Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_063541475788488444570.0
SDRG_0176414757109288042130.0
H257_0630514757109988728180.0
H310_0921214757111389827430.0
PYIW_187931475799793019820.0
PYIR_1345314757118680219140.0
PYU1_G0017341475780079218960.0
PYAP_1774614757116991917980.0
PPTG_1712814757117793416970.0
PHYRA_9590114757107588416960.0
PHYSO_32115714757118078816660.0
PHALS_0647714757116689716490.0
PITG_1845714757117081416460.0
PHYCA_344751475769273314780.0
CCI4512214757110590113431e-168
CCA1889814757114785513452e-168
PYAR_13581147577304286971e-78
PHYKE_8394147574282684961e-53
PYIW_131624800116695880.22
SPRG_192655362220057860.38
PYIW_2070412890147470840.65
PYAP_152029463198750840.76
H257_1443114367214892831.1
PHYSO_5000421373891485801.8
SDRG_1167253622193191802.2
SPRG_1827513299436739792.2
PYU1_G005363480098994802.2
PYU1_G0062779463197884792.4
H257_0427812977483239792.7
PYAR_216311627357830783.1
H257_094213275212247783.3
H310_0164616613130185783.4
SDRG_1098616613124482783.4
PYU1_G012671131951052107783.6
PYIR_1876848001146102783.9
H310_133213275210873783.9
SDRG_1218010813116248774.1
PHYRA_9463913738104685774.5
H310_0588212977481339774.5
SDRG_16344123785120223774.8
PYAR_20859946311156124775.0
SDRG_03752480098743756.7
PHALS_083476664146951766.8
PYIR_1418313195132569757.3
H257_165881421110638757.8
PYIR_226456516362862758.0
PYAR_18244480099374748.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_06354

Length=884
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SPRG_06354                                                            1721       0.0   
SDRG_01764                                                            1627       0.0   
H257_06305                                                            1090       0.0   
H310_09212                                                            1061       0.0   
PYIW_18793                                                            768        0.0   
PYIR_13453                                                            741        0.0   
PYU1_G001734                                                          734        0.0   
PYAP_17746                                                            697        0.0   
PPTG_17128                                                            658        0.0   
PHYRA_95901                                                           657        0.0   
PHYSO_321157                                                          646        0.0   
PHALS_06477                                                           639        0.0   
PITG_18457                                                            638        0.0   
PHYCA_34475                                                           573        0.0   
CCI45122                                                              521        1e-168
CCA18898                                                              522        2e-168
PYAR_13581                                                            273        1e-78 
PHYKE_8394                                                            195        1e-53 
PYIW_13162                                                            38.5       0.22  
SPRG_19265                                                            37.7       0.38  
PYIW_20704                                                            37.0       0.65  
PYAP_15202                                                            37.0       0.76  
H257_14431                                                            36.6       1.1   
PHYSO_500042                                                          35.4       1.8   
SDRG_11672                                                            35.4       2.2   
SPRG_18275                                                            35.0       2.2   
PYU1_G005363                                                          35.4       2.2   
PYU1_G006277                                                          35.0       2.4   
H257_04278                                                            35.0       2.7   
PYAR_21631                                                            34.7       3.1   
H257_09421                                                            34.7       3.3   
H310_01646                                                            34.7       3.4   
SDRG_10986                                                            34.7       3.4   
PYU1_G012671                                                          34.7       3.6   
PYIR_18768                                                            34.7       3.9   
H310_13321                                                            34.7       3.9   
SDRG_12180                                                            34.3       4.1   
PHYRA_94639                                                           34.3       4.5   
H310_05882                                                            34.3       4.5   
SDRG_16344                                                            34.3       4.8   
PYAR_20859                                                            34.3       5.0   
SDRG_03752                                                            33.5       6.7   
PHALS_08347                                                           33.9       6.8   
PYIR_14183                                                            33.5       7.3   
H257_16588                                                            33.5       7.8   
PYIR_22645                                                            33.5       8.0   
PYAR_18244                                                            33.1       8.8   

>SPRG_06354
Length=884

 Score = 1721 bits (4457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 884/884 (100%), Positives = 884/884 (100%), Gaps = 0/884 (0%)

Query  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARKRKST  60
            MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKST
Sbjct  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKST  60

Query  61   VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120
            VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH
Sbjct  61   VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120

Query  121  QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180
            QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA
Sbjct  121  QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180

Query  181  AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLR  240
            AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLR
Sbjct  181  AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLR  240

Query  241  QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV  300
            QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV
Sbjct  241  QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV  300

Query  301  VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL  360
            VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL
Sbjct  301  VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL  360

Query  361  QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  420
            QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG
Sbjct  361  QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  420

Query  421  PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA  480
            PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA
Sbjct  421  PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA  480

Query  481  KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG  540
            KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG
Sbjct  481  KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG  540

Query  541  IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  600
            IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE
Sbjct  541  IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  600

Query  601  PSGGVHVTSAQEQLMHVKNKHQSVGavypptavpyaaIRGASLAVAQAMYASGIIGYASI  660
            PSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASI
Sbjct  601  PSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASI  660

Query  661  DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRsflpl  720
            DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPL
Sbjct  661  DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPL  720

Query  721  paprpsslagppaTETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFN  780
            PAPRPSSLAGPPATETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFN
Sbjct  721  PAPRPSSLAGPPATETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFN  780

Query  781  MCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ  840
            MCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ
Sbjct  781  MCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ  840

Query  841  PAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKARSNTSACLV  884
            PAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKARSNTSACLV
Sbjct  841  PAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKARSNTSACLV  884

>SDRG_01764
Length=1092

 Score = 1627 bits (4213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/880 (93%), Positives = 834/880 (95%), Gaps = 2/880 (0%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARKRKST  60
             +QNSKLRLYDRSEQPVKSQPYMNSS FNVASLKLDLAPPPTEPD  P TR AVAR +KS 
Sbjct  214   IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAVARNKKSA  273

Query  61    VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120
             VATVQL+FPGAKDE  D VPVEDP TDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH
Sbjct  274   VATVQLTFPGAKDE-GDVVPVEDPTTDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  332

Query  121   QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180
             QFIIRKGQTL+ETPEFISFKRITEDLWGSVSMAIRELETLL++YSVPLAYIDGQKLLKIA
Sbjct  333   QFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIA  392

Query  181   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLR  240
             AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKG D RHAAAI++QSVYRMH TRR LR
Sbjct  393   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLR  452

Query  241   QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV  300
             QHHGHSYA+HIQRVYRTYK VK+IQVKLRLAREADARTWETQMT FHANWDKIKMQRRVV
Sbjct  453   QHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVV  512

Query  301   VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL  360
             VHVPSFSAEER RLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELS DIQKYMMRLL
Sbjct  513   VHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLL  572

Query  361   QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  420
             QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG
Sbjct  573   QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  632

Query  421   PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA  480
             PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIP+GAHDIYDEDELILSLA
Sbjct  633   PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLA  692

Query  481   KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG  540
             KLTAANLHQGMWLIKLDADPSDTGLA+IDMHALECVNKVR EKRAMKNDEYYSQPNIKEG
Sbjct  693   KLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEG  752

Query  541   IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  600
             IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE
Sbjct  753   IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  812

Query  601   PSGGVHVTSAQEQLMHVKNKHQSVGavypptavpyaaIRGASLAVAQAMYASGIIGYASI  660
             PSGGVH+TSAQEQLM  KNKHQSVGAVYP T VPYAAIRGASLAVAQAMYASGIIGYASI
Sbjct  813   PSGGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASI  872

Query  661   DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRs-flp  719
             DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRS    
Sbjct  873   DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQ  932

Query  720   lpaprpsslagppaTETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFF  779
                    +    P TETQLAVEKIL ES  ++ +G ERAYIAHEYIFHPNMATLQYAVFF
Sbjct  933   PAPHPSPATGQLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFF  992

Query  780   NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV  839
             NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV
Sbjct  993   NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV  1052

Query  840   QPAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKARSNT  879
             QPAPDALTGERLGNFAAVLGAIR RHDDMVKRAKKAR++T
Sbjct  1053  QPAPDALTGERLGNFAAVLGAIRSRHDDMVKRAKKARTST  1092

>H257_06305
Length=1099

 Score = 1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/887 (61%), Positives = 671/887 (76%), Gaps = 17/887 (2%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARK-RKS  59
             +QNS++++YDR+ QPVKS PY N SGFN+ASLK D++  P      P           K 
Sbjct  212   IQNSRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMSTTPATSTPSPVAAVVSGGDVSKM  271

Query  60    TVATVQLSFPGAKDELVDAVPVEDP-----ATDDGPIEPTDTIDELRNNVEKIRGYNDLL  114
              V  + +SF           PVE P       DD     + TI  LR NVEKIRGYN+LL
Sbjct  272   VVTPIDISFDAPSSS---HPPVEQPKGGATGGDDTNGGDSSTIHNLRRNVEKIRGYNELL  328

Query  115   DTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQ  174
             DTYSLHQFIIRKG+TLS+TPEFISF+R TEDLWGSVS +I+ELET+L  YSVPLAY+DGQ
Sbjct  329   DTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQ  388

Query  175   KLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHR  234
             KL+KIAAMDA +R  +ELL+C+LN+DEV++ M RPGQR+KG  G   A ++IQSV+RM  
Sbjct  389   KLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFL  448

Query  235   TRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294
             T++ L+ HHG+  A  IQR+YR+Y+C   +Q +L+L READ R W+ QM  F ANWD +K
Sbjct  449   TKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMK  508

Query  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354
             MQRRVVVHVPSF++++R RL MDNF+IRQNLQMAR+CAIADPNVD+IYISPFELS DIQ+
Sbjct  509   MQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQR  568

Query  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414
             Y +RLLQLGG+ DP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+VRGK AYI
Sbjct  569   YQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYI  628

Query  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474
             V G VGPEDKRLAI LQ+PLLGMDPD+ALLYGTRSG KR+F  ADVNIP GAHDIYDEDE
Sbjct  629   VTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDE  688

Query  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKN--DEYY  532
             LI SL+KL AA++ Q  WL+K+DAD SDTG+A+I++  ++ V KVRAEKR MK+   EY+
Sbjct  689   LIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYF  748

Query  533   SQPNIKEGIVRAIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLA  591
              QP++++ ++R+I  EL+E  F   I+PCFPDVY +W  +RPV  R+G VIEAYP KVL+
Sbjct  749   QQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLS  808

Query  592   RVRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGavypptavpyaaIRGASLAVAQAMYA  651
             +VRANVFIEPSGGVH+TSA +  M   NKH    A++P T+VPY AIRGASLA+A +M+ 
Sbjct  809   QVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCALFPQTSVPYQAIRGASLAIASSMFI  868

Query  652   SGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDA  711
              GIIGYASIDY++F D KT+ G  G P  RLWA+Q++P LT TA+SFV+F FLSC+  + 
Sbjct  869   KGIIGYASIDYMSFADPKTLVG-GGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNP  927

Query  712   ATGR--sflplpaprpsslagppaTETQLAVEKILGESSP--AATMGAERAYIAHEYIFH  767
              TG+    +  P P  +S    P T+ Q AVE IL    P  A   G ER Y+  +YI+H
Sbjct  928   ITGKCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPNGAVVCGPERTYMVLDYIYH  987

Query  768   PNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTR  827
             PNMATL ++ FFN CR++GVSFDLQ++IGAAF+LADSLTAGV+GL+CIGE+DKEA R+ R
Sbjct  988   PNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIAR  1047

Query  828   AALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKK  874
              A+ELIGDQVGVQ  PD+L+GERLGNF  +L  +R + DD   R K+
Sbjct  1048  QAVELIGDQVGVQALPDSLSGERLGNFPHLLAIVRNKSDDPADRRKR  1094

>H310_09212
Length=1113

 Score = 1061 bits (2743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/898 (59%), Positives = 675/898 (75%), Gaps = 24/898 (3%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpA--VARKRK  58
             +QN+++++YDR+ QPVKS PY N SGFN+ASLK D+  P     A  P      +   + 
Sbjct  215   IQNTRVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPTVANVPINQGGDIPPSKT  274

Query  59    STVATVQLSFPGAKDELVDAVPVE-----DPA------TDDGPI-EPTDTIDELRNNVEK  106
             S    + ++F G  +  V   P +     DP+       DDG     + +I  LR NVEK
Sbjct  275   SIPTPIDITFDGHANNAVPFRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEK  334

Query  107   IRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSV  166
             IRGYN+LLDTYSLHQFIIRKG+TL++TPEFISF+R TEDLWGSVS +I+ELE +L +YSV
Sbjct  335   IRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSV  394

Query  167   PLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVI  226
             PLAY+DGQKL+KIAAMD  +R   ELL+C+LN+DEV++ M RPGQRFKG  G   AA+++
Sbjct  395   PLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLL  454

Query  227   QSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTF  286
             QSV+RM+ T++ L+ HHG+  A  IQR+YR+Y+C   +Q +L+  READ R W+ QM  F
Sbjct  455   QSVWRMYITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRF  514

Query  287   HANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPF  346
              ANWD IKMQRRVVVHVPSFS+EER RL M+NF+I+QNLQMAR+CAIADPNVD+IYISPF
Sbjct  515   RANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPF  574

Query  347   ELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRY  406
             ELS DIQKY +RLLQLGG+ADP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+
Sbjct  575   ELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRF  634

Query  407   VRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGA  466
             VRGK+AYIV G VGPEDKRLAI LQLPLLGMDPD+ALLYGTRSG KR+F  ADVNIP GA
Sbjct  635   VRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGA  694

Query  467   HDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAM  526
             HDIYDEDELI SL+KL AA++ Q  WLIK+DAD S+TG+A++++  ++ V K RAEKR M
Sbjct  695   HDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREM  754

Query  527   KND--EYYSQPNIKEGIVRAIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIE  583
             K+   EY+ QP++++ ++R++ +EL+E  F   ++PCFP++Y +W  MRP+  R+G VIE
Sbjct  755   KHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIE  814

Query  584   AYPPKVLARVRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGavypptavpyaaIRGASL  643
             AYP KVL+ VR N+FIEPSGGVH+TSA +  M   NKH    AV+P ++VPY AIRGASL
Sbjct  815   AYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASL  874

Query  644   AVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTF  703
             A+A +M+  GIIGYASIDY++F D K +   +G P  RLWA+Q++P LT TA+SFV+F F
Sbjct  875   AIASSMFIKGIIGYASIDYISFADPKAM--VSGRPRQRLWAMQVVPGLTNTAVSFVMFAF  932

Query  704   LSCATLDAATGRs--flplpaprpsslagppaTETQLAVEKIL---GESSPAATMGAERA  758
             LSC+  +  TG+S   +        S A  P T TQ  +  IL     ++ A+  G ER 
Sbjct  933   LSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAAASVCGPERT  992

Query  759   YIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGES  818
             Y+  +YI+HPNMATLQ+A FFN CR+HGVSFDLQ++IGAA++LADSLTAGVVGL+CIGES
Sbjct  993   YMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGES  1052

Query  819   DKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKAR  876
             DKEA R+ R A+ELIGDQVGVQ  P++L+GERLGNF  +L  +R + DD     ++ R
Sbjct  1053  DKEAFRIARQAVELIGDQVGVQALPNSLSGERLGNFPHLLAIVRNKSDDPAAADRRKR  1110

>PYIW_18793
Length=997

 Score = 768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/930 (43%), Positives = 569/930 (61%), Gaps = 78/930 (8%)

Query  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLapppt-------------------  41
            +QN K R+YDR EQP+++ P+ N SGFN+A+LK DLA                       
Sbjct  59   IQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAV  118

Query  42   epdavpptrpAVARKRKSTVATV------------------QLSFPGAKDELVDAVPVED  83
               +      A  R R   V TV                  Q    G +         E 
Sbjct  119  VNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAES  178

Query  84   PATD-------DGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEF  136
            P T+       D   +  + +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF
Sbjct  179  PETNVDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF  238

Query  137  ISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCV  196
            +SFKR+ +++WGSV   I+ LE LL  Y VPLAY+DGQ+L+ +AAM+  S SK +LL+C+
Sbjct  239  VSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCI  298

Query  197  LNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMH-RTRRLLRQHHGHSYATHIQRVY  255
            +N D+V + + RPGQR+KG D +  AA+ IQ+ +RM    ++  R  H  +    IQRV+
Sbjct  299  VNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVW  358

Query  256  RTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLN  315
            R Y    D++ +++  R+     WE +M     +W +IK  RRVV+HVPSFS +ER RL+
Sbjct  359  RVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLS  418

Query  316  MDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRML  375
             DNF+++QNLQ++RLC + D NVD++Y+SPFEL+ D+ +Y M+LLQLGG+ADP +RV+++
Sbjct  419  ADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLV  478

Query  376  HPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLL  435
             PE+A RFP HFSL T+LLYSPHCL++I+RY++ KEAY+V G  GPEDKRLA+ L +P+L
Sbjct  479  FPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPIL  538

Query  436  GMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIK  495
            GMDP  AL   T+SG KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K
Sbjct  539  GMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLK  598

Query  496  LDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHR  555
            +D DP  TG A +D+  +  + ++R EKR+    EY+ QP  ++   R I+AEL      
Sbjct  599  IDYDPFSTGTALLDVSTMVALREIRREKRS---PEYWRQPGTRDNAARVIIAELERTLGN  655

Query  556  LISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLM  615
            L++P  P++YP+WQ     + + G V+EA P  V+  VRAN+F+EPSG VHV+S Q+ L+
Sbjct  656  LVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILL  715

Query  616  HVKN----------KHQSVGavypptavpyaaIRGASLAVAQAMYASGIIGYASIDYVAF  665
                          +H+SVG  +P TA PY AIRGAS A+ + +    + GYASID++ F
Sbjct  716  SSSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVF  775

Query  666  LDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG-----Rsflpl  720
             + K+          RLWA+ L P LT +A +F  F  L+   L+  +G      + +  
Sbjct  776  QEDKSHTA-------RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTS  828

Query  721  paprpsslagppaTETQLAVEKILGESSPAA-----TMGAERAYIAHEYIFHPNMATLQY  775
             +      +         A + +L E++ +       +GA+  Y+  EYIFHPN++T+QY
Sbjct  829  ASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQY  888

Query  776  AVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGD  835
            + FF+ CR+HGV FD+++ +G+ F+LADSLTAGV GL+C  ++   A+   R ALE++G 
Sbjct  889  SAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGR  948

Query  836  QVGVQPAPDALT--GE-RLGNFAAVLGAIR  862
            +VG Q   D  T  GE   GNFA VL AIR
Sbjct  949  EVGTQALTDEFTSGGEAETGNFADVLAAIR  978

>PYIR_13453
Length=1186

 Score = 741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/802 (46%), Positives = 522/802 (65%), Gaps = 43/802 (5%)

Query  94    TDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMA  153
             T  +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WGSV   
Sbjct  376   TSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEV  435

Query  154   IRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRF  213
             IR LE LL  Y VPLAYIDGQ+L+ +AAM+  + SK +LL+C++N D+V + + RPGQR+
Sbjct  436   IRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRY  495

Query  214   KGGDGRHAAAIVIQSVYRMH-RTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAR  272
             KG D +  AAI IQ+ +RM    ++  R  H  +    IQRV+R +   + ++ KL+  R
Sbjct  496   KGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQR  555

Query  273   EADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCA  332
                   WE +M     +W  IK  RRVV+HVPS S +ER+R++ DNF+++QN+Q++RLC 
Sbjct  556   AQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCG  615

Query  333   IADPNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATI  392
             + DPNVD++Y+SPFEL+ D+ +Y M+LLQLGG+ADP +RV++++PE A RFP HFSL T+
Sbjct  616   LIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTL  675

Query  393   LLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAK  452
             LLYSPHCL++I+RY+R KEAY+V G  G EDKRLA+ L +P+LGMDP  AL   T+SG+K
Sbjct  676   LLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSK  735

Query  453   RLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHA  512
             R F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K+D DP  TG A +D+  
Sbjct  736   RFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVST  795

Query  513   LECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMR  572
             +  + ++R EK   K+ EY+ QP+ ++   RAI+AEL      L++P  P+VYP+WQ   
Sbjct  796   MTVLREIRREK---KSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEFV  852

Query  573   PVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLMHVKN-------------  619
               +++ G V+EA P  V+  VRAN+FIEPSG VHV+S Q+ +    N             
Sbjct  853   DAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAG  912

Query  620   --KHQSVGavypptavpyaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGP  677
               + ++VG  +P TA PY AIRGAS A+ + +    + GY+SIDY+ F + KT       
Sbjct  913   AYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA----  968

Query  678   PHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG---------Rsflplpaprpssl  728
                RLWA+ L P LT +A +F  F  L+   L+A++G                     S 
Sbjct  969   ---RLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPSH  1025

Query  729   agppaTETQLAVEKILGESSPAATM-----GAERAYIAHEYIFHPNMATLQYAVFFNMCR  783
             +         A + ++ E++ +  +     GA+R Y+  EYIFHPN++T+QY+ FF+ CR
Sbjct  1026  SRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCR  1085

Query  784   VHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAP  843
             +HGV FD+++ +G+ F+LADSLTAGV G++C  +S   A+   R ALE+IG +VG Q   
Sbjct  1086  LHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALM  1145

Query  844   DALTG---ERLGNFAAVLGAIR  862
             D   G      GNFA VL  IR
Sbjct  1146  DEFMGGGESETGNFADVLAVIR  1167

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)

Query  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDL  36
            ++NSK R+YDR EQP++S P  N SGFNVASLK D+
Sbjct  224  IKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDI  259

>PYU1_G001734
Length=800

 Score = 734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/792 (47%), Positives = 522/792 (66%), Gaps = 38/792 (5%)

Query  97   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRE  156
            +D+LR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WG V   I+ 
Sbjct  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  157  LETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGG  216
            LETLL  Y VPLAY+DGQ+L+ +A+M+  S SK +LL+C++N D+V + + RPGQR+KG 
Sbjct  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  217  DGRHAAAIVIQSVYRMHRTRRLLRQHHGH-SYATHIQRVYRTYKCVKDIQVKLRLAREAD  275
            D +  AAI IQ+V+RM   ++   ++  H S    IQ+V+R Y   +D++ KL+  R+  
Sbjct  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  276  ARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIAD  335
               WE +M      W +IK  RRV++HVPS S +ER R+  DNFA++QNLQ++RLC I D
Sbjct  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  336  PNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLY  395
             NVD++Y+SPFEL+ ++ +Y M+LLQLGG+ADP +RV+++ PE A RFP HFSL T+LLY
Sbjct  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  396  SPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLF  455
            SPHCL++I+R V+GKEAY+V G  G EDKRLA+ L +P+LGMDP   L   T+SG+KR F
Sbjct  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  456  TQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALEC  515
             +ADVN+P G +DIYDEDELI SLAKL  +++ Q +WL+K+D DP  TG A +D   +  
Sbjct  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  516  VNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVV  575
            + ++R EK   K+ EY+ QP  ++   R I+AEL     +L++P  P+VYPTWQ     +
Sbjct  421  LREIRREK---KSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAI  477

Query  576  NRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLMHVKNKHQS--VGavypptav  633
             + G VIEA P  ++  +RAN+F+EPSG VHV+S Q+ ++   + H+    G  +P T  
Sbjct  478  AQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTA  537

Query  634  pyaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL-RLWALQLLPCLT  692
            PY AIRGAS+A+ + +    + GY+S+DY+ F + KT        H+ RLWA+ L P LT
Sbjct  538  PYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT--------HVPRLWAMALHPYLT  589

Query  693  PTAMSFVLFTFLSCATLDAATGR-----------------sflplpaprpsslagppaTE  735
             +A +F +F  L+   L+  TG+                 S + L     S+ A   AT 
Sbjct  590  DSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATS  649

Query  736  TQLAVEKI--LGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQK  793
              L +++   LG  S     GA+R Y  +EYIFHPN++T+QY+ FF+ CR+HGV FD+++
Sbjct  650  ANLVLQEATHLGLVS-LEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVER  708

Query  794  SIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGE---R  850
              G  F+LADSLTAGV G++C G++   A+   R ALE+IG +VG Q   D L G     
Sbjct  709  CFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCE  768

Query  851  LGNFAAVLGAIR  862
             GNFA VL  +R
Sbjct  769  SGNFAEVLTVVR  780

>PYAP_17746
Length=1169

 Score = 697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/919 (42%), Positives = 558/919 (61%), Gaps = 60/919 (7%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARKRK--  58
             +QN  ++L+ R EQPV++  Y +   FN+A+LK D+A   T   A   +           
Sbjct  232   IQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALP  291

Query  59    -STVATVQLSFPGAKDELV------------------DAVPVEDPATDDGPIEPTDTIDE  99
                + TV +SF   K E                    D  P+E    D    E  +++++
Sbjct  292   LRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMED  351

Query  100   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELET  159
             LRNNVEKIRGYN+LLD YSLHQFII KG+ L +TPEF SFKR+ +++WGS+   I+ LE 
Sbjct  352   LRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEI  411

Query  160   LLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGR  219
             LL  Y VPLAYIDGQ+L+ +A+M+    S  ELLTCV+N D+V + + RPGQR+KG D +
Sbjct  412   LLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRK  471

Query  220   HAAAIVIQSVYRM--HRTR-RLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADA  276
               AA  +Q+ +RM  HR R R +R++   S A  IQ+ +R+Y C + ++ +L   RE   
Sbjct  472   RRAATTLQAFFRMVLHRNRFRKIRRN--GSSAMLIQKTWRSYACQQSLRRRLAHVREERL  529

Query  277   RTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADP  336
               W+ ++    + W  I+ QRRVV+HV S S +ER RL+M+NF+++QNLQ++RL  + D 
Sbjct  530   GEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQ  589

Query  337   NVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  396
             NV+++Y++PFELS ++ +Y ++LLQL G+A+ H+RVR++ PE+A +FP+HFSLAT L+YS
Sbjct  590   NVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYS  649

Query  397   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLG-MDPDRALLYGTRSGAKRLF  455
             P+C+++I+R V+GKEAY+V G  GPED+RLA+ LQ+P+LG  DP   L   TRSG+KR F
Sbjct  650   PNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFF  709

Query  456   TQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALEC  515
              +ADVN+P G +DIYD DEL+ SLAKL  ++L+Q +WL+KLDADP  TG A +D+  +  
Sbjct  710   IKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTT  769

Query  516   VNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVV  575
             +  +R EKR     EY+ QP I++ I RA++ EL  +   L+ P  P+++ +W+     +
Sbjct  770   LRDIRREKRP---PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAI  826

Query  576   NRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLMH-----VKNKHQSVGavypp  630
                G V+EA P  V   +R N+FIEPSG VHV S  + L        + + +    V+P 
Sbjct  827   PEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQ  886

Query  631   tavpyaaIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPHL--RLWALQL  687
             T VP+ AI GAS AV + +Y      GYAS+D     +    +     PH   RLWA+ L
Sbjct  887   TLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTS-----PHKAERLWAVSL  941

Query  688   LPCLTPTAMSFVLFTFLSCATLDAATGRsflplpaprpsslagppaTETQLAVEKILGES  747
              P LT +A +F  F  L    L+ ATGR  L      P        +     +++I    
Sbjct  942   FPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIGTLDRI----  997

Query  748   SPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  807
                   GA R+Y   EY+FHPN++ + Y  FF+ CR+HGV FD+++ +G+ F+LADSLTA
Sbjct  998   ------GAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTA  1051

Query  808   GVVGLLCIGESDKEAVRLTRAALELIGDQVGVQP--APDALTGERL---GNFAAVLGAIR  862
             G+ G+L  GES  +A++  R A E+IG +VG Q   + D+  G  +   GNFA +LG   
Sbjct  1052  GIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGL--  1109

Query  863   LRHDDMVKRAKKARSNTSA  881
             LRH   +++ K+ R   +A
Sbjct  1110  LRHRLSLEKEKEKRDRATA  1128

>PPTG_17128
Length=1177

 Score = 658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/934 (42%), Positives = 548/934 (59%), Gaps = 85/934 (9%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptr-----pAVAR  55
             M+    R+YDRSEQ V+S P+  S+G+N+ASLK DL  PPT P  +P ++      +  R
Sbjct  238   MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPPESTTR  297

Query  56    KR---KSTVAT----VQLSFPGAKDELV--------------------------------  76
             +R   KS+       V +SFP + +++                                 
Sbjct  298   RRSVRKSSAVQGPNRVTMSFPKSGNKVKNSRSAHQTSLMSAAVAAFTNQGEDMDNNRGRF  357

Query  77    --DAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETP  134
               D V  ED   D+   +    ++EL  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TP
Sbjct  358   SDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTP  417

Query  135   EFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLT  194
             EFISF+R+ ++LWGSV  A+R LE LL  Y VPLAY+DGQ+LL +A       SK ELL+
Sbjct  418   EFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLS  477

Query  195   CVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLRQHHGHSY-ATHIQR  253
             C++N D++ + + RPGQR+KG D +  AA  +Q+  RM   RR   +       AT IQ 
Sbjct  478   CIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQL  537

Query  254   VYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERAR  313
              +R Y C   ++ +LR  R      WE +M T  + W +I  +RRVVVHVPS S +E  R
Sbjct  538   AWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYR  597

Query  314   LNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSR  371
             L+ +NFA++QNLQ+ R+CA+A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+ D   R
Sbjct  598   LSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPR  657

Query  372   VRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQ  431
             V+ + PE + RFP HFSL+++LLYSPHCL++I+ Y  GKEAY+V G  G ED+RLAI L 
Sbjct  658   VKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALD  717

Query  432   LPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGM  491
             LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  +LAKL  A++ Q  
Sbjct  718   LPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPK  777

Query  492   WLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE  551
             WLIKLD DP   G A +D+  ++ + ++R EKR     EY+ QP  ++   + I+AEL  
Sbjct  778   WLIKLDYDPLGVGEAVVDLSNIQAMRELRREKR---TPEYWRQPGPRDAAAKMILAELER  834

Query  552   --QFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLAR-------------VRAN  596
                  RL +P   +++PTW+     V   G VIEA PP  +A              VRAN
Sbjct  835   PGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRAN  894

Query  597   VFIEPSGGVHVTSAQEQLMHVKN--KHQSVGavypptavpyaaIRGASLAVAQAMYASGI  654
             +F++P G VHVTS Q  L         ++V   +P TA P+ AI+GA  A  + +  + +
Sbjct  895   LFVDPDGSVHVTSTQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNV  954

Query  655   IGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG  714
              GY S+D+V F D K+     G P  RLWAL + P LT +A SF  F  L+   LD  +G
Sbjct  955   WGYVSLDFVVFQDEKS----NGAP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSG  1008

Query  715   RsflplpaprpsslagppaTETQLAVEKILGESSPA--ATMGAERAYIAHEYIFHPNMAT  772
                +   +    +        T L    +L E+S A  +  GA R ++   Y+FHP++ T
Sbjct  1009  AYRVASKSLTTVTGRNGSGCTTDL----LLREASLAKDSLAGAPRCFVVCSYVFHPHVTT  1064

Query  773   LQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALEL  832
             +QY  FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+
Sbjct  1065  MQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEV  1124

Query  833   IGDQVG----VQPAPDALTGERLGNFAAVLGAIR  862
             IG + G    +  +P      R GNFA VL A+R
Sbjct  1125  IGREAGSTINMVSSPSRPVSGRSGNFAQVLSAVR  1158

>PHYRA_95901
Length=1075

 Score = 657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/884 (42%), Positives = 532/884 (60%), Gaps = 62/884 (7%)

Query  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARKRKST  60
             M+    R+YDRSEQP ++ P+  S+G+N+A+LK DL                  +  +S 
Sbjct  213   MKQRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRST------------GTGKNDRSN  260

Query  61    VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120
                      G ++ +   +  ED    D   +    ++EL  NV+KIRGYNDLLD YSLH
Sbjct  261   D-----DMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLH  315

Query  121   QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180
             QF+I KG+++ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLAY+DGQ+LL +A
Sbjct  316   QFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLA  375

Query  181   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRR-LL  239
             A      SKSELL C++N ++V + + RPGQR+KG D +  AA  IQ+  RM   RR  +
Sbjct  376   ATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  435

Query  240   RQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRV  299
             R       AT IQ  +R+Y C   ++ +LR  R      WE +M      W +I  +RRV
Sbjct  436   RSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRV  495

Query  300   VVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSVDIQKYMM  357
             VVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D +VD+ +Y+SPFEL+ D+ +Y +
Sbjct  496   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFL  555

Query  358   RLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAG  417
             +LLQLGG+AD   RV+++ PE A RFP+HFSL+++LLYSPHCL++I+ Y  GKEAY+V G
Sbjct  556   KLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMG  615

Query  418   TVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELIL  477
               G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  
Sbjct  616   LPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA  675

Query  478   SLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNI  537
             +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ + ++R EKR     EY+ QP  
Sbjct  676   ALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR---TPEYWRQPGP  732

Query  538   KEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLAR---  592
             ++   + ++AEL       RL +P   +++P W+     +   G VIEA PP  +A    
Sbjct  733   RDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPE  792

Query  593   ----------VRANVFIEPSGGVHVTSAQEQLMHVKNKHQSVGavypptavpyaaIRGAS  642
                       VRAN+F+ P G   + S+   L       ++V   +P TA P+ A++GA 
Sbjct  793   SSSLLVEPAYVRANLFVYPDGKNVLASSGGGL-----NRKTVAFTFPQTAAPHEAVQGAC  847

Query  643   LAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFT  702
              A  + +  + + GY S+D+V F D K  NG  G P  RLWAL + P LT +A SF  F 
Sbjct  848   DATGKLLVETSVWGYVSLDFVVFQDEK--NG--GSP--RLWALAVHPFLTDSAASFACFH  901

Query  703   FLSCATLDAATGRsflplpaprpsslagppaTETQLAVEKILGESS--PAATMGAERAYI  760
              L+         R    + A      A P  + +  A + +L E+S   AA  GA R ++
Sbjct  902   LLA---------RGAYRVAASNSMVNANPGRSGSGGAADLLLREASLTKAALAGAPRCFV  952

Query  761   AHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDK  820
                Y+FHP++ T+QY+ FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L +GE+ +
Sbjct  953   VCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTE  1012

Query  821   EAVRLTRAALELIGDQVG--VQPAPDALTGERLGNFAAVLGAIR  862
              A+   R ALE+IG +VG  ++ A       R GNFA VL A+R
Sbjct  1013  GALAFLRTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVR  1056

>PHYSO_321157
Length=1180

 Score = 646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/788 (43%), Positives = 485/788 (62%), Gaps = 35/788 (4%)

Query  100   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELET  159
             L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LET
Sbjct  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALET  443

Query  160   LLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGR  219
             LL  Y VPLAY DGQ+LL +A+      SK ELL+C++N ++V   + RPGQR+KG D +
Sbjct  444   LLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503

Query  220   HAAAIVIQSVYRMHRTRR-LLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADART  278
               AA  IQ+  RM   RR  +R       AT IQ  +R + C   ++ +LR  R      
Sbjct  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDN  563

Query  279   WETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPN  337
             WE +M      W +I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D N
Sbjct  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623

Query  338   VDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  396
             VD+ +Y++PFEL+ D+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYS
Sbjct  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683

Query  397   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFT  456
             PHCL++I+ Y  GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL  
Sbjct  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLI  743

Query  457   QADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECV  516
             +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ +
Sbjct  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803

Query  517   NKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPV  574
              ++R EK   K  EY+ QP  ++   + ++AEL       RL +P   +++P+W+     
Sbjct  804   RELRREK---KTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEA  860

Query  575   VNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHVTSAQEQLMHVKN-K  620
             ++  G V+EA PP                A VRAN+FI+P G VH+TS Q  L       
Sbjct  861   ISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLN  920

Query  621   HQSVGavypptavpyaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL  680
              ++V   +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  
Sbjct  921   RKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--  974

Query  681   RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRsflplpaprpsslagppaTETQLAV  740
             RLWAL + P LT +A SF  F  L+   LDA++G  +    A    +      +      
Sbjct  975   RLWALAVHPFLTDSAASFACFHLLARGVLDASSG-GYRMAAANSTLAAVNSGRSGGGGTT  1033

Query  741   EKILGESSPA--ATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAA  798
             + +L E+S A  A  G  R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G  
Sbjct  1034  DLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1093

Query  799   FVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGERLGNF  854
             F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P      R GNF
Sbjct  1094  FLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNF  1153

Query  855   AAVLGAIR  862
             A VL A+R
Sbjct  1154  AQVLSAVR  1161

 Score = 43.5 bits (101),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)

Query  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDL  36
            M+    R++DRSEQ V+  P+  S+G+N+A+LK DL
Sbjct  238  MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDL  273

>PHALS_06477
Length=1166

 Score = 639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/897 (39%), Positives = 521/897 (58%), Gaps = 52/897 (6%)

Query  8     LYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepda-----vpptrpAVARKRKSTVA  62
             +YDRS++  +  P + S GFN+A LK D     T   A           ++   + S++ 
Sbjct  260   IYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPNTKFSSIM  319

Query  63    TVQLSFPGAKDELVDAVP------VEDPAT----DDGPIEPTDTIDELRN----------  102
                 S P  ++ LV A P      +E+  T    D    E +D  D +++          
Sbjct  320   QTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEGSDDSDIIKDEGFSTKDLAV  379

Query  103   NVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLV  162
             NV KIR YNDL+D YSLHQ +I KG+ + +TPEF SF+R+  DLWGSV   +R LE +L 
Sbjct  380   NVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILF  439

Query  163   HYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAA  222
              Y VPLA++DGQ+L+ +A+ +    S+ ELL+C++N ++V + + RPGQR+ G D +H A
Sbjct  440   QYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRA  499

Query  223   AIVIQSVYRMHRTR-RLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWET  281
             A  IQ+  RM     R ++    +  A  IQ  +R Y     ++ +LR  R   A  WE 
Sbjct  500   ATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEA  559

Query  282   QMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVDV  340
             +M  F + W +I  +RR+VVHVPS S  E +RLN +NFA++QNLQ+ R+CA A D  VD+
Sbjct  560   RMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDL  619

Query  341   -IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHC  399
              +Y+SP+EL+ D+ +Y  +LLQL G AD   RV+ ++PE A RFP HFSL++++LYSP+C
Sbjct  620   LVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYC  679

Query  400   LKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQAD  459
             L++I+ Y  G EAY+V G  GPED+RLAI L LP+LG  P +AL   TRSG KRL  QAD
Sbjct  680   LRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQAD  739

Query  460   VNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKV  519
             +N+P G +++YDE E+ ++LAKL  A++ Q  WLIKLD DP   G A +D+ +++ + ++
Sbjct  740   INVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMREL  799

Query  520   RAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPVVNR  577
               EKR     EY+ QP  ++      + E     +  RL +P   ++YPTW+     +  
Sbjct  800   HREKR---TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGH  856

Query  578   IGAVIEAYPPKVLAR-------VRANVFIEPSGGVHVTSAQEQLMHVKN--KHQSVGavy  628
              G VIEA PP   A        +RAN+F++P+G VH+TS Q  L   +     +S    +
Sbjct  857   FGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFAF  916

Query  629   pptavpyaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLL  688
             P T  P+AAI+GA  AV + +  + + GY S+D+V F D+K+         +RLWAL + 
Sbjct  917   PQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAA------VRLWALAIH  970

Query  689   PCLTPTAMSFVLFTFLSCATLDAATGRsflplpaprpsslagppaTETQLAVEKILGESS  748
             P LT +A +F  F  L+   LDA +G  +      +  +      +    A++ +L E+S
Sbjct  971   PFLTNSAATFACFHLLTRGCLDANSG-IYRVPGTKKLQTACTAEQSGNHDAMDLLLREAS  1029

Query  749   --PAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLT  806
                A   GA R Y+   Y+FHPN+   QY  FF  CR+HGV FD+ +++G  F+LADSLT
Sbjct  1030  LTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLT  1089

Query  807   AGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGER-LGNFAAVLGAIR  862
             AGV G+L IGE+ ++A+   R ALE+IG + G      + +    LGNFA VL  +R
Sbjct  1090  AGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFADVLSTVR  1146

>PITG_18457
Length=1170

 Score = 638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/814 (43%), Positives = 501/814 (62%), Gaps = 39/814 (5%)

Query  77    DAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEF  136
             D +  E+  +D+   +    +++L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF
Sbjct  351   DDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEF  410

Query  137   ISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCV  196
             +SF+R+T++LWGSV  A+R LETLL  Y VPLAY+DGQ+LL +A       SK ELL+C+
Sbjct  411   VSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCI  470

Query  197   LNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLRQHHGHSY-ATHIQRVY  255
             +N D+V + + RPGQR+KG D +  AA  I++  RM   RR   +     + A+ IQ  +
Sbjct  471   VNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAW  530

Query  256   RTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLN  315
             R Y C   ++ +LR         WE +M    ++W +I  +RRVVVHVPS S +E +RL 
Sbjct  531   RAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLG  590

Query  316   MDNFAIRQNLQMARLCAIA-DPNVDVI-YISPFELSVDIQKYMMRLLQLGGVADPHSRVR  373
              +NFAI+QNLQ+ R+CA A D NV+++ Y+SPFEL+ D+ +Y ++LLQLGG+ D   RV+
Sbjct  591   AENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVK  650

Query  374   MLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLP  433
             ++ PE   RFP HFSL+++LLYSPHCL++I+ Y  GKEAY+V G  G ED+RLA+ L LP
Sbjct  651   LVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLP  710

Query  434   LLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWL  493
             +LG  P +AL   TRSG KRL  +ADVN+P G +++YDE E+  +LAKL  A++ Q  WL
Sbjct  711   ILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWL  770

Query  494   IKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--  551
             IKLD DP D G A +D+  ++ + ++R EKR     EY+ QP  ++   + I+AEL    
Sbjct  771   IKLDYDPLDVGEAVVDLSNMQAMRELRREKR---TPEYWRQPGPRDAAAKLILAELERPG  827

Query  552   QFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLAR-------------VRANVF  598
                R+ +P   +++P W+     V   G V+EA PP  +A              VRAN+F
Sbjct  828   MLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLF  887

Query  599   IEPSGGVHVTSAQEQLMHVKN--KHQSVGavypptavpyaaIRGASLAVAQAMYASGIIG  656
             ++P G VH++S Q  L         ++V   +P TA PY AI+GA  A  + +  + + G
Sbjct  888   VDPDGSVHISSTQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWG  947

Query  657   YASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG--  714
             Y S+D+V F D K+ +        RLWAL + P LT +A SF  F  L+   LD  +G  
Sbjct  948   YVSLDFVVFQDEKSNDAP------RLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVY  1001

Query  715   RsflplpaprpsslagppaTETQLAV-EKILGESSPAATMGAERAYIAHEYIFHPNMATL  773
             R          S       + T L + E +L +SS    +GA R ++A  Y+FHP++ T+
Sbjct  1002  RVANKSLTTANSGRKSESGSATDLLLREALLAKSS---LVGARRCFVACSYVFHPHVITM  1058

Query  774   QYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELI  833
             QY  FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+I
Sbjct  1059  QYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVI  1118

Query  834   GDQVG----VQPAPDALTGERLGNFAAVLGAIRL  863
             G + G    V  +P      R GNFA +L AIR+
Sbjct  1119  GREAGSTISVASSPSRSVASRSGNFAQILSAIRV  1152

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)

Query  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDL  36
            M+    R+Y+RSEQ V+S P+  S+G+N+ASLK DL
Sbjct  232  MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDL  267

>PHYCA_34475
Length=692

 Score = 573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/733 (43%), Positives = 442/733 (60%), Gaps = 61/733 (8%)

Query  108  RGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVP  167
            RGYN+LLD YSLHQF+I KG+T+ +TPEFISF R+ ++LWGSV  A+R LETLL HY VP
Sbjct  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  168  LAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQ  227
            LAY+DGQ+LL +AA      SK ELL+C++N ++V   + RPGQR+KG D +  AA  IQ
Sbjct  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  228  S-VYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTF  286
            + V      RR  R       AT IQ  +R Y C   ++ +LR  R      WE +M   
Sbjct  121  AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  287  HANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYIS  344
             + W +I   RRVVVHVPS S +E +RL+ +N A+RQNLQ+ R+CA A D  VD+ +Y+S
Sbjct  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  345  PFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIK  404
            PFEL+ D+ +Y ++LLQLGG+AD   RV++L PE A RFP HFSL+++LLYSPHCL++I+
Sbjct  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  405  RYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPY  464
             Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P 
Sbjct  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  465  GAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKR  524
            G +++YDE EL  +LAKL  A++ Q  WL KLD DP   G A +D+  ++ + ++R EKR
Sbjct  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  525  AMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPVVNRIGAVI  582
                 EY+ QP  ++   + ++ EL       RL  P   D++P+W      +   G VI
Sbjct  421  ---TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVI  477

Query  583  EAYPPKVL-------------ARVRANVFIEPSGGVHVTSAQEQLMHVKN--KHQSVGav  627
            EA P   +             A +RAN+F++P G VHVTS    L         ++V   
Sbjct  478  EAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFT  537

Query  628  ypptavpyaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  687
            +P TA P+ A++GA  A  + +  + + GY S+D+V F D K+ NG       RLWAL +
Sbjct  538  FPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS-NGAP-----RLWALAV  591

Query  688  LPCLTPTAMSFVLFTFLSCATLDAATGRsflplpaprpsslagppaTETQLAVEKILGES  747
             P LT +A SF  F  L+   LDA +G                         V ++   S
Sbjct  592  HPFLTDSAASFACFHLLARGVLDANSG-------------------------VYRMAAAS  626

Query  748  SPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  807
            +P       R ++   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G  F+LADSLTA
Sbjct  627  TP-------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTA  679

Query  808  GVVGLLCIGESDK  820
            GV G+L IGE+ +
Sbjct  680  GVFGVLSIGETTE  692

>CCI45122
Length=1105

 Score = 521 bits (1343),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 319/901 (35%), Positives = 491/901 (54%), Gaps = 66/901 (7%)

Query  8     LYDRSEQPVKSQPYMNSSGFNVASLKLDLap--------pptepdavpptrpAVARKRKS  59
             L++R E+P+K+ PY  +   N+ S+K D                + +  T    +++R  
Sbjct  221   LHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNG  280

Query  60    TVATVQLSFP---GAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDT  116
              +   Q+S     G +++     P  DP+   G I+    I    N+V K     ++  T
Sbjct  281   ALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPI--FLNDVTK-SLVGEISKT  337

Query  117   YSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKL  176
             Y    F+I +G    + PEF +F+RI   +W SV + +  L  +L  Y +P+AYI+GQ++
Sbjct  338   YD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRI  394

Query  177   LKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRM--HR  234
             L +A  D V  +  +L++C+ N DEV   +++PGQRF+G +    A I +QS  RM  HR
Sbjct  395   LTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHR  454

Query  235   TRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294
              +R L   + +   T IQR +R +   K  ++K+   RE     +   M +F +NWDKI+
Sbjct  455   -KRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIR  513

Query  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354
             MQRR ++H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI PFEL+ DI +
Sbjct  514   MQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQ  573

Query  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414
             Y M+LLQLGG++D  +R++++ PENA RFP HFSL++++LYSP  L ++ R +RG+ AY+
Sbjct  574   YYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYM  633

Query  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474
             V G  G EDKR+A  L +P+LG+D  ++L   T SG+KR F +A+VN      D+YDE+E
Sbjct  634   VPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENE  693

Query  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQ  534
             LI SLAKL A++ HQ   +++LD DP  TG+A +D+  L+ V +VR   + +   E + Q
Sbjct  694   LIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTL---ESWLQ  750

Query  535   PNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVR  594
             P I+  ++R +V E+       I    P+++P+ +     +   G +IE  P K    VR
Sbjct  751   PPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVR  810

Query  595   ANVFIEPSGGVHVTSAQEQLMHVKN--------------------KHQSVGavypptavp  634
             AN+FIEPS  V V+S  E  +H                       K ++ G  +P T + 
Sbjct  811   ANLFIEPSRRVCVSSTHE--IHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLID  868

Query  635   yaaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPT  694
             +  ++ ASLA+ QA+   GI GY S+D+V  LD +T           L+A  L P LT T
Sbjct  869   HEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-------LYATGLQPFLTNT  921

Query  695   AMSFVLFTFLS-CATLDAATGRsflplpaprpssl----agppaTETQLAVEKILGESSP  749
             A SF LF  LS   + ++ TG   LP   P         +   AT+  +   ++ G  S 
Sbjct  922   AASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSN  981

Query  750   AATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGV  809
                    R Y   EY+ +P +ATL  + FF  CR  GV FD ++  G  F+LADSLTAGV
Sbjct  982   VLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGV  1041

Query  810   VGLLCIGESDKEAVRLTRAALELI----GDQVGVQPAPDAL-----TGERLGNFAAVLGA  860
              G++CI ++ K A+   RAA+E I    G ++ V  + D +     T      F+ +L A
Sbjct  1042  FGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSDGMNELIRTDRMRDQFSEILRA  1101

Query  861   I  861
             +
Sbjct  1102  L  1102

>CCA18898
Length=1147

 Score = 522 bits (1345),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 303/855 (35%), Positives = 471/855 (55%), Gaps = 55/855 (6%)

Query  7     RLYDRSEQPVKSQPYMNSSGFNVASLKLDLappp-----------tepdavpptrpAVAR  55
             +L++R E+P+++ P  ++   ++ SLK D + P             +             
Sbjct  260   QLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVTHFNDQALGECN  319

Query  56    KRKSTVATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLD  115
              R ST         G +++     P  D +   G I       ++  + E  +G N    
Sbjct  320   CRLSTNQVSMALINGFREDNSKLSPSRDHSKKMG-IPKVIKSTKINTDTESHKGNNSSNH  378

Query  116   TYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQK  175
              +++HQ I+ + ++     +F SF+    D+W +V   +  LE LL  Y +P+A+I+GQ+
Sbjct  379   DFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQR  433

Query  176   LLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRT  235
             +L ++  +    +  +LL+CV N  EV   + +PGQRF+G +    AA+ +QS  RM   
Sbjct  434   ILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITF  493

Query  236   RR-LLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIK  294
             RR  L     H     IQ+ +R Y   K  ++K+   RE     +   M +F +NWDKI+
Sbjct  494   RRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIR  553

Query  295   MQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQK  354
              QRR V+H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI PFEL+ DI +
Sbjct  554   TQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQ  613

Query  355   YMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYI  414
             Y M+LLQL G++D  +R++++ PENA RFP HFSL+ ++L SPH +K++ RY+RG+ AY+
Sbjct  614   YYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYL  673

Query  415   VAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDE  474
             V G  G EDKRLA  L++P+LG+DP +     T SG KR F + + N   G+ D+YDE+E
Sbjct  674   VPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENE  733

Query  475   LILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQ  534
             LI SLAKL AAN HQ   ++KLD DP  TG A +D+  L+ +  +R   R +   +Y+ Q
Sbjct  734   LIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTL---DYWRQ  790

Query  535   PNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVR  594
             P I+  ++R IV E+      L+    P+VYP+W+     +   G VIE  P      VR
Sbjct  791   PPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVR  850

Query  595   ANVFIEPSGGVHVTSAQEQLMHVKNKHQ-------------------SVGavypptavpy  635
             AN+FIEPS  V ++S QE  +  +N H+                   ++G  +P T + +
Sbjct  851   ANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDH  909

Query  636   aaIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTA  695
               ++ ASL + QA+   GI GY S+D++  LD +T N         L+A+ L P LT +A
Sbjct  910   EVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-------LYAMALQPFLTNSA  962

Query  696   MSFVLFTFLS-CATLDAATGRsflplpaprpsslagppaTETQLAVEKILGESSPAATMG  754
              SF LF FLS     ++ TG   LP         +  P++ +  A + ++ E+  +  + 
Sbjct  963   ASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVS  1022

Query  755   AE------RAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAG  808
              E      R+Y+  EY+ +PN+ATL Y  FF  CR  GV FD+++ IG  F+LADSLTAG
Sbjct  1023  NELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAG  1082

Query  809   VVGLLCIGESDKEAV  823
             V+G++CI ++ K A+
Sbjct  1083  VLGIMCISDTRKNAL  1097

>PYAR_13581
Length=730

 Score = 273 bits (697),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 167/428 (39%), Positives = 229/428 (54%), Gaps = 80/428 (19%)

Query  3    NSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLappptepdavpptrpAVARKRKSTVA  62
            N  +RLY R EQPV++ P ++        L                              
Sbjct  1    NGAVRLYRREEQPVRAVPDISPRPPPPQQLN-----------------------------  31

Query  63   TVQLSFPGAKDELVDAVPVEDPATDDGP----------IEPTDT-------IDELRNNVE  105
            TV +SF   +     +   ++P  D+ P          I+  D        +D+LR NVE
Sbjct  32   TVTISFTDGESPPQQST--DEPEMDESPPQLDTEHAQHIDDADASESDANAMDDLRKNVE  89

Query  106  KIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYS  165
            KIRGYN+LLDTYSLHQFII KG+ + ETPEF SFKR+ +++WG+V   IR LE LL  Y 
Sbjct  90   KIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYF  149

Query  166  VPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIV  225
            +                   S   S LL+CV+N D+V + + RPGQR+KG D +  AA  
Sbjct  150  M------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATT  191

Query  226  IQSVYRM--HRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQM  283
            +Q+ +RM  HR R       G S AT IQ  +R +   + ++ +L L R    R W+ QM
Sbjct  192  LQAFFRMLFHRNRFRRVCRRGAS-ATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQM  250

Query  284  TTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVD-VIY  342
                + W +I  QRRVVVHVPS S +E AR+++D+FA++QNLQ+ARL A+ D  V+ V+Y
Sbjct  251  ARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATVEYVVY  310

Query  343  ISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPH-CLK  401
            +SPFEL  D+           GVA+   RV+++ PE+A  FP HFSLAT LLYSPH  L+
Sbjct  311  VSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTLE  361

Query  402  KIKRYVRG  409
            K+ R  R 
Sbjct  362  KLGRCSRA  369

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 101/379 (27%), Positives = 153/379 (40%), Gaps = 87/379 (23%)

Query  506  AAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVY  565
            A +D+ AL  + ++R   RA K   Y+ QP I++ + RA++ EL      L  PC  + +
Sbjct  389  ALLDVSALTTLREIR---RAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERF  445

Query  566  PTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVH-----VTSAQEQLMHVKNK  620
            P W+     + R G VIEA P +V   VR N+F+ P+   H     V S QE L     +
Sbjct  446  PDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR  505

Query  621  HQSVGavypptavpyaaIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPH  679
               +    P T VP+ A+ GA+ A+ + +       GYAS+D     D  +         
Sbjct  506  -APLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDETS---------  555

Query  680  LRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRsflplpaprpsslagppaTETQLA  739
                 L LLP  +P           + A L  AT                     E  L 
Sbjct  556  ----GLYLLP--SPAVD--------TSAPLSPAT----------------PLVLQEAHLL  585

Query  740  VEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAF  799
                   +SP+A+    R +++ ++  HPN+ T+  A FF  CR  GV FD+        
Sbjct  586  ARSSRPLASPSAS---PRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDV--------  634

Query  800  VLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ-PAPDALTGERLGNFAAVL  858
                                + A++  R A E++  +VG   P+ D       GNF  VL
Sbjct  635  -------------------TRRAMQYLRTAFEVLAREVGSSTPSSD-------GNFGDVL  668

Query  859  GAIRLRHDDMVKRAKKARS  877
              +R R     +R K+A S
Sbjct  669  ALLRHRVGVEKEREKEAAS  687

>PHYKE_8394
Length=428

 Score = 195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 155/268 (58%), Gaps = 40/268 (15%)

Query  274  ADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAI  333
             + R  + +M    AN DKI+               E      +NFA++QNLQ+ R+CA 
Sbjct  147  GNDRDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAA  194

Query  334  A-DPNVDV-IYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  391
            A D NVD+ +Y+SPFEL+ D+ +Y ++LLQLGG+AD   RV+++ PE A RFP       
Sbjct  195  ALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT------  248

Query  392  ILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGA  451
                             GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG 
Sbjct  249  -----------------GKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGG  291

Query  452  KRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMH  511
            KRL  +ADVN+P G +++YD+ EL  +LAKL   ++ Q  WL+KLD DP   G A ID+ 
Sbjct  292  KRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLS  351

Query  512  ALECVNKVRAEKRAMKNDEYYSQPNIKE  539
             ++ + ++R EKRA    EY+ QP  ++
Sbjct  352  GMQAMRELRREKRA---PEYWRQPGPRD  376

 Score = 35.4 bits (80),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 25/35 (71%), Gaps = 1/35 (3%)

Query  97   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLS  131
            ++EL  NV+KIRGYN+LLD Y+   F +++   L+
Sbjct  156  MEELGANVDKIRGYNELLDAYT-ENFAVQQNLQLT  189

>PYIW_13162
Length=1166

 Score = 38.5 bits (88),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 48/95 (51%), Gaps = 4/95 (4%)

Query  165  SVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAI  224
            S+  A ID Q++ +       S+ + E L   +   ++   + +    F   + R  +AI
Sbjct  703  SLSFAAIDIQRVFR--GFRFRSQLRREKLIQSIQQRQIDHMLNQLQANFVVRECRRKSAI  760

Query  225  VIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYK  259
             IQ +++ +  R LLR+ H    ATHIQRV+R Y+
Sbjct  761  AIQRIFKGYAHRNLLRRWHIE--ATHIQRVFRGYR  793

>SPRG_19265
Length=2200

 Score = 37.7 bits (86),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (51%), Gaps = 1/57 (2%)

Query  201   EVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLRQHH-GHSYATHIQRVYR  256
             +  +F AR     K    +H AA+ IQ  Y+ H  RR LR     H  A H+QRVYR
Sbjct  1452  QYKSFWARFDAETKAERAKHLAALAIQRAYKGHVCRRRLRALKLEHKTALHLQRVYR  1508

>PYIW_20704
Length=1474

 Score = 37.0 bits (84),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query  213  FKGGDGRHA--AAIVIQSVYRMHRTRRLLRQH------HGHSYATHIQRVYRTYKCVKDI  264
            F+G D + A  AA++IQ  +R  R+R LL QH        H+ A  +Q   R ++  K +
Sbjct  374  FEGRDAKRALSAAVLIQCTWRRRRSRTLLEQHKKERTRQRHASAATLQSYLRQFQFAKAL  433

Query  265  QVKLRLAREA  274
            +      REA
Sbjct  434  EQHANAEREA  443

>PYAP_15202
Length=987

 Score = 37.0 bits (84),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query  219  RHAAAIVIQSVYRMHRTRRLLRQHHG----HSYATHIQRVYRTYKCVKDI  264
            RHAAA  IQ + R++  RRLL++H      H  A+ IQ +YR  K  ++I
Sbjct  513  RHAAATRIQCLARLYIARRLLKEHQQERKRHVAASRIQALYRGRKVRREI  562

>H257_14431
Length=2148

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 40/92 (43%), Gaps = 8/92 (9%)

Query  220   HAAAIVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYK--CVKDIQVKLRLAREADAR  277
             H  A  IQ  YR +R R L  +   H  A  +QRVYR +K   V D + +   A     R
Sbjct  1403  HKLASKIQKAYRAYRARTLADRLRRHKAALTMQRVYRGFKGRLVFDKRRREDAAIRLVQR  1462

Query  278   TWETQMTTFHANWDK------IKMQRRVVVHV  303
             +W  +M        K      I+MQR V  HV
Sbjct  1463  SWRGKMGRMQFKSTKSQRLAAIEMQRMVRGHV  1494

>PHYSO_500042
Length=914

 Score = 35.4 bits (80),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query  219  RHAAAIVIQSVYRMHRTR-----RLL----RQHHGHSYATHIQRVYRTYKCVKDIQVKLR  269
            R AAAI IQ VYR HR R     +L+    R       AT IQ++ R  + ++ ++ +LR
Sbjct  565  RRAAAINIQRVYRGHRARLSTELKLMALRERNRMRAQAATKIQKMVRKRQAIRRVE-QLR  623

Query  270  LAREA----DARTWETQMTTFHANW  290
              R A     ARTW    +   A W
Sbjct  624  QERAARFVLQARTWVEYWSEDSAKW  648

>SDRG_11672
Length=2193

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 71/191 (37%), Gaps = 50/191 (26%)

Query  214   KGGDGRHAAAIVIQSVYRMHRTRRLLRQHH-GHSYATHIQRVYR-------------TYK  259
             K    R+ AA+ IQ  Y+ H  RR LR     H  A H+QRVYR               +
Sbjct  1474  KAERARYLAAVAIQRTYKGHVYRRRLRALKVEHKTALHLQRVYRGRIARRHAAQQRHRVR  1533

Query  260   CVKDIQVKLR--LAREADARTWETQMTTFHAN----------WDKIKMQR-----RVVVH  302
             C   +Q   R  L R  + ++W         N          W  +  +R     RV+ H
Sbjct  1534  CALKLQALGRGFLTRLHERQSWHAWRVQVRTNRIAANTIQRVWRGLHGRRDAKRARVIQH  1593

Query  303   VP-SFSAEERARLN---MDNFAIRQNLQMARLCAIADPNVDVIYIS-----------PFE  347
              P +F   E AR +   + NF++   L    L A   P V V Y +           P  
Sbjct  1594  GPRTFFNWEDARKHASLVSNFSVWDEL----LLAGTSPIVGVFYCNQITGQCVWDKPPLW  1649

Query  348   LSVDIQKYMMR  358
             +  D Q ++ R
Sbjct  1650  VERDYQAFLDR  1660

>SPRG_18275
Length=367

 Score = 35.0 bits (79),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 0/39 (0%)

Query  224  IVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVK  262
            I++QS++R    R  LRQH  ++ A  +QR +RTYK  K
Sbjct  33   ILLQSLWRGRHARSALRQHQLYTSAVVLQRNWRTYKAQK  71

>PYU1_G005363
Length=989

 Score = 35.4 bits (80),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 28/94 (30%), Positives = 45/94 (48%), Gaps = 4/94 (4%)

Query  166  VPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIV  225
            +  A ID Q++ +       S+ + E L   +   +V   +A+    F   + R  +AI 
Sbjct  619  ISYAAIDLQRVFR--GFRFRSQMRRERLIQSIQQRQVDNMLAQLQANFLFRERRRLSAIA  676

Query  226  IQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYK  259
            IQ +Y+    R  LR+ H    AT IQRV+R Y+
Sbjct  677  IQRIYKGFAHRNRLRRWHLE--ATQIQRVFRGYR  708

>PYU1_G006277
Length=978

 Score = 35.0 bits (79),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 42/84 (50%), Gaps = 14/84 (17%)

Query  220  HAAAIVIQSVYRMHRTR-----RLLRQHHGHSY----ATHIQRVYRTYKCVKDIQVKLRL  270
            HA+AI IQ VYR HR+R     +LL     + +    AT IQ+  R+Y   K +Q ++R 
Sbjct  644  HASAIKIQKVYRSHRSRLSTELKLLALREKNRWRAKAATTIQKRMRSYLAKKCVQ-RVRE  702

Query  271  AREAD----ARTWETQMTTFHANW  290
            A  A     ARTW        ++W
Sbjct  703  AHAAQLVTLARTWVEYWNEDTSSW  726

>H257_04278
Length=832

 Score = 35.0 bits (79),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  221  AAAIVIQSVYRMHRTRRLLRQHHG--HSYATHIQRVYRT  257
            AAA+V+Q++YR  RT+R  R++    H  AT IQR+ R+
Sbjct  536  AAAVVVQTIYRSQRTQRWFRKYVASVHRSATSIQRMVRS  574

>PYAR_21631
Length=578

 Score = 34.7 bits (78),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  428  IRLQLPLLGMDPDRALLYGTRSGAKRLFTQ  457
            ++  +PL G DPDR   +G  +GAK +F Q
Sbjct  193  VKHHIPLFGGDPDRITAFGESAGAKSVFAQ  222

>H257_09421
Length=2122

 Score = 34.7 bits (78),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 25/47 (53%), Gaps = 3/47 (6%)

Query  222   AAIVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTY---KCVKDIQ  265
             A + IQ  Y+  + RR  R    + YA  IQRVYR Y   K V DI+
Sbjct  1463  ATLTIQRCYKGSKARRAYRHTLRNKYAVFIQRVYRGYVGRKRVGDIR  1509

>H310_01646
Length=1301

 Score = 34.7 bits (78),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 27/85 (32%)

Query  220  HAAAIVIQSVYRMHRTRRLLRQHHGHSYATHI-------------------------QRV  254
            HA+++ IQ+VYR +RTRR  R +  H     I                         QR 
Sbjct  867  HASSLRIQTVYRGYRTRRWFRHYKTHVVGATIRIQAWVRRNWHRRAYLHTRKCIIAAQRR  926

Query  255  YRTYKCVKDIQVKLRLAREADARTW  279
            +RTY  ++D+ +   + R   AR W
Sbjct  927  FRTYLSIRDMHIM--ILRALHARRW  949

>SDRG_10986
Length=1244

 Score = 34.7 bits (78),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 37/82 (45%), Gaps = 27/82 (33%)

Query  221  AAAIVIQSVYRMHRTR-----------------------RLLRQHHGHSYAT--HIQRVY  255
            A+A+ IQS YRMH+TR                       R   +H  H+ A    +Q+ +
Sbjct  816  ASAVCIQSTYRMHQTRIWYVSYCNQIVAAAVRVQTWARQRFEMRHWQHAKAAVRRVQKRF  875

Query  256  RTYKCVKDIQ--VKLRLAREAD  275
            RTY+ V+       LRLAR+ D
Sbjct  876  RTYRAVRRFNAIAALRLARKGD  897

>PYU1_G012671
Length=1052

 Score = 34.7 bits (78),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 12/107 (11%)

Query  226  IQSVYRMHRTRR-LLRQ-----HHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTW  279
            IQ+ +R HR RR +L Q           A HIQR++R Y   K++     +A  A+ R  
Sbjct  664  IQNQFRAHRRRRTMLYQLSWLISETQQSAVHIQRIFRGYCAKKEVNFAKTVA-AAERRRL  722

Query  280  ETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQ  326
            E     FHA     +  +R + H  S + E  A++ + N    Q LQ
Sbjct  723  EAGKKIFHA----YRQYKRRLRHRCSMTVESIAQVQLFNIQY-QKLQ  764

>PYIR_18768
Length=1146

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 8/102 (8%)

Query  158  ETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGD  217
            E++L+ Y    A +D Q++ +       S+ + E L   +   +V   + +    F   +
Sbjct  717  ESVLLSY----ATVDIQRVFR--GFQFRSQLRREKLIQSVQQRQVDHILGQLQANFIVRE  770

Query  218  GRHAAAIVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYK  259
             R  +A+ IQ +++ +  R  LR+ H    ATHIQRV+R Y+
Sbjct  771  CRRKSAVSIQRIFKGYAYRNRLRRWHID--ATHIQRVFRGYR  810

>H310_13321
Length=2108

 Score = 34.7 bits (78),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (47%), Gaps = 9/73 (12%)

Query  222   AAIVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWET  281
             + + IQ  Y+  + RR  RQ      A  IQRVYR Y+     ++++R     D R    
Sbjct  1449  STVTIQRCYKGFKARRAYRQTRRKKNALFIQRVYRGYRG----RMRVR-----DIRASYA  1499

Query  282   QMTTFHANWDKIK  294
              +   HAN  K++
Sbjct  1500  HLQVLHANATKVQ  1512

>SDRG_12180
Length=1162

 Score = 34.3 bits (77),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query  224  IVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLA  271
            I++QS++R    R  L QH  ++ A  +QR +RTYK  K   ++LR A
Sbjct  810  ILLQSLWRGRHARSALHQHKLYTSAVVLQRNWRTYKAQKSY-LRLRAA  856

>PHYRA_94639
Length=1046

 Score = 34.3 bits (77),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 38/85 (45%), Gaps = 14/85 (16%)

Query  219  RHAAAIVIQSVYRMHRTR-----RLL----RQHHGHSYATHIQRVYRTYKCVKDIQVKLR  269
            R AAAI IQ VYR HR R     +LL    R       AT IQ + R  + +  ++ +LR
Sbjct  530  RRAAAINIQRVYRGHRARLSTELKLLALRERNRMYAQAATKIQNLVRKRQAIHRVE-RLR  588

Query  270  LAREA----DARTWETQMTTFHANW  290
              R A     ARTW        A W
Sbjct  589  QERAARFVLQARTWVEYWNEDSAKW  613

>H310_05882
Length=813

 Score = 34.3 bits (77),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  221  AAAIVIQSVYRMHRTRRLLRQHHG--HSYATHIQRVYRT  257
            AAA+V+Q++YR  RT+R  R+H       AT IQR+ R+
Sbjct  532  AAAVVVQTIYRSQRTQRWFRKHVARIRRSATSIQRMVRS  570

>SDRG_16344
Length=1202

 Score = 34.3 bits (77),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)

Query  219  RHAAAIVIQSVYRMHRTRRLLRQ  241
            R AAA+V+QS YR HR +R LRQ
Sbjct  754  RSAAAVVLQSCYRRHRAQRKLRQ  776

>PYAR_20859
Length=1156

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 55/124 (44%), Gaps = 30/124 (24%)

Query  219  RHAAAIVIQSVYRMHRTRRLL---RQHH------GHSYATHIQRVYRTYKCVKDIQVKLR  269
            R  AA +IQ + R + +RRLL   R+ H       ++ AT IQ+VYR ++     ++KL 
Sbjct  761  RTKAATLIQKIMRGYLSRRLLVRMREQHRAELAMQNAAATQIQKVYRGHRARLGTELKLL  820

Query  270  LAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLN---MDNFAIRQNLQ  326
              +E                  K KM++R  + + +     +AR     M    +R  + 
Sbjct  821  ALKE------------------KNKMRKRAAIQIQTLVRHRQARFTVARMREQKLRGLVA  862

Query  327  MARL  330
            +ARL
Sbjct  863  LARL  866

>SDRG_03752
Length=987

 Score = 33.5 bits (75),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 25/43 (58%), Gaps = 3/43 (7%)

Query  220  HAAAIVIQSVYRMHRTRRLLRQHHG---HSYATHIQRVYRTYK  259
            H AAIV+Q VYR HR R L+    G      A  IQR+YR ++
Sbjct  65   HHAAIVLQRVYRGHRDRTLVFAFFGPRNQQKALLIQRIYRGHR  107

>PHALS_08347
Length=1469

 Score = 33.9 bits (76),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  222  AAIVIQSVYRMHRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAR  272
            AAI +Q   R HR R+LL        AT IQ V + +   +  QVK++  R
Sbjct  851  AAISVQKYVRRHRARQLLVHMREEYRATQIQNVCKMFVARRKYQVKVKAIR  901

>PYIR_14183
Length=1325

 Score = 33.5 bits (75),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 35/69 (51%), Gaps = 7/69 (10%)

Query  226  IQSVYRMHRTRRLLRQH------HGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTW  279
            IQ  +R+HR RR + Q+           A HIQR++R Y   KD  + +++  EA+ +  
Sbjct  933  IQLQFRVHRLRRNILQNLTLFIAETRQSAVHIQRIFRGYCAKKDYNI-IKMLLEAERQRQ  991

Query  280  ETQMTTFHA  288
            E     +HA
Sbjct  992  EAVRKIWHA  1000

>H257_16588
Length=1106

 Score = 33.5 bits (75),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  222  AAIVIQSVYRMHRTRRLLRQH-HGHSYATHIQRVYRTY  258
            AA+++Q VYR+H   R LR+    H +A  IQRVYR Y
Sbjct  386  AAMMLQRVYRIHCVARTLRRLLASHRHALTIQRVYRGY  423

>PYIR_22645
Length=3628

 Score = 33.5 bits (75),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 9/62 (15%)

Query  219  RHAAAIVIQ----SVYRMHRTRRLLRQHHGHSY--ATHIQRVYRTYKCVKD---IQVKLR  269
            RH AA  IQ    S  R  R R+L        +  A  IQRV+R Y+C K+   +Q K++
Sbjct  501  RHEAATAIQIHFSSRCRYQRKRKLQEDREWEEFCCAVDIQRVFRRYRCRKNYSFVQEKVK  560

Query  270  LA  271
             A
Sbjct  561  KA  562

>PYAR_18244
Length=993

 Score = 33.1 bits (74),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 2/74 (3%)

Query  186  SRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLRQHHGH  245
            +R + E L   +   +V    AR  Q F+  + R  AA  +Q +Y+   TRRL+      
Sbjct  623  ARMRRESLLRTIRQHQVDQLYARLHQNFQVREKRRLAASAVQRMYKGFATRRLMTT--WR  680

Query  246  SYATHIQRVYRTYK  259
              AT IQR+YR ++
Sbjct  681  VAATTIQRMYRGHR  694

Lambda      K        H        a         alpha
   0.322    0.135    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 72579038004

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40