLSSRPVD  496
            LI+PLR++P    +   VL D +D+      +N L+ LL+ +   FPSW+ F+++S+   
Sbjct  320  LIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFP  379

Query  497  SVLKALPTHDVLHFHMEHRPFAADCTIAVQSLM----DKHGLDDKNILFLLKAKSQGSFL  552
            +    L T+ V+H    +  F  D  I +++L+     KH  +  +IL     KS G+ L
Sbjct  380  AFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILM---RKSGGNSL  436

Query  553  YLQFVDQAFA--MIHSE---IDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVL  607
            YLQF+++A +  ++H E   +   ++ ELP+++ EI   +F++K+G+G +RVW+  +P+L
Sbjct  437  YLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPIL  496

Query  608  EAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQSK  667
            E IV AA   +     P V ES ++  F+L + +  +I R+F DI+     T  YR+ + 
Sbjct  497  EVIVAAAAGPY-----PLVGESQIKQQFELRENEWRMINRAFTDIIHCG--TDGYRIINS  549

Query  668  GLFDYLVDTSRSQEVAHIN  686
             L+D+LV   RSQ   H+N
Sbjct  550  SLYDWLVVEKRSQHF-HLN  567

>PHALS_06476
Length=726

 Score = 223 bits (568),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 129/384 (34%), Positives = 206/384 (54%), Gaps = 26/384 (7%)

Query  298  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  352
            P+ D AL+ P  +  +N+  P ++        A  + P +R+WA+ +  +W         
Sbjct  273  PVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGN  332

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410
              +L VVG  G+GKS     +   +   ++A+H  ++D +  +    +L+S+ HQ+   L
Sbjct  333  DTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNL  392

Query  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDAS-TPGT  469
            P F+ QL RLNL Y+++E DP +LA K+LI+PL ++  P  S  I++D +D+ A+ + G 
Sbjct  393  PLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGR  452

Query  470  N-LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSL  528
            N L+  ++ +    PSWV FL+SS+P   + K LP   VL F  ++  F AD +  V+ +
Sbjct  453  NELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDI  512

Query  529  MDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFA-------MIHSEIDAGMILELPKTL  580
                  DD      +L  KS G+F YL+F  QA +         +  +   ++ ELP+TL
Sbjct  513  SQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETL  572

Query  581  YEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPF--VTESDVQHIFKLG  638
            Y+IY ++FE+K+G+G  R W K +P+L+ IVGAA       A P+  VTE   +    L 
Sbjct  573  YDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAA-------AGPYSLVTEEQAKKQLDLN  625

Query  639  QPDLALIARSFEDIVAVDEETGVY  662
              DL ++ RSF DIVAV  E   Y
Sbjct  626  ADDLRMLRRSFVDIVAVKHEEQFY  649

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)

Query  146  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV  186
            V ++K  V  IRR+VM ELH T+YD+LKE+T+L+GA+ QL 
Sbjct  161  VLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLA  201

>PYAP_17763
Length=794

 Score = 216 bits (550),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 127/413 (31%), Positives = 219/413 (53%), Gaps = 21/413 (5%)

Query  298  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  352
            P+ D AL+ P  +  ++   P ++     Q  +      +R W  ++  +W         
Sbjct  305  PVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGA  364

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKL  410
              VL +VG AG+GK+   + +   Y +Q++A HF ++D +  +S   +L+SL +Q++  L
Sbjct  365  DVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSL  424

Query  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN  470
            P F+ QL RLNL Y+++E D   L+ K+LI+PL ++  PL  + +V DA+D+  +  G N
Sbjct  425  PMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYN  484

Query  471  -LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLM  529
             L   L+ +  E P W+ FL+SS+P      ++P   VL F  ++  +  D    +  + 
Sbjct  485  DLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIA  544

Query  530  DK-HGLDDKNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMI-----LELPKTLYEI  583
               H  D      +LK KS G++ YL+F  QA +    E  +G +      +LP++LYEI
Sbjct  545  AVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEI  604

Query  584  YDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLA  643
            Y+++FE+K+GKGR RVW+K  PVL+ I  AA+  + +     +TE ++       + ++ 
Sbjct  605  YEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQ-----ITEQNIMDSLSYTKDEVR  659

Query  644  LIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
            ++ R+F DI+++    G Y + S  ++D+L D  R  E   I+V   V  L K
Sbjct  660  MLRRAFIDIISI--RHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRK  710

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)

Query  148  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQ  191
            EMK+ +  I+R++M E+H T+YD+LKE+TML+G +MQLV  + Q
Sbjct  189  EMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQ  232

>PYAR_13571
Length=666

 Score = 208 bits (530),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 220/413 (53%), Gaps = 38/413 (9%)

Query  298  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  352
            P+ D AL+ P  +  +++  P L+     Q  A      TR WA ++  +W         
Sbjct  194  PVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGS  253

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKL  410
              +L +VG AG GK+                 HF +++ +  +S   +L+S+ +Q++  L
Sbjct  254  DVLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATL  296

Query  411  PDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN  470
            P F+ QL RLNL Y+++E D + LA K+L++PL S+  PL ++ ++LD +D+     G N
Sbjct  297  PTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYN  356

Query  471  -LISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLM  529
             L+  L+ V  E PSW+ FL++++P     + +P   +L F  ++  +  D  + ++ ++
Sbjct  357  DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIV  416

Query  530  DKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAG-----MILELPKTLYEI  583
                 +D+ +   +LK KS G++ YL+F  QA +    E   G     ++ +LP++LYEI
Sbjct  417  AIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEI  476

Query  584  YDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLA  643
            Y+++FE+K+GKGR R+W+K  PVL+ I  AA+  + +     +TE  V       + D+ 
Sbjct  477  YEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVR  531

Query  644  LIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
            ++ R+F DI+++    G Y + S  LFD+L D  R  E  H++V   V  L +
Sbjct  532  MLRRAFIDIISIRH--GTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRR  582

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 34/44 (77%), Gaps = 0/44 (0%)

Query  155  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAAT  198
             IRR++M E+HT++YD+LKE+TML+G + QL++ M ++    A+
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVAS  163

>PYVX_23590
Length=689

 Score = 181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 194/417 (47%), Gaps = 65/417 (16%)

Query  295  TRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGP  349
            T  P+ D AL+ P     L++  P ++        A    P TR WA  +  +W      
Sbjct  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301

Query  350  TNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQIS  407
              +  +L VVGG G GKST    +       ++A+HF ++D +  ++   +L+SL  Q+ 
Sbjct  302  VGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVV  361

Query  408  CKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DAST  466
              LP F++QL RLNL Y+++EPD  VLA K+LI+PL +   P+ ++ +VLD +D+   S 
Sbjct  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSR  421

Query  467  PG---TNLISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTI  523
             G     L+  LA V  + PSW+  L+SS+P   +   L    +L F  +++ F  D   
Sbjct  422  RGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARF  481

Query  524  AVQSL-MDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAF---AMIHSEIDAGMILELPKT  579
             V  +  +           LL+ K+ G+F YL F  QA     +   E++  M+ +LP++
Sbjct  482  LVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLDDGELELDMLHDLPES  541

Query  580  LYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQ  639
            LYEIY ++FE+                                                 
Sbjct  542  LYEIYLEIFED------------------------------------------------N  553

Query  640  PDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696
             D+ L+ RSF DI+AV    G YR++S  LF++L D +RS E    + + GV  L +
Sbjct  554  DDMRLVKRSFVDIIAV--RGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRR  608

 Score = 40.4 bits (93),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)

Query  148  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG  180
            +++     IRR+VM ELH  +YD+LKE+T+L+G
Sbjct  157  DVRAETQAIRREVMNELHVLRYDVLKEVTVLKG  189

>SPRG_19030
Length=1000

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 84/315 (27%), Positives = 148/315 (47%), Gaps = 36/315 (11%)

Query  317  PF-LNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  375
            PF   +Q   +  L   R W + +Y  W Q     N SR+  V G  G+GKS +++ ++ 
Sbjct  433  PFSFQSQISKLTQLFVAREWVLAKYDAWVQT---PNGSRIFVVSGVIGSGKSAIMAQIIQ  489

Query  376  NYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVV  433
            N PE I A H   ++E    SA   ++SL +Q+S +LP++      LN    ++E  PV 
Sbjct  490  NRPE-IAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVK  545

Query  434  ----LATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFL  489
                L   LLI PL ++  P    V+++D +  +   PG  + +L A + L +PSWV F+
Sbjct  546  SLVDLIHALLIAPLSAIAHPASILVLLIDGI--ECFEPGF-VATLTAHMDL-WPSWVRFV  601

Query  490  LSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTI------AVQSLMDKHGLDDKN-ILFL  542
              +R   SVL+ L  +      ++   + +   I      A+   +       +N I+  
Sbjct  602  FGTREDPSVLQTLQAYMPPAVSLDPSLYESKLDIKAYLHLALTPQLTTESQGKRNEIVDF  661

Query  543  LKAKSQGSFLYLQFVDQAFAMIH---SEIDAGMILELPKTLYEIYDQVFEEKY-GKGRRR  598
            + A+++G FLY + +  A A+     +E+DA      P ++       F+ ++   G  +
Sbjct  662  IAARAEGLFLYARHLVNAIAVGQLQLNELDA-----FPTSMGGCLQHCFDAQFPSIGYYK  716

Query  599  VWQKVQPVLEAIVGA  613
              + ++PVLE +  A
Sbjct  717  --KTIRPVLEVLCAA  729

>SDRG_07983
Length=991

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 80/313 (26%), Positives = 144/313 (46%), Gaps = 32/313 (10%)

Query  317  PF-LNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  375
            PF   +Q   +  L   R W + +Y  W Q     N SR+  + G  G+GKS +++ ++ 
Sbjct  425  PFSFQSQISKLTQLFVAREWVLAKYDAWVQT---PNGSRIFVMSGVIGSGKSAIMAQIIQ  481

Query  376  NYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVV  433
            N PE I A H   ++E    SA   ++SL +Q+S +LP++      +N    ++E  PV 
Sbjct  482  NRPE-IAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVK  537

Query  434  ----LATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFL  489
                L   LLI PL ++  P    V+++D +  D   PG  + +L A + L +PSWV F+
Sbjct  538  SLVDLIHALLIAPLSAIAHPASILVLLIDGI--DCFEPGF-VATLTAHMDL-WPSWVRFV  593

Query  490  LSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQS---------LMDKHGLDDKNIL  540
              +R   SVL+ L  +      ++  P   D  + +++         L  +       I+
Sbjct  594  FGTREDPSVLQTLQAYMPPAVSLD--PSLPDSKLDIKAYLHLALTPQLTSESQSKRNEIV  651

Query  541  FLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVW  600
              + A+S+G FLY + +  A A+   ++    +   P ++       F+ ++        
Sbjct  652  DFIAARSEGLFLYARHLVNAIAV--GQLQLNQLDAFPTSMGGCLQHCFDAQF-PSIEYYK  708

Query  601  QKVQPVLEAIVGA  613
            + ++PVLE +  A
Sbjct  709  KTIRPVLEVLCAA  721

>PHYSO_470533
Length=1084

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 81/305 (27%), Positives = 133/305 (44%), Gaps = 49/305 (16%)

Query  354  RVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HATSAILMSLAHQISCKLP  411
            RV  +VG  G+GK+++ + +V   PE I A HF R ++   H     ++SLA+Q++ +LP
Sbjct  502  RVFWLVGQIGSGKTSVAAQMVQTCPE-IAAFHFARQEDEQTHNARRCVLSLAYQLTTQLP  560

Query  412  DFQQQLVRLN-LAYLIQEPDPVVLATKLLIEPLRSM--PAPLESQVIVLDAV-----DED  463
            ++   L     L  ++     V L ++LLI PL ++  P   +S V+++D +     +  
Sbjct  561  EYAHYLQSHEPLEEMVPVASFVELVSQLLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSS  620

Query  464  ASTPGT-----------NLISLLADVALEFPSWVLFLLSSR---PVDSVLKALPTHDVLH  509
            +S P              L+S+L  +A   P WV  ++ SR   PV S L A    DV+ 
Sbjct  621  SSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLSREDPPVLSKLHAFEPADVII  680

Query  510  FHMEHR---------------------PFAADCTIAVQSLMDKHGLDDKNILFLLKAKSQ  548
             H +H                       FA     AV    + H    + ++ L+  +S+
Sbjct  681  DHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVPANNHEFGLEQVVELIARRSE  740

Query  549  GSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLE  608
            G FLY   V Q  A+    +    + ELP  +     Q F   +        Q+V+PVLE
Sbjct  741  GLFLYAVNVVQ--AITEGRLRLHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLE  797

Query  609  AIVGA  613
             +  A
Sbjct  798  VLCAA  802

>H257_01934
Length=1022

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 138/308 (45%), Gaps = 50/308 (16%)

Query  333  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  392
            R W ++++ +W     P+N  RV  + G  G+GK+ L +H++ N PE ++A H   ++  
Sbjct  463  RAWVLHEFDEWVTSP-PSNARRVFLLTGVIGSGKTALAAHIIQNRPE-VVAFHLASHEGE  520

Query  393  HATSA--ILMSLAHQISCKLPDF-----------QQQLVRLNLAYLIQEPDPVVLATKLL  439
               +    +++L +Q++ +LP +           ++ +   NLA L+QE         LL
Sbjct  521  QTQNGRRCVLNLVYQLTTQLPAYANVLKSQKEPLEETVFVGNLADLVQE---------LL  571

Query  440  IEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVL  499
            I PL  +  P  + VI++D + E       NL+++L      +P+W+ F+ +SR    VL
Sbjct  572  IAPLERIATPPSTMVILIDGI-ECFPCADDNLVAILTASLNRWPAWMRFVFTSREDPRVL  630

Query  500  KALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDK-------------NILFLLKAK  546
              L  + +        P A D   A      +  LD               +++ LL  +
Sbjct  631  SLLQAYML-------PPIALDLACAQSKRDVRQYLDTALGSHFDISPPMPPHVIDLLVDR  683

Query  547  SQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYG-KGRRRVWQKVQP  605
            +QG FLY + +  + +     +D   +  +P T+     Q F  ++    + +V   V+P
Sbjct  684  TQGLFLYARHLVDSISSGQWNLDN--LDNVPTTMGGFLHQNFATQFPVVDKYKV--DVRP  739

Query  606  VLEAIVGA  613
            VLE +  A
Sbjct  740  VLEVVCAA  747

>PYVX_21513
Length=1446

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (48%), Gaps = 31/211 (15%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFV--R  388
            + R W   +  +W  D+    + RV  + G  G+GK+++ + +V  +PE I A HF    
Sbjct  436  TGRDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPE-IAAFHFALQE  494

Query  389  YDERHATSAILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPV----VLATKLLIEPLR  444
             D+ H     ++SLA+Q++ +LP++    V L     ++E  PV     L T LL+EPL 
Sbjct  495  DDQTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLN  551

Query  445  SMPAPLESQVIVLDAVD-----EDASTPGTN------------LISLLADVALEFPSWVL  487
            ++  P +  ++++D ++        S PG +            L+++L  +    PSWV 
Sbjct  552  TIKRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVR  611

Query  488  FLLSSRPVDSVLKAL----PTHDVLHFHMEH  514
             +L SR    V+  L    P+  + HF  E+
Sbjct  612  LVLLSREDHDVMTRLQTYIPSVVIDHFAQEN  642

>PITG_17250
Length=1046

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 105/408 (26%), Positives = 171/408 (42%), Gaps = 64/408 (16%)

Query  333  RTWAINQYIKWAQDAGPT----NESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVR  388
            R W    + +W Q +  +    +  RV  V+G  G+GKS++ + +V   PE I A HF  
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQACPE-IAAFHFAT  508

Query  389  YDER--HATSAILMSLAHQISCKLPDFQQQLVRLN-LAYLIQEPDPVVLATKLLIEPLRS  445
             ++   H     ++SLA+Q++ +LP++   L     L  ++     V L T LLI PL +
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  446  M--PAPLESQVIVLDAVD---EDASTPGTN-----------LISLLADVALEFPSWVLFL  489
            +  P+  +S V+++D V+     + TP              L+S+L  +    P WV  +
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  490  LSSR---PVDSVLKALPTHDVL--HFHMEH----RPF----------------AADCTIA  524
            L SR   PV S L A    DV+   F +++    R F                 A   I 
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  525  VQSLMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIY  584
              S   + G++   ++ L+  +S+G FLY   V QA +     +    + ELP  +    
Sbjct  689  SGSDTGEFGME--QVVELIARRSEGLFLYAVNVVQAIS--EGRLRLHELAELPVGMGAYL  744

Query  585  DQVFEEKYGKGRRRVWQ-KVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLA  643
             Q F   +      V++ +++PVLE    A          P  T + V       Q D A
Sbjct  745  HQFFASHFAD--HDVYKHRIRPVLEVCCAA------YEPLPLATLARVLEWDVYEQRDAA  796

Query  644  LIARSFEDIVAV-DEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERG  690
             +  S   I A  D E  + R     + D++ D S S  V  ++V  G
Sbjct  797  AMLGSLFSIEAGHDPEAQLLRPFHSSVLDWVRD-SNSSGVFFVDVASG  843

>PPTG_11365
Length=1106

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 168/413 (41%), Gaps = 67/413 (16%)

Query  333  RTWAINQYIKWAQDAGPTNESR------VLNVVGGAGAGKSTLLSHLVSNYPEQIMASHF  386
            R W   Q+ +W Q +  ++ +R      V  VVG  G+GK+++ + +V + PE I A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSCPE-IAAFHL  561

Query  387  -VRYDER-HATSAILMSLAHQISCKLPDFQQQLVRLN-LAYLIQEPDPVVLATKLLIEPL  443
              + DE+ H     ++SLA+Q++ +LP++   L     L  ++     V L T LLI PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  444  RSM--PAPLESQVIVLDAVDEDASTPGTN------------------LISLLADVALEFP  483
             ++  P+  +S V+++D V+       ++                   +S+L  +    P
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  484  SWVLFLLSSR---PVDSVLKALPTHDVLHFHMEH------RPF----------------A  518
             WV  +L SR   PV S L+A    DV     +H      R +                 
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  519  ADCTIAVQSLMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPK  578
            A   I   S  + H    + ++ L+  +S+G FLY   V QA +     +    + ELP 
Sbjct  742  AAAQIGTDS-GNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS--EGRLHLHELAELPV  798

Query  579  TLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLG  638
             +     Q F   +         +V+PVLE    A          P  T + V       
Sbjct  799  GMGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAA------YEPLPVATIARVLEWDVYE  851

Query  639  QPDLALIARSFEDIVAV-DEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERG  690
            Q D A +  S   I A  D ET   R     + D++ D+S S  V  ++V  G
Sbjct  852  QRDAATVLGSLFSIEAGNDPETQTLRPFHTSVLDWVRDSS-SSGVFFVDVASG  903

>SPRG_12621
Length=1003

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 92/178 (52%), Gaps = 12/178 (7%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W ++Q  +W Q        +V  V G  G GKS L ++++ + PE + A H V  +
Sbjct  459  AGREWVLDQLDQWKQ-----THDQVFWVTGQIGTGKSALAAYIIQSRPE-VRAFHLVCKE  512

Query  391  ERHATS--AILMSLAHQISCKLPDFQQQLVRLN-LAYLIQEPDPVVLATKLLIEPLRSMP  447
            +    S    ++SLA+Q++ +LP++   L + + L  ++     V L   LL+ PLR++ 
Sbjct  513  DEQTQSHRRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIA  572

Query  448  APLESQ-VIVLDAVD--EDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVLKAL  502
             P  +  VI+LD +D  ED       L+S L  +  + PSWV  +L+SR    V++ L
Sbjct  573  EPATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKL  630

>H310_08292
Length=1007

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 135/307 (44%), Gaps = 45/307 (15%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W ++Q  +W   A     S+   V G  G GK+ L ++++ + PE + A H V  D
Sbjct  453  AGREWVMDQLTQWKASA-----SQTFWVTGQIGTGKTALAAYIIQSQPE-VRAFHLVSKD  506

Query  391  ERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVV----------LATKL  438
            +    +    ++SLA+Q++ +LP +         A  +Q+ +P+           L T L
Sbjct  507  DEQTQNPRRCILSLAYQLTTQLPAY---------AAFLQQGEPLEEIVAVSSVTELVTTL  557

Query  439  LIEPLRSMPAPLESQ-VIVLDAVD--EDASTPGTNLISLLADVALEFPSWVLFLLSSRPV  495
            L+ PL ++  P     VI+LD +D  +DA+      +S L  +  + PSWV  + +SR  
Sbjct  558  LVVPLNAIAQPTTVPLVILLDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSRED  617

Query  496  DSV---LKALPTHDVLHFHMEHRPFAADCTIAVQSLM------DKHGLDDKNILFLLKAK  546
             SV   L+ L     L   ++    +AD    +Q+ +      D+  +     L  + A+
Sbjct  618  PSVMRKLQGLVPQVALDKCVDQS--SADMLKYLQAALVPFVRPDEGAVVPLETLHAIVAR  675

Query  547  SQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPV  606
            S+G FLY   +  A       +D   +   P  +     Q FE+++          ++P+
Sbjct  676  SEGLFLYASHIVHALHQKRLTLDK--LESFPVGMGGYLRQFFEDQFSAHHYET--SIRPL  731

Query  607  LEAIVGA  613
            LE +  A
Sbjct  732  LEVLCAA  738

>SDRG_04575
Length=1003

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 91/178 (51%), Gaps = 12/178 (7%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W ++Q  +W Q        +V  + G  G GKS L ++++ + PE I A H V  +
Sbjct  446  AGREWVLHQLDQWKQ-----THDQVFWITGQIGTGKSALAAYIIQSRPE-IRAFHLVCKE  499

Query  391  ERHATS--AILMSLAHQISCKLPDFQQQLVRLN-LAYLIQEPDPVVLATKLLIEPLRSMP  447
            +    S    ++SLA+Q++ +LP++   L + + L  ++     V L   LL+ PL ++ 
Sbjct  500  DEQTQSHRRCILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIA  559

Query  448  APLESQ-VIVLDAVD--EDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVLKAL  502
             P  +  VI+LD +D  ED       L+S L  +  + PSWV  +L+SR    V++ L
Sbjct  560  EPATTPLVILLDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>PYU1_G002110
Length=999

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 161/369 (44%), Gaps = 53/369 (14%)

Query  333  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  392
            R W I Q  KW     PT  S++  V G  G+GK+ L + LV   PE I A HF   ++ 
Sbjct  432  RKWLIAQLTKWID--SPT-ASQMFWVTGQIGSGKTALAARLVQTIPE-IKAFHFAFEEDE  487

Query  393  HATSA--ILMSLAHQISCKLPDFQQQL-VRLNLAYLIQEPDPVVLATKLLIEPLRSMPAP  449
               +A   ++SLA+Q++ +L D+   L  R  L  L+       L T LLI+PL  + A 
Sbjct  488  QTQNARRCVLSLAYQLTTQLKDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI-AQ  546

Query  450  LESQ----VIVLDAVD-------EDASTP--------GTNLISLLADVALEFPSWVLFLL  490
            L+SQ    V+++D ++       + +S P           L+S L  +  + P WV  ++
Sbjct  547  LQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVRVIV  606

Query  491  SSR---PVDSVLKALPTHDVLHFHMEH-----RPFAAD--CTIAVQSLMDKHGLDDKNIL  540
             SR    +++ L+    + VL  +++      + F     C+ A   L     L    I 
Sbjct  607  LSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQID  666

Query  541  FLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGRRRVW  600
             +++ +S+G FLY   V Q+       +   + + +   LY+ +   F      G ++  
Sbjct  667  LIVE-RSEGLFLYAANVVQSLEEKWFAVGQSLPIGMNGYLYDFFVSHF------GAKQYK  719

Query  601  QKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETG  660
            + ++PVLE +  A     E  + P +       I KL   +   IA +F  ++++  +  
Sbjct  720  RLIRPVLEVLCAA----FEPLSLPTIAS-----ILKLQTNEQQEIATAFGSLLSIGADGS  770

Query  661  VYRLQSKGL  669
            V    S  L
Sbjct  771  VRPFHSSVL  779

>H257_11773
Length=1026

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 89/179 (50%), Gaps = 13/179 (7%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W ++Q  +W       + S+   + G  G GK+ + + ++ N PE + A H V  +
Sbjct  468  AGREWVMDQLTEWK-----ASSSQTFWITGQIGTGKTAVAASVIQNQPE-VRAFHLVSKE  521

Query  391  ERHATS--AILMSLAHQISCKLPDFQQQLVRLN--LAYLIQEPDPVVLATKLLIEPLRSM  446
            +    +    ++SLA+Q++ +LPD+   L + +  L  ++       L   LL+ PL ++
Sbjct  522  DEQTQNHRRCVLSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAI  581

Query  447  PAPLE-SQVIVLDAVD--EDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVLKAL  502
              P     VI++D +D  +D++      +S LA      P WV ++L+SR   SV++ L
Sbjct  582  AQPSTVPLVILIDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKL  640

>PYAR_14788
Length=795

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/151 (32%), Positives = 76/151 (50%), Gaps = 14/151 (9%)

Query  353  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFV--RYDERHATSAILMSLAHQISCKL  410
            S+V  V G  GAGK+++ + +V   PE I A HF     D+       ++SLA+Q++ +L
Sbjct  416  SKVFWVTGQIGAGKTSVAAKMVQTIPE-IAAFHFALQEDDQTQLARRCVLSLAYQLTTQL  474

Query  411  PDFQQQLVRLNLAYLIQEPDPV----VLATKLLIEPLRSMPAPLESQ--VIVLDAVDEDA  464
            P +    V L     ++E  PV     L   LLI PL ++  P   +  ++++D ++  A
Sbjct  475  PAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLA  531

Query  465  STPG--TNLISLLADVALEFPSWVLFLLSSR  493
            S  G     +SLL  +    PSWV  +L SR
Sbjct  532  SNTGGAGGGVSLLPSLIARLPSWVRVILLSR  562

>PYIR_14107
Length=1176

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 90/200 (45%), Gaps = 43/200 (22%)

Query  333  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  392
            R W   Q   W   A PT  ++V  V G  G+GK+ L + +V   PE I A HF   ++ 
Sbjct  550  REWLFMQLENWI--ASPT-ATQVFWVTGQIGSGKTALAARMVQVIPE-IAAFHFALQEDE  605

Query  393  HATSA--ILMSLAHQISCKLPDFQQQL-VRLNLAYLIQEPDPVVLATKLLIEPLRSMPAP  449
               +A   ++SLA+Q++ +LP +   L  R  L  ++   +   L T+LL+EPL  +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  450  LESQ--VIVLDAVDEDAS-------TPGTN---------------------------LIS  473
              ++  V+++D ++  +S       TPGT+                           L+S
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  474  LLADVALEFPSWVLFLLSSR  493
             L  +    P+WV  +L SR
Sbjct  726  ALPSLVARLPNWVRVVLLSR  745

>PYAP_22230
Length=1116

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 89/225 (40%), Gaps = 61/225 (27%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W +    +W  +   T+ S+V  V G  G+GK+++ + +V   PE I A HF   D
Sbjct  494  TGRAWLLESIRQWI-NTPVTSGSKVFWVTGQIGSGKTSVAARMVQLMPE-IAAFHFALQD  551

Query  391  ERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPV----------VLATKL  438
            +     A   ++SLA+Q++ +LP++         A  +Q  DP+           L T L
Sbjct  552  DDQTQLARRCVLSLAYQLTTQLPEY---------AVFLQTGDPLEEIVPVSSVQALLTHL  602

Query  439  LIEPLRSMPAPLESQVIVL--------------------------------------DAV  460
            L+ PL ++  P   + +VL                                         
Sbjct  603  LVNPLNAIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLC  662

Query  461  DEDASTPGTNLISLLADVALEFPSWVLFLLSSRPVDSVLKALPTH  505
            DE + +    L+SLL  +    P WV  +L SR   S+L  L  +
Sbjct  663  DESSGSSDECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVY  707

>PYIW_15717
Length=1121

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 94/213 (44%), Gaps = 42/213 (20%)

Query  331  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  390
            + R W   Q   W   A P+  ++V  V G  G+GK+ L + +V   PE I A HF   +
Sbjct  523  AGREWLFAQLESWI--ASPS-AAQVFWVTGQIGSGKTALAARMVQLIPE-IAAFHFALQE  578

Query  391  ERHATSA--ILMSLAHQISCKLPDFQQQL-VRLNLAYLIQEPDPVVLATKLLIEPLRSMP  447
            +    +A   ++SLA+Q++ +LP +   L  R  L  ++   +   L T+LL+EPL  + 
Sbjct  579  DEQTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIA  638

Query  448  APLESQ---VIVLDAV-----DEDAS--------------TPGTN-------------LI  472
             P  +    V+++D +     D++A               + G+N             L+
Sbjct  639  RPQTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLV  698

Query  473  SLLADVALEFPSWVLFLLSSRPVDSVLKALPTH  505
            S L  +    P WV  +L SR   +++  L  H
Sbjct  699  SALPSLVARLPKWVRVVLLSRKDPAIIAKLQGH  731

>PYU1_G009543
Length=1408

 Score = 38.1 bits (87),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 4/61 (7%)

Query  315  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  373
            HL F  +++      PS     I N Y  W +DA   + S +L VVG  G GKS +L+H 
Sbjct  58   HLAFAKSRKDDFAFAPSPHYVQILNNYCHWDRDA---SHSSILVVVGQPGNGKSAMLAHW  114

Query  374  V  374
            V
Sbjct  115  V  115

>PYIR_13773
Length=1486

 Score = 37.0 bits (84),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 79/195 (41%), Gaps = 31/195 (16%)

Query  315  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  373
            HL F  +++      PS +   I N Y +W +DA     S VL  +   G GKS LL+H 
Sbjct  60   HLAFAKSRKDDFVFTPSLQCMHILNDYCRWDRDA---THSSVLVAISQPGNGKSALLAHW  116

Query  374  VSNYPE------QIMASHF--VRYDERHATSAILMSLAHQISC--KLPDF------QQQL  417
                 E      +++  H+    YD     S  L    +QI     L DF      +++ 
Sbjct  117  ADTRRESEEGAQELIYEHYAGCSYDSVR-LSLFLFRFMNQIKTTYSLRDFELPREHEEEK  175

Query  418  VRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLAD  477
            ++ +    ++       A       L    + L+  ++VLD +D   +  G + +S L  
Sbjct  176  LKFSFGRCLE-------AAVGRTNHLTGTNSKLKRIILVLDGIDCIRNEDGGDSLSWLPT  228

Query  478  VALEFPSWVLFLLSS  492
                FPS V  ++S+
Sbjct  229  T---FPSNVRIIVSA  240

>H310_09588
Length=280

 Score = 35.0 bits (79),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (46%), Gaps = 34/140 (24%)

Query  305  TQPWENVLNQHLPF----LNTQRPAMEMLPSTRTWAINQYIKWAQ--DAGPTNESRVLNV  358
            +Q   N +NQH P      +TQR   ++   T    +++    A+    G T++  V+ V
Sbjct  26   SQSKSNKVNQHAPKKPLPAHTQRVQSDL---TEAQLVSESFTLARRPSDGSTDDILVIGV  82

Query  359  VGGAGAGKSTLLSHLVSNYPEQIMA--SH-FVRYDERHAT----------------SAIL  399
             GG+G+GK+TL   ++ +  +  ++  SH F   D  H +                +A+L
Sbjct  83   CGGSGSGKTTLSKAIIDDIGDNAVSYLSHDFYYKDLSHLSMEQRAEHNFDHPDALDTALL  142

Query  400  MS----LAHQISCKLP--DF  413
            +S    L H I+C +P  DF
Sbjct  143  VSHLAKLKHGIACDIPMYDF  162

>PYIW_17208
Length=198

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (59%), Gaps = 0/46 (0%)

Query  352  ESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSA  397
            + R+L V+GG GAGK T  S LV  Y    +++  +  +ER + SA
Sbjct  6    KKRILFVLGGPGAGKGTQCSKLVEKYGFVHLSAGDLLREERQSGSA  51

>SPRG_08282
Length=1250

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (54%), Gaps = 3/52 (6%)

Query  356   LNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQIS  407
             + +VG  GAGKS+L   L   YP   +AS  +  D R   +  L SL HQIS
Sbjct  1045  IGIVGRTGAGKSSLTMALFRLYP---LASGAICIDGRDIATLSLHSLRHQIS  1093

>SDRG_09748
Length=750

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 35/80 (44%), Gaps = 12/80 (15%)

Query  333  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  392
            R  A+ Q + W + A          +VG +G GKSTLL  L+  YP          YD +
Sbjct  441  RVNAMWQAVFWGEYA---------CIVGPSGCGKSTLLGCLMQFYPISAGTLRLDSYDTQ  491

Query  393  HATSAILMSLAHQISCKLPD  412
            H + A   SLA Q +    D
Sbjct  492  HYSKA---SLADQTAVVFQD  508

>PYIW_20824
Length=1435

 Score = 34.7 bits (78),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 4/59 (7%)

Query  315  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSH  372
            H+ F  +++      PS +   I N Y +W +D   T  S VL V+   G GKS LL+H
Sbjct  55   HVAFAKSRKDDFVFAPSPQCMHILNDYCQWDRD---TAHSSVLVVISQPGNGKSALLAH  110

>PYAP_23079
Length=583

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 16/75 (21%)

Query  358  VVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQL  417
            +VG  GAGKST+LSHL  +   Q+  S FV +D               +   LP+F   +
Sbjct  364  LVGVPGAGKSTILSHL--DTTGQLKLSEFVNFD------------VDDVISMLPEFYHAM  409

Query  418  VRLNL--AYLIQEPD  430
            + + L  A  +++PD
Sbjct  410  LNIGLGNAEPVEDPD  424

>SPRG_14614
Length=993

 Score = 33.9 bits (76),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  358  VVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAIL  399
            +VG +G GKSTLL  L+  YP    A     YD +H + A L
Sbjct  687  IVGPSGCGKSTLLGCLMQFYPISAGALRLDAYDTQHYSKASL  728

>SDRG_09749
Length=992

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query  358  VVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPD  412
            +VG +G GKSTLL  L+  YP          YD +H + A   SLA Q +    D
Sbjct  672  IVGPSGCGKSTLLGCLMQFYPISAGTLRLDSYDTQHYSKA---SLADQTAVVFQD  723

>PYU1_G014376
Length=198

 Score = 32.7 bits (73),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 0/45 (0%)

Query  352  ESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS  396
            + R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  6    KKRILFVLGGPGAGKGTQCSKLVEKYGFVHLSAGDLLREERQSGS  50

>CCA21773
Length=196

 Score = 32.7 bits (73),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  354  RVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS  396
            R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  8    RILFVLGGPGAGKGTQCSKLVQKYGFVHLSAGDLLREERQSGS  50

>CCI41333
Length=196

 Score = 32.3 bits (72),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  354  RVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS  396
            R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  8    RILFVLGGPGAGKGTQCSKLVQKYGFVHLSAGDLLREERQSGS  50

>PHYSO_359310
Length=715

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 52/125 (42%), Gaps = 9/125 (7%)

Query  575  ELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHI  634
            E+ +   E+Y +VF+ K+    R +W    P+ E     A L    N C FV+ +D+  +
Sbjct  133  EMTRVAQEMYTRVFQMKFTPPGRGLWAMGSPITEERGLYAAL----NNCAFVSTADILEL  188

Query  635  FKLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFD-----YLVDTSRSQEVAHINVER  689
                +P   L+  +   +    +  G  +L  +G  +     Y +  SR   V  + +  
Sbjct  189  ETPAEPFCFLMEAAMLGVGVGFDTKGAGKLLVQGCDETKANVYAIPDSREGWVESVKMLL  248

Query  690  GVHYL  694
              H+L
Sbjct  249  EAHFL  253

>SDRG_09480
Length=565

 Score = 33.1 bits (74),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  325  AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  376
             + ++ ST++  I + I    D     E+R + V+G A AGKST L+ L+S+
Sbjct  213  GIRLVSSTKSLGIKEII---GDIKKHRENRDVCVIGAANAGKSTFLNALISH  261

>H257_06450
Length=1259

 Score = 33.1 bits (74),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  355  VLNVVGGAGAGKSTLLSHLVSNYP  378
            +  VVGG G+GKSTLLS L+ + P
Sbjct  442  ICAVVGGVGSGKSTLLSGLLGDAP  465

>PPTG_14604
Length=608

 Score = 33.1 bits (74),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 27/125 (22%), Positives = 53/125 (42%), Gaps = 9/125 (7%)

Query  575  ELPKTLYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHI  634
            E+ +   E+Y ++++ K+    R +W    P+ E     A L    N C FV+ +D+  I
Sbjct  124  EMNRIAQEMYTRIYQMKFTPPGRGLWAMGSPITEDRGLYAAL----NNCAFVSTADILEI  179

Query  635  FKLGQPDLALIARSFEDIVAVDEETGVYRLQSKGLFD-----YLVDTSRSQEVAHINVER  689
                +P   L+  +   +    +  G  +L  +G  +     Y++  SR   V  + +  
Sbjct  180  ATPSKPFCFLMEAAMLGVGVGFDTKGAGKLLVQGCDETKTNTYVIPDSREGWVESVKLLL  239

Query  690  GVHYL  694
              H+L
Sbjct  240  EAHFL  244

>SPRG_08053
Length=563

 Score = 33.1 bits (74),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  325  AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  376
             + ++ ST++  I + I    D     E+R + V+G A AGKST L+ L+S+
Sbjct  213  GIRLVSSTKSLGIKEII---GDIKKHRENRDVCVIGAANAGKSTFLNALISH  261

>SDRG_16746
Length=439

 Score = 32.7 bits (73),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 66/159 (42%), Gaps = 11/159 (7%)

Query  23   KFFRRSASKMSLRGDDVTASMPRERVTLSGVTASAITASNYSSYQLDTLHETVASMNKQL  82
            KFFR     + LR   + AS+ +  V    + A    A     + +D L +   ++   +
Sbjct  256  KFFR----DLMLRMKQLEASLTQVEVEKEDIGARLHGAEKVRDFLMDKLKDLEEALATSM  311

Query  83   DE-YKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAKAYRDEPTGFENTsdapapsma  141
            +E  K    + LD       D   + + ++ + H+     YR E    +          A
Sbjct  312  EETAKAGAQSSLDREVLAYLDVKVQELEDELSVHVAQTDEYRAELERVQR------QHSA  365

Query  142  mdaaVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG  180
                +D+M RHV   +RD+ ++  + K  L+KE+ MLR 
Sbjct  366  KTQVLDDMLRHVTAEKRDLDLQAKSQKKVLVKEVRMLRA  404

Lambda      K        H        a         alpha
   0.318    0.131    0.376    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 56795947620

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40