Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_063361475633533516420.0
SDRG_017811475633533515710.0
H257_06294147563583546951e-88
H310_09223147563333396913e-88
PITG_18456147563513374914e-58
PYU1_G001735147563423364783e-56
PHYRA_81100147563493344775e-56
PHALS_06478147563453374767e-56
PHYSO_471523147563483384751e-55
PPTG_17127147563513364742e-55
PYVX_18171147562942164552e-53
PHYCA_556162147563513384592e-53
PYAP_17762147563483244541e-52
PYIR_13451147563593414437e-51
PYIW_19971147563483404071e-45
CCA18899147563433323834e-42
PHYKE_8393147563263323659e-40
PYAR_13570147563223313483e-37
CCI45123147563013053028e-31
PPTG_188981612815591041492e-09
PITG_205621612815591041483e-09
PYAR_154631526710911611483e-09
PYAP_2264624178151221456e-09
PHYRA_849161612815411091422e-08
PHYRA_825431526711991091412e-08
PYAR_23286161286071541403e-08
PHYSO_5445981526711631091403e-08
PPTG_193711526711951091394e-08
PYAP_186361526710091091376e-08
PHYSO_3617471612815231111377e-08
PYAR_1988324178331191368e-08
PYU1_G0063471612810951111368e-08
PITG_192131526712011091351e-07
PYAP_169971612810181331351e-07
PHYRA_792812417809591341e-07
PHYCA_5061372417810531341e-07
H257_06722161281482671341e-07
CCA2453118533741231321e-07
PYU1_G00438624178371251332e-07
PHYKE_19901612814991111332e-07
PHYKE_56782417809531332e-07
H310_002311612814952061332e-07
CCI462351526711551131332e-07
PYIW_16987152678211091322e-07
PYU1_G008848152677651091323e-07
PHYSO_3441122417813531323e-07
HYAP_080262417798531323e-07
PYIW_1738116128952991323e-07
PPTG_055192417810531313e-07
CCA180231526711381091313e-07
H257_03361123428699621313e-07
PITG_027622417810531304e-07
SPRG_003641222722551061274e-07
PHYKE_6662152677651091304e-07
PYIR_183821526711541091314e-07
CCI44752161281526981314e-07
PYIW_1848024177551121305e-07
PYIR_215891612815681331305e-07
H310_0770124178111121305e-07
CCI4714518533901861285e-07
SPRG_060581612812581161296e-07
HYAP_086451612815141091296e-07
H257_0751424178101121296e-07
SDRG_021541265688221151287e-07
CCA1909718566881451287e-07
SDRG_035311222722551061257e-07
HYAP_044571526712031051288e-07
SDRG_127621612813921081288e-07
H310_04843152679681091279e-07
SPRG_11900166051301261e-06
SDRG_1276312510913171161271e-06
PYVX_20438161281346991271e-06
SDRG_01407152678151101261e-06
PHALS_036452417830531261e-06
SDRG_14487123428964571262e-06
CCA18875161281514981262e-06
SPRG_02752123428831551252e-06
PHALS_040981526711831051262e-06
SPRG_00890152678831101252e-06
SPRG_17022131892107531152e-06
CCA2171524177821511242e-06
CCA218601550787821511242e-06
CCI10489158709777591242e-06
CCI451271609872021901202e-06
SPRG_088341265688251161242e-06
SDRG_1448618533081211213e-06
PYVX_133121526710161051233e-06
PYAP_16161986618891251233e-06
SPRG_0605912510913121061234e-06
PYIR_131202417814531224e-06
SPRG_0275318533091211204e-06
H257_03093152679751091224e-06
PYVX_183382417746551224e-06
SDRG_0515024177871451216e-06
CCI41225144599811171216e-06
SPRG_0834624177971121206e-06
PITG_0210918535221031181e-05
PYU1_G00673286329541181191e-05
CCA16487144599751171181e-05
PYVX_13574144599501051181e-05
SDRG_0628816641571181e-05
PYAR_19914144597881231181e-05
PYIW_13172144599391051181e-05
PYAP_1369518533481031161e-05
H310_0023012510912481131181e-05
PHYKE_2479144591711021121e-05
PYU1_G0128701853352981161e-05
PYU1_G001063144597831051171e-05
PYIR_15309144599371051182e-05
PYIW_21108951125931641182e-05
PPTG_13401144599271051172e-05
PPTG_1463018533981141162e-05
PYAR_2550015835473991162e-05
PHYCA_5031121529262141051132e-05
HYAP_0734886329731181162e-05
SDRG_014081225189161151162e-05
PITG_113039318293351142e-05
PYIR_233721583514151181153e-05
SPRG_008891225189941151153e-05
PYAR_1461586325171081143e-05
PITG_18067144599241051144e-05
PHALS_06533144599301051144e-05
CCA171021529268841251144e-05
PYIR_135551853355531134e-05
PHYRA_77834144599361051144e-05
PHALS_0656818533881031134e-05
PYVX_14527603012691181145e-05
PYAP_2219586329011071135e-05
H310_13627143136781141126e-05
CCI42457152926906411128e-05
PYAP_17290144598351231118e-05
PYIR_17453951126191131111e-04
PYIW_184911583516841011101e-04
PYVX_16714863210301071101e-04
PHYSO_47861118535221381091e-04
H257_0672112510912381061101e-04
PYIR_2224612554559921091e-04
PYAR_18690951124551101101e-04
PYIR_2301286329651071092e-04
H257_06469219447640982e-04
H310_054571222722691051062e-04
PYU1_G00950895765328321072e-04
PITG_10462863210281071082e-04
PHYRA_82040863210541171083e-04
CCI4099124178011711073e-04
PYAR_16228986618621221073e-04
PHYCA_56429686329571161073e-04
H310_002091583511981131073e-04
PHYRA_793481583512401141073e-04
PYIW_208911853291531053e-04
PHYSO_55849886329671071063e-04
H310_0666686328871051064e-04
PHYKE_104486325211071064e-04
PPTG_0878586329441071064e-04
PHYRA_7329757259119134984e-04
PHALS_0972986329491071054e-04
H257_0818216859551055e-04
PYIW_1781818501188481055e-04
SDRG_14286143136701661046e-04
PYU1_G009249951125801641056e-04
PITG_20103158351301791056e-04
PPTG_068231583513211141056e-04
PHYCA_529660115173451281036e-04
H310_0192118533411121027e-04
PHALS_1250311517340531028e-04
PYIR_15118134791222321048e-04
SPRG_09128143136201191038e-04
H310_0880316916551038e-04
PHYCA_50480118533981031029e-04
PYIW_18911134791196321039e-04
PYVX_130841347912671761030.001
PHYKE_914612554557921020.001
PYU1_G012274158358731181020.001
PYIW_2152686329631111020.001
SDRG_0213521944306331000.001
PPTG_0780057259154129960.001
H257_16349122272262100990.002
PHYKE_491118534637890.002
PHYRA_7343018533951031000.002
PHYSO_35019712554557921000.002
PYU1_G012859185011831361000.002
H257_0130886328971051000.002
H257_033631853316117980.002
CCA25510134791139331000.002
PYAP_241441583510221151000.002
PYVX_13261614713821691000.002
PITG_141971151734953980.003
SPRG_0606115835115998990.003
PHYSO_3436291445997737990.003
HYAP_137571151726253970.003
H310_06667138868896159990.003
HYAP_09511158351295107990.003
SPRG_018608632674125980.003
H257_06698158351199109990.003
SDRG_082368632864113980.003
PYVX_190301255455692980.004
PYU1_G01126161471328118980.004
PYIR_218315669515442930.004
SDRG_088001445988147980.004
CCI434561109212654910.004
PHALS_0663695112386122980.004
H310_063781445983734970.005
PYIR_1678061471352110970.005
H257_135671445983634970.005
SPRG_054491445972347960.006
SDRG_1277615835118498970.006
PYU1_G00917811517336128950.006
PHYSO_315255158351301114960.006
PHYSO_3203611151734453950.006
PYAP_1629795112466106960.006
HYAP_0930413479114432960.006
PPTG_194711151734853950.007
CCI4379313479111733960.007
SDRG_0008012454429877940.007
PHALS_11367158351329112960.007
PHYKE_3811517227129930.007
PYVX_22589158351375121950.008
CCA191181109212554890.009
H257_01309138868895108950.009
PYVX_14593185096440950.009
PHYRA_836961151733753930.009
CCI458578632905107940.011
PYIW_2525011517245127920.011
H310_048421395771081114940.011
H257_098231431365450940.012
CCA268906147153055940.012
SPRG_1631213132226177920.013
HYAP_1368818501036132930.013
PYAP_1975361471340105940.013
CCA235728632868107930.014
HYAP_117121255455892930.014
PYU1_G0032291681031930.015
PYAR_1349181951080101930.016
PHYRA_8307195112300128930.016
H310_09363140947195453930.017
PYIW_1987356695185112890.018
HYAP_0223081951195186920.019
HYAP_117131764541792910.020
CCI109286147153043920.021
CCA2715712554553106910.022
PYAR_1912299405554121910.022
HYAP_13690185337739900.024
PHYSO_52993195112211119910.026
PHYCA_50471216208107880.026
PYVX_216545153855115910.027
PYIR_1316828851353104910.027
PHYCA_5093851255455792900.027
PPTG_1898913479121332910.028
PHALS_0793013479120032910.029
H310_0644928851361123910.029
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_06336

Length=335
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SPRG_06336                                                            637        0.0  
SDRG_01781                                                            609        0.0  
H257_06294                                                            272        1e-88
H310_09223                                                            270        3e-88
PITG_18456                                                            193        4e-58
PYU1_G001735                                                          188        3e-56
PHYRA_81100                                                           188        5e-56
PHALS_06478                                                           187        7e-56
PHYSO_471523                                                          187        1e-55
PPTG_17127                                                            187        2e-55
PYVX_18171                                                            179        2e-53
PHYCA_556162                                                          181        2e-53
PYAP_17762                                                            179        1e-52
PYIR_13451                                                            175        7e-51
PYIW_19971                                                            161        1e-45
CCA18899                                                              152        4e-42
PHYKE_8393                                                            145        9e-40
PYAR_13570                                                            138        3e-37
CCI45123                                                              120        8e-31
PPTG_18898                                                            62.0       2e-09
PITG_20562                                                            61.6       3e-09
PYAR_15463                                                            61.6       3e-09
PYAP_22646                                                            60.5       6e-09
PHYRA_84916                                                           59.3       2e-08
PHYRA_82543                                                           58.9       2e-08
PYAR_23286                                                            58.5       3e-08
PHYSO_544598                                                          58.5       3e-08
PPTG_19371                                                            58.2       4e-08
PYAP_18636                                                            57.4       6e-08
PHYSO_361747                                                          57.4       7e-08
PYAR_19883                                                            57.0       8e-08
PYU1_G006347                                                          57.0       8e-08
PITG_19213                                                            56.6       1e-07
PYAP_16997                                                            56.6       1e-07
PHYRA_79281                                                           56.2       1e-07
PHYCA_506137                                                          56.2       1e-07
H257_06722                                                            56.2       1e-07
CCA24531                                                              55.5       1e-07
PYU1_G004386                                                          55.8       2e-07
PHYKE_1990                                                            55.8       2e-07
PHYKE_5678                                                            55.8       2e-07
H310_00231                                                            55.8       2e-07
CCI46235                                                              55.8       2e-07
PYIW_16987                                                            55.5       2e-07
PYU1_G008848                                                          55.5       3e-07
PHYSO_344112                                                          55.5       3e-07
HYAP_08026                                                            55.5       3e-07
PYIW_17381                                                            55.5       3e-07
PPTG_05519                                                            55.1       3e-07
CCA18023                                                              55.1       3e-07
H257_03361                                                            55.1       3e-07
PITG_02762                                                            54.7       4e-07
SPRG_00364                                                            53.5       4e-07
PHYKE_6662                                                            54.7       4e-07
PYIR_18382                                                            55.1       4e-07
CCI44752                                                              55.1       4e-07
PYIW_18480                                                            54.7       5e-07
PYIR_21589                                                            54.7       5e-07
H310_07701                                                            54.7       5e-07
CCI47145                                                              53.9       5e-07
SPRG_06058                                                            54.3       6e-07
HYAP_08645                                                            54.3       6e-07
H257_07514                                                            54.3       6e-07
SDRG_02154                                                            53.9       7e-07
CCA19097                                                              53.9       7e-07
SDRG_03531                                                            52.8       7e-07
HYAP_04457                                                            53.9       8e-07
SDRG_12762                                                            53.9       8e-07
H310_04843                                                            53.5       9e-07
SPRG_11900                                                            53.1       1e-06
SDRG_12763                                                            53.5       1e-06
PYVX_20438                                                            53.5       1e-06
SDRG_01407                                                            53.1       1e-06
PHALS_03645                                                           53.1       1e-06
SDRG_14487                                                            53.1       2e-06
CCA18875                                                              53.1       2e-06
SPRG_02752                                                            52.8       2e-06
PHALS_04098                                                           53.1       2e-06
SPRG_00890                                                            52.8       2e-06
SPRG_17022                                                            48.9       2e-06
CCA21715                                                              52.4       2e-06
CCA21860                                                              52.4       2e-06
CCI10489                                                              52.4       2e-06
CCI45127                                                              50.8       2e-06
SPRG_08834                                                            52.4       2e-06
SDRG_14486                                                            51.2       3e-06
PYVX_13312                                                            52.0       3e-06
PYAP_16161                                                            52.0       3e-06
SPRG_06059                                                            52.0       4e-06
PYIR_13120                                                            51.6       4e-06
SPRG_02753                                                            50.8       4e-06
H257_03093                                                            51.6       4e-06
PYVX_18338                                                            51.6       4e-06
SDRG_05150                                                            51.2       6e-06
CCI41225                                                              51.2       6e-06
SPRG_08346                                                            50.8       6e-06
PITG_02109                                                            50.1       1e-05
PYU1_G006732                                                          50.4       1e-05
CCA16487                                                              50.1       1e-05
PYVX_13574                                                            50.1       1e-05
SDRG_06288                                                            50.1       1e-05
PYAR_19914                                                            50.1       1e-05
PYIW_13172                                                            50.1       1e-05
PYAP_13695                                                            49.3       1e-05
H310_00230                                                            50.1       1e-05
PHYKE_2479                                                            47.8       1e-05
PYU1_G012870                                                          49.3       1e-05
PYU1_G001063                                                          49.7       1e-05
PYIR_15309                                                            50.1       2e-05
PYIW_21108                                                            50.1       2e-05
PPTG_13401                                                            49.7       2e-05
PPTG_14630                                                            49.3       2e-05
PYAR_25500                                                            49.3       2e-05
PHYCA_503112                                                          48.1       2e-05
HYAP_07348                                                            49.3       2e-05
SDRG_01408                                                            49.3       2e-05
PITG_11303                                                            48.5       2e-05
PYIR_23372                                                            48.9       3e-05
SPRG_00889                                                            48.9       3e-05
PYAR_14615                                                            48.5       3e-05
PITG_18067                                                            48.5       4e-05
PHALS_06533                                                           48.5       4e-05
CCA17102                                                              48.5       4e-05
PYIR_13555                                                            48.1       4e-05
PHYRA_77834                                                           48.5       4e-05
PHALS_06568                                                           48.1       4e-05
PYVX_14527                                                            48.5       5e-05
PYAP_22195                                                            48.1       5e-05
H310_13627                                                            47.8       6e-05
CCI42457                                                              47.8       8e-05
PYAP_17290                                                            47.4       8e-05
PYIR_17453                                                            47.4       1e-04
PYIW_18491                                                            47.0       1e-04
PYVX_16714                                                            47.0       1e-04
PHYSO_478611                                                          46.6       1e-04
H257_06721                                                            47.0       1e-04
PYIR_22246                                                            46.6       1e-04
PYAR_18690                                                            47.0       1e-04
PYIR_23012                                                            46.6       2e-04
H257_06469                                                            42.4       2e-04
H310_05457                                                            45.4       2e-04
PYU1_G009508                                                          45.8       2e-04
PITG_10462                                                            46.2       2e-04
PHYRA_82040                                                           46.2       3e-04
CCI40991                                                              45.8       3e-04
PYAR_16228                                                            45.8       3e-04
PHYCA_564296                                                          45.8       3e-04
H310_00209                                                            45.8       3e-04
PHYRA_79348                                                           45.8       3e-04
PYIW_20891                                                            45.1       3e-04
PHYSO_558498                                                          45.4       3e-04
H310_06666                                                            45.4       4e-04
PHYKE_1044                                                            45.4       4e-04
PPTG_08785                                                            45.4       4e-04
PHYRA_73297                                                           42.4       4e-04
PHALS_09729                                                           45.1       4e-04
H257_08182                                                            45.1       5e-04
PYIW_17818                                                            45.1       5e-04
SDRG_14286                                                            44.7       6e-04
PYU1_G009249                                                          45.1       6e-04
PITG_20103                                                            45.1       6e-04
PPTG_06823                                                            45.1       6e-04
PHYCA_529660                                                          44.3       6e-04
H310_01921                                                            43.9       7e-04
PHALS_12503                                                           43.9       8e-04
PYIR_15118                                                            44.7       8e-04
SPRG_09128                                                            44.3       8e-04
H310_08803                                                            44.3       8e-04
PHYCA_504801                                                          43.9       9e-04
PYIW_18911                                                            44.3       9e-04
PYVX_13084                                                            44.3       0.001
PHYKE_9146                                                            43.9       0.001
PYU1_G012274                                                          43.9       0.001
PYIW_21526                                                            43.9       0.001
SDRG_02135                                                            43.1       0.001
PPTG_07800                                                            41.6       0.001
H257_16349                                                            42.7       0.002
PHYKE_4911                                                            38.9       0.002
PHYRA_73430                                                           43.1       0.002
PHYSO_350197                                                          43.1       0.002
PYU1_G012859                                                          43.1       0.002
H257_01308                                                            43.1       0.002
H257_03363                                                            42.4       0.002
CCA25510                                                              43.1       0.002
PYAP_24144                                                            43.1       0.002
PYVX_13261                                                            43.1       0.002
PITG_14197                                                            42.4       0.003
SPRG_06061                                                            42.7       0.003
PHYSO_343629                                                          42.7       0.003
HYAP_13757                                                            42.0       0.003
H310_06667                                                            42.7       0.003
HYAP_09511                                                            42.7       0.003
SPRG_01860                                                            42.4       0.003
H257_06698                                                            42.7       0.003
SDRG_08236                                                            42.4       0.003
PYVX_19030                                                            42.4       0.004
PYU1_G011261                                                          42.4       0.004
PYIR_21831                                                            40.4       0.004
SDRG_08800                                                            42.4       0.004
CCI43456                                                              39.7       0.004
PHALS_06636                                                           42.4       0.004
H310_06378                                                            42.0       0.005
PYIR_16780                                                            42.0       0.005
H257_13567                                                            42.0       0.005
SPRG_05449                                                            41.6       0.006
SDRG_12776                                                            42.0       0.006
PYU1_G009178                                                          41.2       0.006
PHYSO_315255                                                          41.6       0.006
PHYSO_320361                                                          41.2       0.006
PYAP_16297                                                            41.6       0.006
HYAP_09304                                                            41.6       0.006
PPTG_19471                                                            41.2       0.007
CCI43793                                                              41.6       0.007
SDRG_00080                                                            40.8       0.007
PHALS_11367                                                           41.6       0.007
PHYKE_38                                                              40.4       0.007
PYVX_22589                                                            41.2       0.008
CCA19118                                                              38.9       0.009
H257_01309                                                            41.2       0.009
PYVX_14593                                                            41.2       0.009
PHYRA_83696                                                           40.4       0.009
CCI45857                                                              40.8       0.011
PYIW_25250                                                            40.0       0.011
H310_04842                                                            40.8       0.011
H257_09823                                                            40.8       0.012
CCA26890                                                              40.8       0.012
SPRG_16312                                                            40.0       0.013
HYAP_13688                                                            40.4       0.013
PYAP_19753                                                            40.8       0.013
CCA23572                                                              40.4       0.014
HYAP_11712                                                            40.4       0.014
PYU1_G003229                                                          40.4       0.015
PYAR_13491                                                            40.4       0.016
PHYRA_83071                                                           40.4       0.016
H310_09363                                                            40.4       0.017
PYIW_19873                                                            38.9       0.018
HYAP_02230                                                            40.0       0.019
HYAP_11713                                                            39.7       0.020
CCI10928                                                              40.0       0.021
CCA27157                                                              39.7       0.022
PYAR_19122                                                            39.7       0.022
HYAP_13690                                                            39.3       0.024
PHYSO_529931                                                          39.7       0.026
PHYCA_504712                                                          38.5       0.026
PYVX_21654                                                            39.7       0.027
PYIR_13168                                                            39.7       0.027
PHYCA_509385                                                          39.3       0.027
PPTG_18989                                                            39.7       0.028
PHALS_07930                                                           39.7       0.029
H310_06449                                                            39.7       0.029
CCI42711                                                              39.7       0.031
PHYSO_489872                                                          39.3       0.034
HYAP_01795                                                            39.3       0.034
PHYRA_81944                                                           39.3       0.034
PPTG_11714                                                            39.3       0.036
PITG_11578                                                            39.3       0.036
H310_12867                                                            39.3       0.037
PHYRA_73534                                                           39.3       0.038
H310_12448                                                            38.9       0.040
PYIW_14611                                                            38.9       0.042
H310_13412                                                            38.9       0.043
PHYSO_335887                                                          38.9       0.044
PPTG_14626                                                            38.9       0.045
H257_03095                                                            38.9       0.046
PHYSO_485120                                                          36.6       0.049
H310_14019                                                            38.5       0.051
PYAP_16658                                                            38.1       0.052
PHYRA_73432                                                           38.5       0.057
PYIR_14542                                                            38.1       0.059
PITG_17893                                                            38.5       0.060
PYIR_14494                                                            38.5       0.061
PHYRA_73535                                                           38.5       0.061
PITG_02106                                                            38.5       0.063
PPTG_16659                                                            38.5       0.064
PPTG_04553                                                            38.5       0.064
PHYRA_78815                                                           38.5       0.067
PHALS_06334                                                           38.5       0.067
SPRG_02939                                                            38.5       0.069
PYU1_G008119                                                          36.2       0.070
PYAR_23366                                                            38.1       0.070
H257_09028                                                            38.1       0.072
PHYSO_484541                                                          38.1       0.074
H257_11802                                                            38.1       0.076
SDRG_00756                                                            38.1       0.080
PHYSO_556164                                                          38.1       0.081
PHYRA_81188                                                           37.7       0.083
SDRG_05608                                                            35.8       0.085
SPRG_02502                                                            35.8       0.090
H257_03931                                                            37.7       0.093
PYVX_22150                                                            37.4       0.093
PHYKE_5588                                                            37.7       0.095
PHYRA_76931                                                           37.7       0.095
CCI44571                                                              35.8       0.10 
PHALS_03540                                                           37.7       0.10 
PITG_00020                                                            37.7       0.10 
PYAP_23744                                                            35.8       0.11 
CCA19033                                                              37.7       0.11 
PYU1_G002683                                                          37.4       0.11 
H310_02133                                                            37.7       0.11 
H257_11158                                                            37.4       0.12 
PHYSO_533422                                                          37.4       0.12 
PYU1_G000724                                                          36.6       0.12 
PYVX_16256                                                            37.4       0.12 
PYAR_24323                                                            37.4       0.12 
HYAP_06101                                                            37.4       0.13 
PITG_13665                                                            35.4       0.13 
H257_03521                                                            37.4       0.15 
PHYRA_85100                                                           35.0       0.15 
PHYRA_85097                                                           35.0       0.15 
PYU1_G010818                                                          35.8       0.15 
PHALS_07062                                                           35.0       0.15 
PYIW_21901                                                            37.4       0.15 
PHYSO_349983                                                          37.4       0.16 
PHYKE_8531                                                            36.6       0.16 
CCI39367                                                              37.4       0.16 
PHALS_06699                                                           37.0       0.16 
SDRG_05128                                                            37.0       0.16 
SPRG_08326                                                            37.0       0.17 
PYAP_16734                                                            37.0       0.17 
PYIW_24869                                                            36.6       0.17 
SPRG_08783                                                            36.6       0.17 
PYIR_22259                                                            35.4       0.17 
HYAP_02360                                                            35.0       0.18 
H257_10913                                                            37.0       0.18 
H257_16221                                                            37.0       0.19 
H310_01510                                                            37.0       0.20 
CCA14529                                                              37.0       0.20 
H257_11443                                                            37.0       0.20 
PYU1_G001268                                                          36.2       0.21 
PYAP_19085                                                            36.6       0.21 
PYAP_23478                                                            36.6       0.22 
SPRG_14312                                                            36.6       0.23 
SPRG_04912                                                            36.2       0.23 
PHYRA_94409                                                           36.6       0.23 
CCA15513                                                              36.6       0.25 
PHYSO_248481                                                          36.6       0.25 
PPTG_16044                                                            36.6       0.25 
H257_02642                                                            36.6       0.25 
PITG_03318                                                            36.6       0.26 
PITG_16461                                                            36.6       0.26 
PYIW_23677                                                            33.9       0.26 
PPTG_19153                                                            36.6       0.27 
PYAP_22685                                                            36.6       0.27 
PHYCA_98948                                                           34.7       0.27 
PHYRA_77134                                                           36.6       0.28 
SPRG_08217                                                            36.2       0.28 
SDRG_04871                                                            36.2       0.28 
PHYKE_7347                                                            34.3       0.28 
PHYSO_289146                                                          34.3       0.29 
H310_02933                                                            36.2       0.30 
PHYCA_510506                                                          34.3       0.30 
PPTG_09008                                                            36.2       0.30 
PYVX_19982                                                            36.2       0.30 
PYIW_26522                                                            34.3       0.31 
CCI11474                                                              36.2       0.31 
PPTG_19631                                                            34.3       0.32 
CCI45895                                                              36.2       0.32 
HYAP_04252                                                            35.8       0.33 
PYIR_15407                                                            34.3       0.33 
PYIW_22477                                                            36.2       0.34 
PYAR_15792                                                            34.3       0.34 
PPTG_05753                                                            36.2       0.34 
H310_13911                                                            35.8       0.34 
SPRG_06021                                                            36.2       0.35 
SPRG_09211                                                            35.8       0.35 
PYIW_18840                                                            35.0       0.35 
PYAR_18008                                                            34.3       0.35 
SDRG_05567                                                            35.8       0.36 
SDRG_14771                                                            35.8       0.37 
HYAP_10830                                                            36.2       0.37 
PYVX_23349                                                            35.8       0.38 
PYAR_16504                                                            35.8       0.39 
PHYCA_505441                                                          35.8       0.39 
PITG_09930                                                            35.8       0.39 
PYVX_15906                                                            33.9       0.40 
PYU1_G012858                                                          35.4       0.40 
PHALS_08097                                                           35.8       0.40 
PHYKE_7856                                                            35.4       0.40 
PITG_17594                                                            35.8       0.41 
CCA22329                                                              35.8       0.42 
PYIR_24588                                                            35.8       0.43 
SDRG_01838                                                            35.8       0.43 
PYIR_25066                                                            35.0       0.44 
SPRG_06273                                                            35.8       0.45 
PYAR_16674                                                            35.4       0.45 
PHALS_02608                                                           35.4       0.45 
CCA24267                                                              34.3       0.46 
CCA21572                                                              34.3       0.46 
PHYCA_566962                                                          35.8       0.47 
PYU1_G007423                                                          35.4       0.48 
H310_07683                                                            35.4       0.49 
PYAR_13275                                                            35.0       0.50 
H257_00263                                                            35.4       0.50 
PHYSO_354120                                                          35.4       0.50 
H257_05679                                                            35.0       0.52 
PHYCA_71329                                                           32.7       0.53 
H310_07070                                                            35.4       0.53 
PYAP_18890                                                            33.5       0.56 
PHYRA_77130                                                           35.4       0.56 
PHYSO_354122                                                          35.4       0.56 
PPTG_04169                                                            35.4       0.56 
PYIR_20162                                                            35.4       0.57 
PITG_07286                                                            35.4       0.57 
PPTG_16174                                                            35.4       0.58 
PITG_21026                                                            35.4       0.58 
PYAP_17960                                                            35.0       0.60 
PHYSO_304784                                                          35.0       0.60 
PHALS_05587                                                           35.4       0.60 
PHYRA_80100                                                           34.7       0.60 
PYIW_18236                                                            35.4       0.61 
H310_01094                                                            33.5       0.61 
PITG_07289                                                            35.4       0.61 
PHYSO_355952                                                          34.7       0.61 
SPRG_05970                                                            35.0       0.61 
SPRG_13975                                                            34.7       0.63 
SDRG_07012                                                            34.7       0.63 
PYAR_19291                                                            35.0       0.64 
SDRG_06342                                                            35.4       0.65 
PHYRA_84567                                                           35.0       0.65 
H257_00729                                                            33.5       0.65 
SPRG_08532                                                            35.0       0.65 
PPTG_03644                                                            34.7       0.66 
PHALS_13270                                                           35.0       0.69 
PYIW_15014                                                            35.0       0.70 
PITG_03458                                                            35.0       0.70 
PYIR_21473                                                            35.0       0.71 
PPTG_04165                                                            35.0       0.73 
PHYCA_553561                                                          34.3       0.73 
PITG_19877                                                            35.0       0.74 
PHYRA_82811                                                           35.0       0.74 
PHALS_12874                                                           34.7       0.74 
SPRG_20275                                                            34.7       0.75 
PYIW_21944                                                            35.0       0.76 
H257_13346                                                            34.7       0.77 
PHYSO_258828                                                          35.0       0.78 
HYAP_02057                                                            35.0       0.78 
CCI41909                                                              34.3       0.79 
H310_06059                                                            35.0       0.81 
PYIR_17155                                                            34.7       0.81 
PPTG_03759                                                            35.0       0.82 
PPTG_09889                                                            33.9       0.82 
HYAP_11295                                                            34.7       0.83 
PYAP_19560                                                            34.3       0.85 
PITG_09298                                                            34.3       0.85 
PHYRA_79015                                                           34.7       0.85 
PHALS_10225                                                           34.7       0.90 
H310_00912                                                            34.7       0.90 
PYAP_15706                                                            34.3       0.93 
PYAP_15374                                                            34.7       0.94 
SDRG_15601                                                            34.3       0.97 
PITG_16799                                                            34.7       1.1  
PHYRA_82888                                                           34.3       1.1  
SDRG_10107                                                            34.3       1.2  
SPRG_10233                                                            34.3       1.2  
PYAP_16005                                                            34.3       1.2  
PHALS_02739                                                           34.3       1.3  
PHALS_09667                                                           34.3       1.3  
PHALS_03704                                                           34.3       1.3  
HYAP_14013                                                            33.9       1.4  
SDRG_02060                                                            33.9       1.4  
SDRG_14070                                                            33.9       1.4  
PYAP_23464                                                            33.9       1.4  
SPRG_05843                                                            34.3       1.5  
PYAR_21583                                                            33.5       1.5  
H257_14025                                                            33.5       1.6  
PYU1_G007013                                                          33.9       1.6  
PHYCA_504258                                                          33.1       1.7  
CCI45290                                                              33.9       1.8  
SDRG_04220                                                            33.9       1.8  
H257_04044                                                            33.9       1.8  
CCA17621                                                              33.9       1.9  
PYVX_13435                                                            33.5       1.9  
PYU1_G004115                                                          32.3       2.0  
PHYCA_568901                                                          33.5       2.0  
SDRG_07310                                                            33.5       2.0  
H257_10063                                                            33.5       2.1  
PYAP_18827                                                            33.5       2.1  
H257_03477                                                            33.5       2.1  
CCA24252                                                              33.1       2.1  
HYAP_10421                                                            33.1       2.1  
PHALS_00378                                                           33.5       2.1  
PHYSO_543442                                                          33.5       2.1  
PYAP_15732                                                            33.1       2.1  
PYIW_17571                                                            33.5       2.2  
SDRG_07302                                                            33.5       2.2  
HYAP_05646                                                            33.5       2.2  
HYAP_12562                                                            33.5       2.2  
CCI43715                                                              33.1       2.3  
SPRG_11532                                                            33.5       2.3  
CCA25744                                                              33.1       2.3  
PITG_10447                                                            33.5       2.3  
PYIR_16539                                                            33.5       2.3  
PHYRA_82056                                                           33.5       2.3  
H257_05175                                                            33.5       2.3  
H310_04667                                                            33.5       2.3  
PPTG_08766                                                            33.5       2.4  
PITG_03652                                                            33.5       2.4  
PHYCA_9844                                                            32.7       2.4  
PHYKE_10704                                                           33.1       2.4  
SPRG_21393                                                            33.1       2.4  

>SPRG_06336
Length=335

 Score = 637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/335 (100%), Positives = 335/335 (100%), Gaps = 0/335 (0%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  121  NVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180
            NVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT
Sbjct  121  NVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180

Query  181  VSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgspksks  240
            VSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKS
Sbjct  181  VSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKS  240

Query  241  ARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVER  300
            ARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVER
Sbjct  241  ARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVER  300

Query  301  TTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335
            TTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL
Sbjct  301  TTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335

>SDRG_01781
Length=335

 Score = 609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/335 (96%), Positives = 325/335 (97%), Gaps = 0/335 (0%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY+DSKTIYKSDKPKEKGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  121  NVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180
            NV PQAS DQRA+ALLGHRA SGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT
Sbjct  121  NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180

Query  181  VSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgspksks  240
            VSEMGHNAEMLDIAEANMDYV TELDRGDNIIKKMTSPFFYYFSSSKSKKKG GSPKSKS
Sbjct  181  VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKS  240

Query  241  ARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVER  300
            ARSH PQTPMNSPT+KK SGP SK GG TTDAGDDELDQLSKILASLEVHANTISTEVER
Sbjct  241  ARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVER  300

Query  301  TTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335
            TTEQIDRIQKKMVEADER+VEQSAKVHAIQ+KNKL
Sbjct  301  TTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335

>H257_06294
Length=358

 Score = 272 bits (695),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/354 (43%), Positives = 210/354 (59%), Gaps = 27/354 (8%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            M+++L+   QTSCEGYVTKRGH+MKSW+RRYMVL+GDTL VSYYDSK IY S K   KGS
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGS  59

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            F+L+E EK D SDEG  VKP+GFK +GH PG GYKE+ VYVE+  DQT+WL VAHNALGK
Sbjct  60   FVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119

Query  121  NVTPQASVDQRASAL------------------------LGHRAPSGFLTSAPVQLRNVN  156
            N +PQ S+ QR   +                        LGH+  +G + S   Q++NV 
Sbjct  120  NSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVK  179

Query  157  KTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMt  216
            KT +ELL++AI   + A  +GD TV+EM +  ++L+ AE  +D +  ++D  +++ + + 
Sbjct  180  KTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLK  239

Query  217  s-pffyyfssskskkkgtgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDD  275
                +        KK      +    R    +   +S   +    P  +   A     DD
Sbjct  240  HPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPE-DD  298

Query  276  ELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAI  329
            +LDQLSKILA L   A+TIS    RTTEQ+DRI +K+   D+R+ +++  V A+
Sbjct  299  QLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLVQAV  352

>H310_09223
Length=333

 Score = 270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 204/339 (60%), Gaps = 22/339 (6%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            M+++L+   QTSCEGYVTKRGH+MK+W+RRYMVL GDTL V+YYDSK IYKS+ P  KGS
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGS  59

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            F+L+E EK D SDEGG VKP+GFK +GH PG GYKE+ V+VET  DQT+WL VAHNALGK
Sbjct  60   FVLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119

Query  121  NV-TPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179
                P  S++    A  GH+  +G + S   Q++NV KT  ELL++AI   + A  +GD 
Sbjct  120  TTYIPSPSMESHGGA--GHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDA  177

Query  180  TVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMt---------spffyyfssskskk  230
            TV EM +  E+L+ AE  +D +  ++DR +++ K +                    K   
Sbjct  178  TVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGA  237

Query  231  kgtgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVH  290
                    KS RS +    +    H     P  +         +D+LD+LSKILA L   
Sbjct  238  SSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQE---------EDQLDELSKILAKLGQT  288

Query  291  ANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAI  329
            A+TIS    RTTEQ+DRI +K+   DER+ +++  V ++
Sbjct  289  ADTISDITTRTTEQVDRIDQKVTSVDERVTKEAKLVESV  327

>PITG_18456
Length=351

 Score = 193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/337 (39%), Positives = 195/337 (58%), Gaps = 30/337 (9%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKT-----IYKSDKPKEKGSFIL  63
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSYY+S+      I +   P  KG F L
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP--KGIFYL  76

Query  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--  119
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NALG  
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136

Query  120  KNVTPQASVDQRASALLGHRAPSGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLE  171
            + +T QA +DQ  S   G +   GF   L+  P      Q++ ++K+K+ELL +A+  LE
Sbjct  137  RQLTRQA-IDQSVSP--GKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELE  193

Query  172  HARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkk  231
             A+ VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS     K 
Sbjct  194  AAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKS  253

Query  232  gtgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHA  291
               S  S   RSH  Q+  +SPT      PA +    ++DAG  +L++L++ L  LEV A
Sbjct  254  TGSSKGSSPQRSH--QSGGSSPTRLP---PALE---ISSDAGVSDLERLAQALGELEVQA  305

Query  292  NTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
              ++ E  R+++QI+RI+  +     R+ +Q+ +  A
Sbjct  306  ELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASA  342

>PYU1_G001735
Length=342

 Score = 188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 181/336 (54%), Gaps = 23/336 (7%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            K TSCEGYVTKRGH  KSWR RY+V +G  L+VSY++S+    +     KGSF ++ +EK
Sbjct  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTP  124
            H+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +WLEV  NAL   K +T 
Sbjct  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTR  139

Query  125  QASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184
            +   D   S + G  A      S  +Q++ +  TKEELLR+A+  +E A+ +G   V+E+
Sbjct  140  KGMTDSTKS-MFGFGAS----ISPQLQVKKLAATKEELLREALREIEGAKLIGREAVNEI  194

Query  185  GHNAEMLDIAEANMDYVETELDRGDNIIKKMts-----pffyyfssskskkkgtgspksk  239
                E LD  E ++ +VE +LD  D +++ + S               +    T S    
Sbjct  195  VSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKGAPTAATASASGG  254

Query  240  sARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVE  299
            ++ +  P +      H K +G     GG T     ++L+ L+  L+ LE  AN ++ E  
Sbjct  255  ASATTSPVSGTEGQLHAKITG-----GGGTL----NDLEMLALALSELEEQANLMNAEAA  305

Query  300  RTTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335
            R+TEQI RI++++   ++R+  Q+ K  A  +   L
Sbjct  306  RSTEQIARIEERLTSVNDRVQHQTKKATATMKAGNL  341

>PHYRA_81100
Length=349

 Score = 188 bits (477),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 185/334 (55%), Gaps = 26/334 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++VL+G  L++SYY+S+       ++    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121
            IE H+Y     G   KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL   + 
Sbjct  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138

Query  122  VTPQASVDQRASA----LLGH---RAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHAR  174
            +T QA +DQ  S+    L G     +P   +T    Q++ + + K+ELL  A+  +E A+
Sbjct  139  LTRQA-IDQSVSSNKKNLFGFGVSLSPQPLMTPQK-QMQTLTQNKDELLSGALRDIEAAK  196

Query  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtg  234
             VG    +E+    E LD  E ++  ++ +LD GD +++++        S +        
Sbjct  197  LVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRL-------KSPTLHLFSDDS  249

Query  235  spksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTI  294
             PKS +++ H PQ    S        PA +      DAG  +L++L++ L  LEV A  +
Sbjct  250  RPKSTASKGHSPQRSQQSGGSPSRLPPAME---TINDAGVSDLERLAQALGELEVQAEIL  306

Query  295  STEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
            + E  R+T+QI+R++ ++     R+ +Q+ +  A
Sbjct  307  NGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340

>PHALS_06478
Length=345

 Score = 187 bits (476),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 122/337 (36%), Positives = 189/337 (56%), Gaps = 40/337 (12%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIE  67
            TSCEGYVTKRGH  KSWR R++VLDG  L+V+YY+S+        +    KGSF L+ IE
Sbjct  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80

Query  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVT  123
             H+Y     G   +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL   + +T
Sbjct  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140

Query  124  PQASVDQRASA----LLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHAR  174
             QA +DQ  S     L G   PS   ++ PV     Q++ +  +KE LL +A+  +E A+
Sbjct  141  RQA-IDQSVSPNKKKLFGFSVPS---STQPVMSPQKQMQTLATSKEGLLLEALREIEAAK  196

Query  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtg  234
             VG    +E+ +  E LD+ E ++  ++ +LD GD ++ ++ SP  ++FS          
Sbjct  197  LVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDT-------  249

Query  235  spksksARSHQPQTPM-NSPTHKKSSGPAS--KAGGATTDAGDDELDQLSKILASLEVHA  291
                      +P+ P+ + P H  S+ P+    A   T DAG  +L +L++ L  LEV A
Sbjct  250  ----------RPKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQA  299

Query  292  NTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
              +++E   +++QI+RI+  +    ER+ +Q+ +  A
Sbjct  300  ELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336

>PHYSO_471523
Length=348

 Score = 187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/338 (36%), Positives = 182/338 (54%), Gaps = 35/338 (10%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++VLDG  L VSYY+S+        +    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL   + 
Sbjct  79   IEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQ  138

Query  122  VTPQASVDQRASALLGHRAPSGF---LTSAP-----VQLRNVNKTKEELLRKAIVTLEHA  173
            +T QA +DQ  S     +   GF   L+  P      Q++ + K+++ELL  A+  +E A
Sbjct  139  LTRQA-IDQSVSP--NRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAA  195

Query  174  RTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgt  233
            + VG    +E+    E LD  E ++  ++ +LD GD +++++              K  T
Sbjct  196  KQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRL--------------KSPT  241

Query  234  gspksksARSHQPQTPMNSPTHKKSSGPASK---AGGATTDAGDDELDQLSKILASLEVH  290
                S  +R     +  +SP   + SG   +   A  +  DAG  +L++L++ L  LEV 
Sbjct  242  LHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEVQ  301

Query  291  ANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
            A  ++ E  R T+QI+RI+ ++     R+ +Q+ +  A
Sbjct  302  AELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASA  339

>PPTG_17127
Length=351

 Score = 187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 188/336 (56%), Gaps = 28/336 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSYY+S+        +    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KN  121
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL   + 
Sbjct  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138

Query  122  VTPQASVDQRAS----ALLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEH  172
            +T QA +DQ  S     L G    S  L+  P      Q++ + K+K+ELL +A+  LE 
Sbjct  139  LTRQA-IDQSVSPNKKTLFGF---SVALSPQPAMSPQKQMQTLAKSKDELLSEALRELEA  194

Query  173  ARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkg  232
            A+ VG    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS     K  
Sbjct  195  AKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKST  254

Query  233  tgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHAN  292
             GS  S   R H  Q+  +SP+          A   ++DAG  +L++L++ L  LEV A 
Sbjct  255  GGSKGSSPQRFH--QSGGSSPSR------LPPAFDTSSDAGGSDLERLAQALGELEVQAE  306

Query  293  TISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
             ++ E   +++QI+RI+  +     R+ +Q+ +  A
Sbjct  307  MLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342

>PYVX_18171
Length=294

 Score = 179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 138/216 (64%), Gaps = 12/216 (6%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            + TSCEGYVTKRGH  KSWR RY+VLDG  L+V+Y++SKT ++ +    KG F L+ I+K
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ-NGAASKGEFYLSSIDK  68

Query  69   HDYSDEGGGV-----KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKN  121
            H Y   G G      KP+GFK+VGHAP  GY E  ++VET  D T+WLEVAHNAL     
Sbjct  69   HAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128

Query  122  VTPQASVDQRASALLGHRAPSGF--LTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179
            ++ +A+ D   SA    ++  GF   TS   QL+ ++ +K+ELL+ A+  LE A+ +G  
Sbjct  129  MSRKAAGDGGGSAT--TKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGRE  186

Query  180  TVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKM  215
              +EM    E LD  EAN+  +E++LD GD +++++
Sbjct  187  ACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRL  222

>PHYCA_556162
Length=351

 Score = 181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/338 (36%), Positives = 188/338 (56%), Gaps = 32/338 (9%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK-----TIYKSDKPKEKGSFIL  63
            + TSCEGYVTKRGH  KSWR R++VLDG  L+V+YY+S+     T  ++  P  KGSF L
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP--KGSFYL  76

Query  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--  119
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL   
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136

Query  120  KNVTPQASVDQRASA----LLGHRAPSGFLTSAPV-----QLRNVNKTKEELLRKAIVTL  170
            + +T QA +DQ  S     L G    S  L+  P      Q++ + K K++LL  A+  +
Sbjct  137  RQLTRQA-IDQSVSPNKKNLFGF---SVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDI  192

Query  171  EHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskk  230
            E A+ +G    +E+    E LD  E ++  ++ +LD GD +++++ SP  + FS+    K
Sbjct  193  EAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPK  252

Query  231  kgtgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVH  290
              + S  +   RS   Q+  +SPT        ++A  +  D G  +L++L++ L  LE+ 
Sbjct  253  STSSSKANSPQRSQ--QSGGSSPTR------LAQAAESRIDPGASDLERLAQALGELELQ  304

Query  291  ANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
            A  ++ E   +T+QI  I+  +     R+ +Q+ +  A
Sbjct  305  AELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASA  342

>PYAP_17762
Length=348

 Score = 179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 180/324 (56%), Gaps = 12/324 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            K TSCEGYVTKRGH  KSWR R++VL+G  L VSYYDSK + ++     KGSF L+ +EK
Sbjct  28   KPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEK  87

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTP  124
            H+Y     G   KP+GFK+VGHAP  GY E  ++VET  D  +WLEV  NAL   K +T 
Sbjct  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTR  147

Query  125  QASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184
                +  A   L   +P+   TS   Q++ +  TKE++L++AI  +E A+ +G +   E+
Sbjct  148  TGQPEALAPKSLFGFSPA---TSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSACQEI  204

Query  185  GHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgspksksARSH  244
                E LD     + +VE +LD  D +++ M +P  + FSS    +         S+R  
Sbjct  205  FIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSSRD-  263

Query  245  QPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVERTTEQ  304
               TP ++ + +  +   S +  A   A   ++++L+ +L  LE  A  ++ E  + T Q
Sbjct  264  ---TP-SAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQ  319

Query  305  IDRIQKKMVEADERIVEQSAKVHA  328
            ++R+ +++   +ER+  Q+ K +A
Sbjct  320  VERVGEQLAHVNERVKAQTRKANA  343

>PYIR_13451
Length=359

 Score = 175 bits (443),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 115/341 (34%), Positives = 180/341 (53%), Gaps = 19/341 (6%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK-------PKEKGS  60
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+V+YY+S+   K          P  KGS
Sbjct  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKGS  83

Query  61   FILAEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            F ++ +EKH+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +W+EV  NAL
Sbjct  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143

Query  119  G----KNVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHAR  174
                 ++ T     +     + G  A +    S  +Q++ +  TKE+LLR A+  +E A+
Sbjct  144  DAAKKRSRTGGFQDNSTTKTMFGFSASA----SPQLQVKKLAATKEDLLRDALREIEGAK  199

Query  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtg  234
             +G   V+E+    E LD+ E+++  VE +LD  D +++ M      +  S   + K + 
Sbjct  200  LIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM-KRPMLHLFSGDERVKQSP  258

Query  235  spksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTI  294
                 S  + +        T    +    +  G   DA  D L++L+  L  LE  AN +
Sbjct  259  HTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSD-LEKLALALGELEEQANLM  317

Query  295  STEVERTTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335
            + E  ++TEQI R+++++   ++R+  Q+ K +A  +   L
Sbjct  318  NAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNL  358

>PYIW_19971
Length=348

 Score = 161 bits (407),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 112/340 (33%), Positives = 166/340 (49%), Gaps = 26/340 (8%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
            FK TSCEGYVTKRGH  KSWR RY+V +      +   +     +     KGSF ++ +E
Sbjct  22   FKATSCEGYVTKRGHFRKSWRVRYLVFN-----GADLQAAGGGGASPATPKGSFFVSSVE  76

Query  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK----N  121
            KH+Y     GG  KP+GFKLVGHAP  GY E  ++VET  D  +W+EV  NAL       
Sbjct  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136

Query  122  VTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181
             TP A+       + G  A      S  +Q++ +  TKEELLR A+  +E A+ +G   V
Sbjct  137  RTPGAADSSTTKNMFGFSAT----VSPQLQVKKLAATKEELLRDALREIEGAKLIGREAV  192

Query  182  SEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgspksksA  241
            S++      L++ E ++  VE++LD G  ++  M                    P +  +
Sbjct  193  SDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHM-----KRPMLHLFSNDNRSKPNAHHS  247

Query  242  RSHQPQTPMNSPTHKKSSG-PASKAGGATTDAGDD-----ELDQLSKILASLEVHANTIS  295
             SH      +S  H  S G  A  A GA      D     +L++L   L  LE  A  ++
Sbjct  248  GSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATAMN  307

Query  296  TEVERTTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335
             E  ++TEQI R+++++   ++R+  Q+ K  A  +   L
Sbjct  308  AEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNL  347

>CCA18899
Length=343

 Score = 152 bits (383),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 173/332 (52%), Gaps = 18/332 (5%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64
            L  +  TSCEGYVTKRGH  KSWR RY+V+ G  ++VSYY+SK   KS     KGSFIL 
Sbjct  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQ  69

Query  65   EIEKHDYSDE---GGGV--KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-  118
              EKH+Y       G V  KP+GFK+VGHAP  GY E  V+V+++ D  QWL+V +N L 
Sbjct  70   SAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129

Query  119  -GKNVTPQASVDQR--ASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
              K +  +A + +     ++LG    S   T++  Q++ +   K + + +A+  +E A++
Sbjct  130  ASKCMAREAFMAEMDTTKSVLGF---SYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKS  186

Query  176  VGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMts-pffyyfssskskkkgtg  234
             G+    E+    E L   E N+  ++ +L+  + +IK +     +++  S    +    
Sbjct  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATIS  246

Query  235  spksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTI  294
               S     H P     +   +     A +    T D     +++L+  L  LEV A  I
Sbjct  247  KSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTND-----IEKLAMALKDLEVQAQLI  301

Query  295  STEVERTTEQIDRIQKKMVEADERIVEQSAKV  326
            ++E  ++ EQI RI+ ++   ++RI  Q+++V
Sbjct  302  NSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333

>PHYKE_8393
Length=326

 Score = 145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 170/332 (51%), Gaps = 45/332 (14%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            + TSCEGYVTKRGH                     +     +  + P  KGSF L+ I  
Sbjct  19   RPTSCEGYVTKRGH---------------------FPCHPPH-GETPAHKGSFYLSNIAP  56

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KNVTP  124
            H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NALG  + +  
Sbjct  57   HEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMR  116

Query  125  QASVDQRASALLGHRAPSGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLEHARTV  176
            QA +DQ  S     +   GF   L+  P+     Q++ +   KEELL +A+  LE A+ V
Sbjct  117  QA-IDQSVSPT--KKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMV  173

Query  177  GDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgsp  236
            G    +E+    E LD  E ++  ++ +LD GD +++++ +P  + FS     K    S 
Sbjct  174  GREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSN  233

Query  237  ksksARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTIST  296
            +S   R+H  Q+  ++P H   S       G+  DA   +L++L+  L  LE+ A  ++ 
Sbjct  234  ESSPQRTH--QSAGSNPIHLPFS------MGSANDADASDLERLAHALGELELQAELLNG  285

Query  297  EVERTTEQIDRIQKKMVEADERIVEQSAKVHA  328
            E  R+T+QI RI++++     R+ +Q+ +  A
Sbjct  286  EAGRSTQQIARIEQQLSNVTARVEKQTKQASA  317

>PYAR_13570
Length=322

 Score = 138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 101/331 (31%), Positives = 160/331 (48%), Gaps = 49/331 (15%)

Query  24   MKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY--SDEGGGVKPY  81
            + SWR RY+VL+G  L VSY+DSK + ++     KGSF L+ +EKH+Y     G   KP+
Sbjct  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65

Query  82   GFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTPQASVDQRASALLGHR  139
            GFK+VGHAP  GY E  ++VE+  D  +WLEV  +AL   K +T     D  ++  L   
Sbjct  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125

Query  140  APSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM---------------  184
            +P+   TS   Q++ ++ +KEELL++AI  +E A+ +G     E+               
Sbjct  126  SPA---TSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGF  182

Query  185  GHNAEMLDIAEANMDYVETELDRGDNIIKKMtspffyyfssskskkkgtgspksksARSH  244
              +AE LD  E+ +  V+ +LD GD ++  +              K       S  AR  
Sbjct  183  SLHAEKLDHIESELQRVDADLDYGDKLLSHL--------------KSPLLYLFSSDARDK  228

Query  245  QPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLE----------VHANTI  294
               +P +SP   K S  +S    A  DA    +++ S  ++ +E            A  +
Sbjct  229  NSASPAHSPVKSKQSALSS---AARADALGQGVERASGEMSDMERLALLLGELEAQATLL  285

Query  295  STEVERTTEQIDRIQKKMVEADERIVEQSAK  325
            + E  R T Q++R+   +   +ER+  Q+ K
Sbjct  286  NEEAVRGTTQVERVGDALAHINERVQNQTKK  316

>CCI45123
Length=301

 Score = 120 bits (302),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 94/305 (31%), Positives = 159/305 (52%), Gaps = 13/305 (4%)

Query  39   LKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE---GGGVK--PYGFKLVGHAPGHG  93
            ++VSYY+SK  YK+     KGSFIL  +EKH+Y       G VK  P+GFK+VGHAP  G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  94   YKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRASALLGHRAPSGFL---TSAPV  150
            Y E  V+V++  +  QWL+V +N L  N   + + +   + +   +   GF    T++  
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKAN--KRMAREAFMAEMDTTKGVLGFSFAGTTSKQ  118

Query  151  QLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDN  210
            Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  +E++L+  + 
Sbjct  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178

Query  211  IIKKMtspffyyfssskskkkgtgspksksARSHQPQTPMNSPTHKKSSGPASKAGGATT  270
            +IK +  P  Y+FS +   +K   S  + + RSH  QT +     +K+ G          
Sbjct  179  LIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI--LHMRKNDGKIEHVAEEIC  236

Query  271  DAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAIQ  330
               +D L++L+  L  LEV A  I++E  ++ +QI RI+ ++   ++RI  Q+ +V A  
Sbjct  237  VPTND-LEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASS  295

Query  331  EKNKL  335
             K  L
Sbjct  296  GKKNL  300

>PPTG_18898
Length=1559

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 56/104 (54%), Gaps = 13/104 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SYY    +  + K K     ++ +++K D 
Sbjct  407  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  463

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
                   +P+GF  + +        + VY +  +++T+W+   H
Sbjct  464  ------GEPFGFMFMTNE----QVPYYVYADNDRERTKWMNALH  497

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 25/132 (19%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  YY S+     +K K+ G+  + ++    +S
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  263

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTPQASVDQ  130
             E  G   Y  K +          + VY  +  ++++WL    + +   ++V+ +  + +
Sbjct  264  GEAHGFMFYTTKQI---------PYYVYASSEAERSRWLRALKDFMVETEDVSCEGYLTK  314

Query  131  RASALLGHRAPS  142
            R     GH  PS
Sbjct  315  R-----GHLVPS  321

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 20/112 (18%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            L DF    +  SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++      
Sbjct  296  LKDFMVETEDVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQS-----  348

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
              +AE+E    +   G      F  V G+        F V  +TA +Q +WL
Sbjct  349  -AMAEVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWL  392

>PITG_20562
Length=1559

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 56/104 (54%), Gaps = 13/104 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SYY    +  + K K     ++ +++K D 
Sbjct  408  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  464

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
                   +P+GF  + +        + VY +  +++T+W+   H
Sbjct  465  ------GEPFGFMFMTNE----QVPYYVYADNDRERTKWMNALH  498

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  YY S+     +K K+ G+  + ++    +S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  264

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  265  GEAHGFMFYTTKQI---------PYYVYASSEAERSRWL  294

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 20/112 (18%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            L DF    ++ SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++      
Sbjct  297  LKDFMVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQSA----  350

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
              +AE+E    +   G      F  V G+        F V  +T  +Q +WL
Sbjct  351  --MAEVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTTGEQQKWL  393

>PYAR_15463
Length=1091

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 75/161 (47%), Gaps = 31/161 (19%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG TL  +YY+SK   +S +   +G  I++++   +Y  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGR-NLRGRMIISKVRPENYG-  133

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE---------VAHNALGKNVTP  124
                 K +GF +     GH     C   E  KD   W+E         V HN L +++  
Sbjct  134  -----KAHGFLI--ETKGHKLFHLCCSTELEKD--MWVEMMQAAIDEGVKHNTLDRSLLS  184

Query  125  QASVDQRASALLGHRAPSGFLTSAPVQ--LRNVNKTKEELL  163
             A++   +SA       SG +  +P Q  LR+      ELL
Sbjct  185  AAALTSTSSA-------SGAVQPSPTQVDLRSFYFAFRELL  218

>PYAP_22646
Length=815

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 13/122 (11%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGY+ K+GHV++SWR RY +L G T   SYY SK +   D  K +G   +   
Sbjct  96   DMFETDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDVAMLDTEKYRGRVSVTGA  153

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQA  126
            ++ D    G  +               +K F +Y  T  +   W+++   A+    TP+ 
Sbjct  154  KRDDSRTNGVLIT-----------TTIHKIFALYTRTPVEAEIWVKMIQQAVANASTPKP  202

Query  127  SV  128
            SV
Sbjct  203  SV  204

>PHYRA_84916
Length=1541

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SYY    +  + K K     ++ +++K D 
Sbjct  404  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVLVEDVQKWD-  460

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  + +        + VY +  +++ +W+    NAL K
Sbjct  461  ------GEPFGFMFMTNE----QVPYYVYADNDRERNKWM----NALNK  495

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  YY S+     +K K+ G+  + ++    +S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  260

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  261  GEAHGFMFYTTKQI---------PYYVYASSEGERSRWL  290

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 53/108 (49%), Gaps = 16/108 (15%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64
            + + +  SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++        +A
Sbjct  297  MVETEDVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQS------AMA  348

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
            E+E    +   G      F  V G+        F V  +T  +Q +WL
Sbjct  349  EVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTGGEQQKWL  389

>PHYRA_82543
Length=1199

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  I++++   +Y  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  116

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  117  -----KAHGFLLETQ--GHKHFHLCCATELEKD--MWVEMMQAAIEEGV  156

>PYAR_23286
Length=607

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 75/154 (49%), Gaps = 32/154 (21%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY VL G +  VSYY       S K K     ++ ++++ D 
Sbjct  388  ACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQRWD-  444

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK--NVTPQAS  127
                   +P+GF  +     P      + VY +  +++T+W+    NAL K  +V  +  
Sbjct  445  ------GEPFGFMFMTSEQIP------YYVYADNERERTKWM----NALRKLTSVVEEPE  488

Query  128  VDQR-----ASALLGHRAPSGFLTSAPVQLRNVN  156
            V+++     A+ L G R    F  +  + LR  +
Sbjct  489  VEKKRCPNCAAVLTGSR----FCGACGLNLRGTS  518

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  Y+  +     DK K  GS ++ ++    +S
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFAGE-----DKSKRYGSVVVEKVAA--WS  244

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K V          + VY  +  ++ +WL
Sbjct  245  GEAHGFMFYTAKQV---------PYYVYASSESERAKWL  274

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 30/43 (70%), Gaps = 2/43 (5%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            +CEGY+T+RGH++ S R  Y VL+G +L+  +Y  +  Y+ ++
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR--HYADQQAYRDNQ  328

>PHYSO_544598
Length=1163

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  I++++   +Y  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  74

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  75   -----KAHGFLL--ETQGHKHFHLCCSTELEKD--MWVEMMQAAIEEGV  114

>PPTG_19371
Length=1195

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  I++++   +Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  126

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  127  -----KAHGFLI--ETQGHKHFHLCCTTELEKD--MWVEMMQAAIEEGV  166

>PYAP_18636
Length=1009

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG TL  +YY++K   +S +   +G  I++++   +Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGR-NLRGRMIISKVRPENYG-  158

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  159  -----KAHGFLL--ETMGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  198

>PHYSO_361747
Length=1523

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SYY    +  + K K     ++ +++K D 
Sbjct  413  SCAGYLTKQGHKRKSWKKRYFILRGNA--ISYYSDYDMANNSKGKPLAEVLVEDVQKWD-  469

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  470  ------GEPFGFMFMTTEQVP------YYVYADNDRERNKWM----NALNK  504

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 52/101 (51%), Gaps = 18/101 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  YY S+     +K K+ G+  + ++    +S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAT--WS  269

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
             E  G   Y  K +          + VY  +  ++++WL V
Sbjct  270  GEAHGFMFYTTKQI---------PYYVYASSESERSRWLRV  301

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 55/108 (51%), Gaps = 16/108 (15%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64
            + + ++ SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++        +A
Sbjct  306  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQ------LAMA  357

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
            E+E    +   G      F  V G+        F V  +TA +Q +WL
Sbjct  358  EVEIRSVAAWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWL  398

>PYAR_19883
Length=833

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 13/119 (11%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV+++WR RY +L G T   SYY SK +   D  K +G   +    + 
Sbjct  99   ETDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVAMQDTEKYRGRVSVTGASRD  156

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASV  128
            D    G  +               +K F +Y  T  +   W+ +   A+     P+ SV
Sbjct  157  DSRANGVLIT-----------TTIHKAFALYTRTPVEAEIWVRMIQQAVANATLPKPSV  204

>PYU1_G006347
Length=1095

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SYY    +  S K K      LAE+   D 
Sbjct  394  SCAGYLTKQGHKRKSWKKRYFILRGNL--ISYYSDYDLANSAKGKP-----LAEVAVEDV  446

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                G  +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  447  QKWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALSK  485

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (53%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL GD L+  Y+  +     +K K+ GS  +A++    +S
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGE-----EKNKKYGSVTVAKVAP--WS  250

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  251  GEAHGFMFYTTKQI---------PYYVYAASEAERSKWL  280

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 54/108 (50%), Gaps = 20/108 (19%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            ++ SCEGY+T+RGH++ S R  Y VL+G +L+  +Y  ++ Y+ ++        +AE+E 
Sbjct  291  EEVSCEGYLTRRGHLVPSQRMAYYVLNGASLR--HYADQSAYRDNQS------AIAEVEV  342

Query  69   HDYSDEGGGVKPYGFKL---VGHAPGHGYKEFCVYVETAKDQTQWLEV  113
               +   G  +P G       G+        F    +T  +Q +WL+ 
Sbjct  343  RSVAPWDG--EPNGLMFQTSTGNV-------FYASTDTVGEQQKWLQT  381

>PITG_19213
Length=1201

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  I+ ++   +Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIINKVRPENYG-  126

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  127  -----KAHGFLI--ETQGHKHFHLCCTTELEKD--MWVEMMQAAIEEGV  166

>PYAP_16997
Length=1018

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (46%), Gaps = 21/133 (16%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEG++TKRGHV  +W+ RY VL G+ L+  Y+        DK K  GS I+ ++   
Sbjct  204  EIACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSGD-----DKSKRYGSVIVEKVAP-  255

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVD  129
             +S E  G   Y  K V          + VY  +  ++ +WL    + +   V P+    
Sbjct  256  -WSGEAHGFMFYTTKQV---------PYYVYASSEAERAKWLRALRDFM---VEPEEVTC  302

Query  130  QRASALLGHRAPS  142
            +      GH  PS
Sbjct  303  EGFLTRRGHLVPS  315

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY VL G++  ++Y+       S+K K     I+ ++++ D 
Sbjct  401  ACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALAEVIVEDVQRWD-  457

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +          + VY +  +++ +W+    NAL K
Sbjct  458  ------GEPFGFMFMTSE----QVPYYVYADNERERGKWM----NALRK  492

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 6/54 (11%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            L DF    ++ +CEG++T+RGH++ S R  Y VL+G +L+  +Y  +  Y+ ++
Sbjct  290  LRDFMVEPEEVTCEGFLTRRGHLVPSQRFAYYVLNGTSLR--HYADQQAYRDNQ  341

>PHYRA_79281
Length=809

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 2/59 (3%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            ++    D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K+D  K +G
Sbjct  90   LSCAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTDTEKFRG  146

>PHYCA_506137
Length=810

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K+D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTDTEKFRG  147

>H257_06722
Length=1482

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 12/67 (18%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            L+DF        CEGY+TKRGH++ S+R RY VL G T+K  YY  +T Y+S      G+
Sbjct  239  LSDFYVEPDAVDCEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETAYRS------GA  290

Query  61   FILAEIE  67
              LAE+E
Sbjct  291  SALAEME  297

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 75/164 (46%), Gaps = 28/164 (17%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY---DSKTIYKSDKPKEKGSFILAEIEK  68
            +C G++TK+GH  KSW++RY VL G+TL  +YY   D+  + +  KP       L E+  
Sbjct  351  ACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNL-RHGKP-------LGEVTV  400

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT----P  124
             + S   G  +P GF  +     +    + V+ +  +DQ +WL  A   L ++ T    P
Sbjct  401  REVSAWDG--EPSGFMFI----TNDSVPYYVFADNDRDQAKWL-AALRKLFESATSMEEP  453

Query  125  QASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIV  168
              +  + A  L G R    F  +    LR  +  +     + +V
Sbjct  454  DKTCPRCAYVLTGSR----FCGACGFNLRGTSNERSRQASQPLV  493

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 17/100 (17%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
              GY+TKRGHV+ +W+ R+ VL     ++SYY  + +      K+ G   L ++    +S
Sbjct  155  ASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGMK-----KKLGEVHLEKVSP--WS  206

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
             E  G   Y  K +          + VY  T  ++ +WL+
Sbjct  207  GEANGFMFYTNKQIA---------YYVYASTNSERRRWLD  237

>CCA24531
Length=374

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 14/123 (11%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAE  65
            T  ++    G++ K+G +++SW++RYMVL G  L  SYYD+  I  S K KEKGSF +  
Sbjct  18   TSIRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVIT  74

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQ  125
            +E  +    G         L+ H  G G +   +Y ET ++ + W      A   +V   
Sbjct  75   VELSNEIKNG---------LLVH--GRGGRILKLYTETTEEASGWYNAIMEATVISVETA  123

Query  126  ASV  128
            A++
Sbjct  124  AAI  126

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            G++ K G   KSW++RY VL G++L  +Y+ S+
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE  214

>PYU1_G004386
Length=837

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 58/125 (46%), Gaps = 17/125 (14%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGY+ K+GHV++SWR RY +L G T   SYY SK +   D  K +G   +   
Sbjct  132  DMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDVAMIDTEKFRGRVTVTGA  189

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV----AHNALGKNV  122
             K D    G         LV        K F +Y  TA +   W+++      NA G+ +
Sbjct  190  RKDDARTNG--------VLVTTTIN---KVFALYTRTAIESEIWIKMIQQAVQNASGQKM  238

Query  123  TPQAS  127
            +  A+
Sbjct  239  STSAT  243

>PHYKE_1990
Length=1499

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 57/111 (51%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G T  +SYY    +  + K K     ++ ++++ D 
Sbjct  405  ACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALAEVLVEDVQRWD-  461

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  462  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALNK  496

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (53%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  YY S+     +K K+ G+ ++ ++    +S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVMVEKVAT--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQI---------PYYVYASSEAERSKWL  291

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 56/108 (52%), Gaps = 16/108 (15%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64
            + + ++ SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++        +A
Sbjct  298  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGASLR--HYADQQAYRDNQSA------MA  349

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
            E+E    +   G      F+ V G+        F V  +T+ +Q +WL
Sbjct  350  EVEIRSVAPWDGEANGLMFQTVTGNV-------FYVIADTSGEQQKWL  390

>PHYKE_5678
Length=809

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K+D  K +G
Sbjct  96   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEVAKTDTEKFRG  146

>H310_00231
Length=1495

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 91/206 (44%), Gaps = 51/206 (25%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH++ S+R RY VL G ++K  Y+  +T Y+S      G+  LAE+E     
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK--YFADETAYRS------GASALAEMEVR---  299

Query  73   DEGGGVKPYGFKLVGHAPGHGYK-----EFCVYVETAKDQTQWLEVAHNALGKNVTPQAS  127
              GGG      +  G + G   K        +  E   +  +WLE    ALGK      +
Sbjct  300  --GGG------RWDGESTGLFIKTSTGSTLFLCAENVPELQKWLE----ALGK-----VT  342

Query  128  VDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVT---------LEHARTVGD  178
            VD+    +    A +G+LT      R   K +  +LR   +          + H+R +G+
Sbjct  343  VDKPVQPI----ACAGWLTKQ-GHKRKSWKKRYFVLRGTTLAYYTDFDASNMRHSRPLGE  397

Query  179  NTVSEM----GHNAEMLDIAEANMDY  200
             TV E+    G     + +   N+ Y
Sbjct  398  VTVREVSTWDGEPGGFMFVTNDNVPY  423

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 20/160 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C G++TK+GH  KSW++RY VL G TL  +YY        D    + S  L E+   + 
Sbjct  351  ACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYT-----DFDASNMRHSRPLGEVTVREV  403

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT---PQASV  128
            S   G  +P GF  V     +    + V+ +  +DQ +WL         + +   P+ + 
Sbjct  404  STWDG--EPGGFMFV----TNDNVPYYVFADNERDQAKWLTALRKLFESSTSVEEPEKTC  457

Query  129  DQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIV  168
             + A  L G R    F  +    LR  +  +     + +V
Sbjct  458  PRCAYVLTGSR----FCGACGFNLRGTSNERSRQTSQPLV  493

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 47/98 (48%), Gaps = 17/98 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+TKRGHV+ +W+ R+ VL     ++SYY  + +      K+ G   L ++    +S E
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGMK-----KKLGEVHLEKVSP--WSGE  208

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
              G   Y  K +          + VY  T  ++ +WLE
Sbjct  209  ANGFMFYTSKQIA---------YYVYASTNSERRRWLE  237

>CCI46235
Length=1155

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 56/113 (50%), Gaps = 13/113 (12%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            Q   EGYV K+G  +  W  RY+VLDG TL  +YY++K   +S +   +G  ++ ++   
Sbjct  116  QVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSAR-NLRGKMMIVKVRPE  172

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
            +Y       K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  173  NYG------KAHGFLI--ETKGHKHFHLCCATELEKD--MWIEMMQAAIEQAV  215

>PYIW_16987
Length=821

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +YY++K   +S +   +G  I++++   +Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  175

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  176  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  215

>PYU1_G008848
Length=765

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +YY++K   +S +   +G  I++++   +Y  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  189

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  190  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  229

>PHYSO_344112
Length=813

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKMDTEKFRG  147

>HYAP_08026
Length=798

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K D  K +G
Sbjct  84   DLFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKVDTEKFRG  134

>PYIW_17381
Length=952

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  Y+  +     DK K  GS  +A++    +S
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFSGE-----DKGKRYGSVTVAKVAP--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K V          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQV---------PYYVYASSEAERSKWL  291

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 21/114 (18%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   ++Y+    I  S K K      + +++K D 
Sbjct  405  SCAGYLTKQGHKRKSWKKRYFILRGNL--IAYFTDYDIANSAKGKPLAEVTVEDVQKWD-  461

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT  123
                   +P+GF  +     P      + VY +  +++ +W+    NAL K  T
Sbjct  462  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALRKLTT  499

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 32/46 (70%), Gaps = 2/46 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            ++  CEGY+T+RGH++ S R  Y VL+G +L+  +Y  ++ Y+ ++
Sbjct  302  EEVGCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRENQ  345

>PPTG_05519
Length=810

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKMDTEKFRG  147

>CCA18023
Length=1138

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 13/109 (12%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            Q   EGYV K+G  +  W  RY+VLDG TL  +YY++K   +S +   +G  ++ ++   
Sbjct  121  QVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSAR-NLRGKMMIVKVRPE  177

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +Y       K +GF +     GH +   C   E  KD   W+E+   A+
Sbjct  178  NYG------KAHGFLI--ETKGHKHFHLCCATELEKD--MWIEMMQAAI  216

>H257_03361
Length=699

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/62 (39%), Positives = 41/62 (66%), Gaps = 4/62 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
           +G++ K+G V+ SW++RY+VL G    +SY+D +    + + KEKGSF+LA ++ +   D
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQ--NISYFDKEV--SNPRAKEKGSFVLAGVQPNKSYD  66

Query  74  EG  75
            G
Sbjct  67  NG  68

 Score = 35.4 bits (80),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            G++ K+G +++SW++RY VL G    ++Y+D+
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRG--RNIAYFDT  241

>PITG_02762
Length=810

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKLDTEKFRG  147

>SPRG_00364
Length=255

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 53/106 (50%), Gaps = 22/106 (21%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V KRG VM++W+RRY VL  + L  +YYD   I    +PK+ G F+         S E
Sbjct  166  GWVEKRGAVMRTWKRRYFVLRENVL--AYYD---INLEGQPKKGGDFV--------QSIE  212

Query  75   GGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
               +KP G  FK+V        +    + ET  D  QWL +A N L
Sbjct  213  TSTIKPNGLEFKMVSG------RSLLGFTETTDDHVQWL-LAANTL  251

>PHYKE_6662
Length=765

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG+V K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  I+ ++   +Y  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIIVKVRPENYG-  127

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  128  -----KAHGFLI--ETQGHKHFHLCCSTELEKD--MWVEMMQAAIEEGV  167

>PYIR_18382
Length=1154

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +YY++K   +S +   +G  I++++   +Y  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  184

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  185  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  224

>CCI44752
Length=1526

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 52/98 (53%), Gaps = 18/98 (18%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+TKRGHV  +W+ R+ VL G+ L+  YY S+     +K K  GS ++A++    +S 
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE-----EKTKRYGSVVVAKVAP--WSG  273

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G   Y  K +          + VY  +  ++T+WL
Sbjct  274  EAHGFMFYTTKQI---------PYYVYAASEAEKTKWL  302

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 13/100 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G+   +SYY    +  + K K      LAE++  D 
Sbjct  417  ACAGYLTKQGHKRKSWKKRYFILRGNI--ISYYQDYDLANNAKGK-----ALAEVQVEDV  469

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
                G    + F      P      + VY +  +++ +W+
Sbjct  470  QKWDGEAFGFMFMTTEQVP------YYVYADNERERKKWM  503

 Score = 40.0 bits (92),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 53/119 (45%), Gaps = 17/119 (14%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEGY+T+RGH++ S R  Y VL G  L+  +Y  +  Y+ +         +AE+E  
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTYLR--HYADQQAYRDNDSA------MAEVEIR  365

Query  70   DYSDEGGGVKPYGFK-LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN-VTPQA  126
              +     V    FK + G+        F    ET  ++ +W+    N    N V P A
Sbjct  366  SIAAWDAEVNGLMFKTMTGNV-------FYASTETESERQRWVSNHSNTTTSNTVEPVA  417

>PYIW_18480
Length=755

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 51/112 (46%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV++SWR RY +L G T   SYY SK +   D  K +G   +   
Sbjct  46   DMFETDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             K D      GV      LV        K F +Y  T  +   W+ +   A+
Sbjct  104  RKDD--SRANGV------LVTTTIN---KVFSLYTRTPIESEIWVRMIQQAV  144

>PYIR_21589
Length=1568

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 65/133 (49%), Gaps = 25/133 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   ++YY    +  S K +      + +++K D 
Sbjct  405  SCAGYLTKQGHKRKSWKKRYFILRGNL--IAYYPDYDLANSAKGRALAEVTVEDVQKWD-  461

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVD  129
                   +P+GF  +     P      + VY +  +++ +W+    NAL K  T    V 
Sbjct  462  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALRKLTT----VA  501

Query  130  QRASALLGHRAPS  142
            +  ++L   R P+
Sbjct  502  EEPTSLEKKRCPN  514

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  Y+  +     DK K  GS  +A++    +S
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFAGE-----DKGKRYGSVTVAKVAP--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQI---------PYYVYAASEAERSKWL  291

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 33/46 (72%), Gaps = 2/46 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            ++ SCEGY+T+RGH++ S R  Y VL+G +L+  +Y  ++ Y+ ++
Sbjct  302  EEVSCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRDNQ  345

>H310_07701
Length=811

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 52/112 (46%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV+++WR RY +L G     +YY SK    SD  K KG   +   
Sbjct  46   DLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMSDFEKFKGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K FC+Y +T  +   W+ +   A+
Sbjct  104  KK-DPSRSNGFVVTTTID----------KVFCMYTKTPIETELWIRMIEKAV  144

>CCI47145
Length=390

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 88/186 (47%), Gaps = 27/186 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G +++SW++RYMVL G  L  SYYD+  I  S K KEKGSF +  +E  +    
Sbjct  39   GWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVITVELSNEIKN  95

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRASA  134
            G         L+ H  G G +   +Y ET ++ + W    +NA+ +      SV+   + 
Sbjct  96   G---------LLVH--GRGGRILKLYTETTEEASGW----YNAIIEATV--ISVETAVAI  138

Query  135  LLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIA  194
              G  + +G L S    L     T++         + H   +  N V+E+   +++ +  
Sbjct  139  AAGRTSRAGSLGSNETALSVDGCTRDS-------QMAHKICLDSNDVTELLDQSDLQNND  191

Query  195  EANMDY  200
            E  +D+
Sbjct  192  EIEIDH  197

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            G++ K G   KSW++RY VL G++L  +Y+ S+
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE  229

>SPRG_06058
Length=1258

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 52/116 (45%), Gaps = 14/116 (12%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +   CEGY+TKRGH++ S+R RY V+ G  +K  YY  +T Y++      G+  LAEIE 
Sbjct  43   RPVDCEGYLTKRGHLVPSYRLRYFVMCGSVVK--YYSDETAYRT------GASALAEIEV  94

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTP  124
                   G      FK   ++         V  E   D  +W+E       + + P
Sbjct  95   KSGGRWDGESTGLFFKTATNS------TMFVCAENVADLQKWIEALGRIFNEPIKP  144

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 55/120 (46%), Gaps = 13/120 (11%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHD  70
             +C G++TK+GH  KSW++RY VL G  L  SYY        +    +    L+++   D
Sbjct  147  VACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYAD-----FEAANTRAGKALSDVSLKD  199

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQ  130
                 G    + F  + + P      + V+ +  +DQ +W+     A+G +     ++D+
Sbjct  200  VGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGADTLAIETIDE  253

>HYAP_08645
Length=1514

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SYY    +  + K +      LAE+   D 
Sbjct  307  SCAGYLTKQGHKRKSWKKRYFILRGNL--ISYYSDYDMANNTKGRP-----LAEVLVEDV  359

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                G  +P+GF  + +        + VY +  +++ +W+    NAL K
Sbjct  360  QSWDG--EPFGFMFMTNE----QVPYYVYADNDRERNKWM----NALNK  398

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  YY  +     +K K+ G+  + ++    +S
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSGE-----EKSKKYGAVTVEKVAT--WS  163

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  164  GEAHGFMFYTTKQI---------PYYVYASSESERSRWL  193

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 20/112 (18%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
            L DF    ++ SCEGY+TKRGH++ S R  Y VL+G +L+  +Y  +  Y+ ++      
Sbjct  196  LKDFMVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRENQSA----  249

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWL  111
              +AE+E    +   G      F  V G+        F V  +T  +Q +WL
Sbjct  250  --MAEVEIRSVAPWEGETNGLMFMTVTGNV-------FYVIADTVGEQQKWL  292

>H257_07514
Length=810

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV+++WR RY +L G     +YY SK    +D  K KG   +   
Sbjct  46   DLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMADFEKFKGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K FC+Y +T  +   W+ +   A+
Sbjct  104  KK-DPSRSNGFVVTTSID----------KVFCMYTKTPIETELWIRMIEKAI  144

>SDRG_02154
Length=822

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 17/115 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G V+K+W+RR+MVL   +  + Y+++  +  + KP  KGSF +  IE+      
Sbjct  128  GWICKQGSVVKNWKRRFMVL--QSCHLHYFETDKLTPTLKP--KGSFQVLAIERASDLQH  183

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE--VAHNALGKNVTPQAS  127
            G         LV  A G G + F  Y + A+  T W    V+H      VTP AS
Sbjct  184  G---------LV--AKGSGNRVFKFYADDAQSCTAWFTAIVSHLRSRPTVTPSAS  227

>CCA19097
Length=688

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 70/145 (48%), Gaps = 20/145 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G V+K+W+RRYMVL+G+ LK  YYDS     S K +EKGS  +  +E       
Sbjct  9    GWVHKQGAVIKTWKRRYMVLNGNVLK--YYDSAL---SIKMEEKGSVQILSVEMSGSIQN  63

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRASA  134
            G          + H  G G +   +Y +++    +W E   N +   +    S+D+  + 
Sbjct  64   G---------RIMH--GKGGRVLKIYTDSSMQNKEWFEAITNVVC-GIEKYPSIDEAQNI  111

Query  135  LLGHRAPSGFLTSAPVQLRNVNKTK  159
               +  P   + S PV   +++ TK
Sbjct  112  ---NERPEVNVASDPVIRMSLDSTK  133

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 26/34 (76%), Gaps = 2/34 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKT  48
            G++ K+G  +K+W+RR+ +L GD L  SY+D+++
Sbjct  144  GWLVKQGGRVKNWKRRFFLLRGDNL--SYFDTES  175

>SDRG_03531
Length=255

 Score = 52.8 bits (125),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 22/106 (21%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V KRG VM+SW+RRY VL  + L  +YYD   I    +PK+ G  +         S E
Sbjct  166  GWVEKRGAVMRSWKRRYFVLRENVL--AYYD---INLEGQPKKGGDLV--------QSIE  212

Query  75   GGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
               VKP G  FK+V        +    + ET  D  QWL +A N L
Sbjct  213  TSTVKPNGLEFKMVSG------RSLVGFTETTDDHVQWL-LAANTL  251

>HYAP_04457
Length=1203

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 13/105 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G  +L ++   +Y  
Sbjct  62   EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSAR-NLRGRMLLLKVRPENYG-  117

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 K +GF L   +  H +   C   E  KD   W+E+   A+
Sbjct  118  -----KAHGFFLETQS--HKHFHLCCSSELEKD--MWVEMMQAAI  153

>SDRG_12762
Length=1392

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 52/108 (48%), Gaps = 18/108 (17%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH++ S+R RY V+ G  +K  YY  +T Y++      G+  LAEIE     
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGSVVK--YYSDETAYRT------GASALAEIEVKSGG  309

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
               G      FK   ++         V  E   D  +W+E    ALG+
Sbjct  310  RWDGESTGLFFKTATNS------TMFVCAENVADLQKWIE----ALGR  347

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C G++TK+GH  KSW++RY VL G  L  SY+       +   K      L+E+   D 
Sbjct  359  ACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKA-----LSEVSVKDV  411

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +   G V  + F  + + P      + V+ +  +DQ +W+     A+G
Sbjct  412  APWDGEVCGFMFVTLENVP------YYVFADNERDQAKWMTALKKAVG  453

 Score = 38.1 bits (87),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (44%), Gaps = 17/98 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+TKRGHV+ +W+ R+  L     ++SYY+ + + K           L E+     S  
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQG-RLSYYNDEGMGKK----------LGEVHVSKVSPW  212

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
             G    + F+            + VY  +  ++ +WL+
Sbjct  213  SGETNGFMFQTTKQI------SYYVYASSNTERARWLK  244

>H310_04843
Length=968

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +YY+SK   ++ K   +G  I+  +   +Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEARTGK-NLRGRMIITRVLPENYG-  158

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  159  -----KAHGFLI--ETMGHKHFHLCCTTELEKD--MWVEMMQAAIDEGV  198

>SPRG_11900
Length=605

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 69/130 (53%), Gaps = 22/130 (17%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G+V K+G ++KSW++R++V+ G    V+YYD +++++ + P+EKGS +L ++ ++    
Sbjct  6    SGFVFKQGALIKSWKKRFLVVQGR--HVTYYD-RSVHEPN-PREKGSLVLVDVTQN----  57

Query  74   EGGGVKPYGFK--LVGH-APGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQ  130
                   +G K  LV H   G   K   +Y  +A D  +       A G N  P   +D 
Sbjct  58   -------FGLKNGLVLHDVKGRQMK---MYTLSATDLDECFTALQAACGANARPSL-LDV  106

Query  131  RASALLGHRA  140
            RAS++   RA
Sbjct  107  RASSIASDRA  116

 Score = 38.5 bits (88),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 24/32 (75%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G  +K+WR+RY  +DG + ++SY D+
Sbjct  239  GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDA  270

 Score = 34.7 bits (78),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 34/72 (47%), Gaps = 15/72 (21%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G++ K G  +++W+RR+ VL GD   V+Y+      + + PK +G      ++ H    
Sbjct  143  RGWLYKEGQRVRNWKRRFFVLTGD--HVAYFAK----QGENPKGEGRVCGVSLDMH----  192

Query  74   EGGGVKPYGFKL  85
                 KP G  L
Sbjct  193  -----KPLGMLL  199

>SDRG_12763
Length=1317

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 60/116 (52%), Gaps = 23/116 (20%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY-DSKTIYKSDKPKEKGSFILAEIE  67
            K  SC GY+TK+GH  KSW+RRY VL G TL  SYY D  ++ K           LAE+ 
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYDSMNKQS---------LAEVG  268

Query  68   KHDYSDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN  121
              D +   G  + +GF+ +     P      + V+ E+ +++ +W+ VA   L +N
Sbjct  269  VEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM-VALQTLIRN  315

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 0/47 (0%)

Query  5   LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYK  51
           + D  +  C GY+TKRGHV+ +W+ R+ VL    +   Y D   + K
Sbjct  2   MGDGDEILCAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKK  48

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query  11   TSCEGYVTKR--GHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEK  58
            T CEGY+TKR  G    S R +Y VL G  LK  Y D +     D P  K
Sbjct  123  TDCEGYLTKRTPGFSFLSSRPKYYVLTGTLLKC-YNDEEGYRGHDVPSAK  171

>PYVX_20438
Length=1346

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  Y+ S      DK K+ G+  +A++    +S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS-----DDKSKKYGAVTVAKVAP--WS  173

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++ +WL
Sbjct  174  GEAHGFMFYTTKQI---------PYYVYASSEVERAKWL  203

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 56/111 (50%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G +  +SY+    +  S K K      LAE+   D 
Sbjct  318  ACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGK-----ALAEVTVEDV  370

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                G  +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  371  QRWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALRK  409

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 20/103 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SCEGY+TKRGH++ S R  Y VL G  L+  +Y  +  Y+ ++        +AE+E    
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLR--HYADQQAYRENQSA------MAEVEVRSV  269

Query  72   SDEGGGVKPYGF---KLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +   G  +P+G     + G+        F    +T  +Q +WL
Sbjct  270  ATWDG--EPHGLMFQTVTGNV-------FYASADTQGEQQKWL  303

>SDRG_01407
Length=815

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 13/110 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +YY++K   +S +   +G  I+  +   +Y  
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGR-NLRGRMIITRVLPENYG-  140

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT  123
                 K +GF +     GH +   C   E  KD   W+E+   A+ + ++
Sbjct  141  -----KAHGFLI--ETKGHKHFHLCCTTELEKD--MWVEMMQAAIDEGIS  181

>PHALS_03645
Length=830

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G     SYY SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSKDVAKMDTEKFRG  147

>SDRG_14487
Length=964

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query  12  SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
           + EG++ K+G +M +W++RYMVL G    ++YYD +    + + KEKG+F LA +E+
Sbjct  5   AWEGWIYKQGSLMPTWKKRYMVLKG--RHIAYYDKEV--SNPRAKEKGTFTLAAVER  57

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            G++ K G  +KSW++R+ VL G  L  +YYD
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>CCA18875
Length=1514

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 18/98 (18%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+TKRGHV  +W+ R+ VL G+ L+  YY S+     +K K  GS ++A++    +S 
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE-----EKTKRYGSVVVAKVAP--WSG  273

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G   Y  K +          + VY  +  ++ +WL
Sbjct  274  EAHGFMFYTTKQI---------PYYVYAASETEKAKWL  302

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G+   +SYY    +    K K      LAE++  D 
Sbjct  417  TCAGYLTKQGHKRKSWKKRYFILRGNI--ISYYQDYDLANHVKGK-----ALAEVQVEDV  469

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
                G    + F      P      + VY +  +++ +W+
Sbjct  470  QKWDGEAFGFMFMTTEQVP------YYVYADNERERKKWM  503

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (46%), Gaps = 16/114 (14%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEGY+T+RGH++ S R  Y VL G  L+  +Y  +  Y+ +         +AE+E  
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTCLR--HYADQQAYRDNDSA------MAEVEVR  365

Query  70   DYSDEGGGVKPYGFK-LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
              +     V    FK + G+        F    ET  ++ +W+    N L  NV
Sbjct  366  SIAAWDAEVNGLMFKTMTGNV-------FYASTETETERQRWVFNHTNTLTTNV  412

>SPRG_02752
Length=831

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 38/55 (69%), Gaps = 4/55 (7%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
           EG++ K+G +M +W++RYMVL G    ++YYD +    + + KEKG+F LA +E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYDKEVT--NPRAKEKGTFTLAAVER  57

 Score = 35.4 bits (80),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            G++ K G  +KSW++R+ VL G  L  +YYD
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>PHALS_04098
Length=1183

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 13/105 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +YY+SK   +S +   +G   + ++   +Y  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NMRGRMTVYKVRPENYG-  130

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 K +GF L      H     C   E  KD   W+E+ H A+
Sbjct  131  -----KAHGFLL--ETQSHKQFHLCCATELEKD--MWVEMMHAAV  166

>SPRG_00890
Length=883

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 13/110 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +YY++K   +S +   +G  I+  +   +Y  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGR-NLRGRMIITRVLPENYG-  86

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT  123
                 K +GF +     GH +   C   E  KD   W+E+   A+ + ++
Sbjct  87   -----KAHGFLI--ETKGHKHFHLCCTTELEKD--MWVEMMQAAIDEGIS  127

>SPRG_17022
Length=107

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 2/53 (4%)

Query  7   DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
           D   T  EGY+ K+GHV+++WR RY VL G     +YY SK    +D  K KG
Sbjct  28  DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKG  78

>CCA21715
Length=782

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 67/151 (44%), Gaps = 19/151 (13%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV++SWR RY VL G     SYY SK I  +D  + +G   +   E+ 
Sbjct  105  ETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAERD  162

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVD  129
                 G  ++    K+           F +   +  +   W+ +   A+  +   + S+ 
Sbjct  163  GSRTNGVLIRTTVNKV-----------FSIQTSSTIESDLWIRMISQAVANSTGLKTSLT  211

Query  130  QRASALLGHRAPSGFLTSAPVQLRNVNKTKE  160
                +LL     S    S  ++ RN+N TK+
Sbjct  212  --TGSLLAQTVRS----SGDLKTRNMNVTKQ  236

>CCA21860
Length=782

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 67/151 (44%), Gaps = 19/151 (13%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV++SWR RY VL G     SYY SK I  +D  + +G   +   E+ 
Sbjct  105  ETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAERD  162

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVD  129
                 G  ++    K+           F +   +  +   W+ +   A+  +   + S+ 
Sbjct  163  GSRTNGVLIRTTVNKV-----------FSIQTSSTIESDLWIRMISQAVANSTGLKTSLT  211

Query  130  QRASALLGHRAPSGFLTSAPVQLRNVNKTKE  160
                +LL     S    S  ++ RN+N TK+
Sbjct  212  --TGSLLAQTVRS----SGDLKTRNMNVTKQ  236

>CCI10489
Length=777

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            +N    D  +T  EGY+ KRGHV++SWR R+ VL G  L  SYY SK +   +  K +G
Sbjct  94   VNHTFEDMFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVAMLNTEKYRG  150

>CCI45127
Length=202

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 95/190 (50%), Gaps = 3/190 (2%)

Query  146  TSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVETEL  205
            T++  Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  +E++L
Sbjct  15   TTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDL  74

Query  206  DRGDNIIKKMtspffyyfssskskkkgtgspksksARSHQPQTPMNSPTHKKSSGPASKA  265
            +  + +IK +  P  Y+FS +   +K   S  + + RSH  QT +     +K+ G     
Sbjct  75   NHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI--LHMRKNDGKIEHV  132

Query  266  GGATTDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERIVEQSAK  325
                    +D L++L+  L  LEV A  I++E  ++ +QI RI+ ++   ++RI  Q+ +
Sbjct  133  AEEICVPTND-LEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  191

Query  326  VHAIQEKNKL  335
            V A   K  L
Sbjct  192  VVASSGKKNL  201

>SPRG_08834
Length=825

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 17/116 (15%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G++ K+G V+K+W+RR+MVL   +  + Y+++  +  + KP  KGSF +  IE+     
Sbjct  127  RGWICKQGSVVKNWKRRFMVL--QSCHLHYFETDKLTPTLKP--KGSFQVLVIERASDLQ  182

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE--VAHNALGKNVTPQAS  127
             G         LV   PG+  + F  Y + A+  T W    V+H      V P AS
Sbjct  183  HG---------LVAKGPGN--RVFKFYADDAQSCTAWFTAIVSHLRNRPTVAPSAS  227

>SDRG_14486
Length=308

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 17/121 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V K+G +++SW++RYMVL    L  SY+D++ +  S   K KGSF +  IE      
Sbjct  7    QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAS--TKAKGSFAVITIEYAKDIQ  62

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRAS  133
             G         L+ H  G G +   +Y E+A+  T W +     +   V  QAS+  RAS
Sbjct  63   HG---------LLIH--GVGGRVMKLYTESAESCTGWFDAVTAVMLGQVLSQASL--RAS  109

Query  134  A  134
            +
Sbjct  110  S  110

 Score = 37.4 bits (85),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            C G++ K G  +K+W+RR+  L G +L  +YYD+  +  S K
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAK  176

>PYVX_13312
Length=1016

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 13/105 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG  L  +YY+SK   +S +   +G   L+ +   +Y  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGR-NLRGRMQLSRVRPENYG-  131

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 K +GF +     GH     C   E  KD   W+E+   A+
Sbjct  132  -----KAHGFLIETR--GHKSFHLCCTTELEKD--MWVEMMQAAI  167

>PYAP_16161
Length=889

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 21/125 (17%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
            N D T  K    EGY+ K+G ++K W++R+ V DG TL  SYY S+   +  KP      
Sbjct  22   NFDPTFMK----EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSR---RDSKPS-----  67

Query  62   ILAEIEKHDYSDEGGGVKPYG---FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            ++ E+ K+   ++GG  + +      L   A G  Y   C+  E  +  T+WL V  N +
Sbjct  68   VVMEL-KYCTVEDGGRSETWNSTRIHLTDSATGTLY---CLSSEDGQIATEWLTVLKNCI  123

Query  119  GKNVT  123
            G+  T
Sbjct  124  GRIAT  128

>SPRG_06059
Length=1312

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 20/106 (19%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
             K  SC GY+TK+GH  KSW+RRY VL G TL   Y D  ++ K           LAE+ 
Sbjct  221  IKPISCAGYLTKQGHRRKSWKRRYFVLRGGTLAY-YADYDSMNKQS---------LAEVG  270

Query  68   KHDYSDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWL  111
              D +   G  + +GF+ +     P      + V+ E+ +++ +W+
Sbjct  271  VEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM  308

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
           C GY+TKRGHV+ +W+ R+ VL    +   Y D
Sbjct  12  CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYAD  44

 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query  11   TSCEGYVTKR--GHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEK  58
            T CEGY+TKR  G    S R +Y VL G  LK  Y+D +     D P  K
Sbjct  125  TDCEGYLTKRTPGFSFLSSRPKYYVLTGTLLKC-YHDEEGYRGHDVPSAK  173

>PYIR_13120
Length=814

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY +L G T   SYY SK +   D  K +G
Sbjct  100  DMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRG  150

>SPRG_02753
Length=309

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 17/121 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V K+G +++SW++RYMVL    L  SY+D++ +  S   K KGSF +  IE      
Sbjct  7    QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAS--TKAKGSFAVITIEY-----  57

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRAS  133
                 K     L+ H  G G +   +Y E+A   T W +     +   V  QAS+  RAS
Sbjct  58   ----AKDIQHGLLIH--GVGGRVMKLYTESADSCTGWFDAVTAVMLGQVLSQASL--RAS  109

Query  134  A  134
            +
Sbjct  110  S  110

 Score = 37.4 bits (85),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            C G++ K G  +K+W+RR+  L G +L  +YYD+  +  S K
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAK  177

>H257_03093
Length=975

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +YY+SK   ++     +G  I+ ++   +Y  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGT-NLRGRMIITKVLPENYG-  159

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  160  -----KAHGFLI--ETMGHKHFHLCCTTELEKD--MWVEMMQAAIDEGV  199

>PYVX_18338
Length=746

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 2/55 (4%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKG  59
            + D  +T  EGY+ K+GHV++SWR RY VL G T   SYY SK +   D  K +G
Sbjct  73   IEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVATLDTEKYRG  125

>SDRG_05150
Length=787

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/145 (29%), Positives = 58/145 (40%), Gaps = 18/145 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D   T  EGY+ K+GHV+++WR RY VL G     +YY SK    +D  K KG   +   
Sbjct  28   DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGA  85

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA-----LGKN  121
            +K D S   G V                K F +Y +T  +   W+ +   A     +   
Sbjct  86   KK-DPSRSNGFVVTTSID----------KLFTMYTKTPIETELWIRMIEKAVQNEYMHST  134

Query  122  VTPQASVDQRASALLGHRAPSGFLT  146
            + P A  D           PS  LT
Sbjct  135  LLPPAMPDTVGELSATQPLPSSLLT  159

>CCI41225
Length=981

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 56/117 (48%), Gaps = 10/117 (9%)

Query  3    LDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            L+  D      EGYVTKRGH++++W+ R+  L+G+  ++SYY+SK +    +   KG   
Sbjct  129  LESLDIPVVEWEGYVTKRGHLVRNWKMRFFTLEGN--RLSYYESK-VDAQQRAHLKGRVK  185

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +A +     S  G G   Y F     +   G K F   V T  +Q  W+      +G
Sbjct  186  VASVRIDQVSKWGSG---YEFTF---STTEG-KIFHCSVSTPLEQVLWVYFLEAGIG  235

>SPRG_08346
Length=797

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (45%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D   T  EGY+ K+GHV+++WR RY VL G     +YY SK    +D  K KG   +   
Sbjct  28   DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGA  85

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K F +Y +T  +   W+ +   A+
Sbjct  86   KK-DPSRSNGFVVTTSID----------KLFTMYTKTPIETELWIRMIEKAV  126

>PITG_02109
Length=522

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +YYD+  +  + KP  KGSF +  +E       
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLNPTVKP--KGSFQVITVELSPDIQN  193

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            G         L+ H  G G + F +Y  +A+  + W  +  +A
Sbjct  194  G---------LLVH--GRGGRVFKLYTASAEATSAWYNMILDA  225

 Score = 38.1 bits (87),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 4/48 (8%)

Query  2    NLDLTDF--KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +L L+D   +Q +  G++ K G  +KSW+RRY VL G+ L  SY++S+
Sbjct  266  SLPLSDSGSEQVTHFGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  311

>PYU1_G006732
Length=954

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (47%), Gaps = 14/118 (12%)

Query  5    LTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFIL  63
            L +F  T   EGY+ K+G  +K W+RR+ V D  TL  SYY S+   K  KP        
Sbjct  11   LAEFDATCMKEGYLQKKGQRLKGWKRRWFVCDARTL--SYYISR---KDRKPN-------  58

Query  64   AEIEKHDYSDEGGGV-KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            A I     S + GG+ + +    +    G     +C+  E  +  TQWL V  NA+ K
Sbjct  59   AVIPLEGCSVQDGGLSETWNSPRIYLTDGTNGVMYCLSSEDGEAVTQWLAVLRNAVAK  116

>CCA16487
Length=975

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 57/117 (49%), Gaps = 10/117 (9%)

Query  3    LDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            L+  D      EGYVTKRGH++++W+ R+  L+G+  ++SYY++K +    +   KG   
Sbjct  127  LESLDIPVVEWEGYVTKRGHLVRNWKMRFFTLEGN--RLSYYENK-VDAQQRAHLKGRVK  183

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +A +     S  G G   Y F     +   G K F   V T+ +Q  W+      +G
Sbjct  184  VASVRIDQVSKWGSG---YEFTF---STTEG-KTFHCSVSTSLEQLLWVYFLEAGIG  233

>PYVX_13574
Length=950

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY+SK +   ++   KG   +A +
Sbjct  152  DLPMVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYESK-VDARNRSHLKGRVNVASV  208

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  209  KIDKVAKSGQGFD-FSFETTEG------KVFHCSVPTQFDQLAWV  246

>SDRG_06288
Length=641

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 42/57 (74%), Gaps = 4/57 (7%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
             G+V K+G ++KSW++R++V+ G    VSYYD +++++ D P+EKGS +L ++ ++
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGR--HVSYYD-RSVHEPD-PREKGSLVLGDVTQN  57

 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (63%), Gaps = 4/48 (8%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            G + K+G  +K+WR+RY  +DG + ++SY D++T    + PK  G  +
Sbjct  263  GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDAET----EPPKGYGKVV  306

 Score = 35.0 bits (79),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 35/72 (49%), Gaps = 15/72 (21%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G++ K G  +++W+RRY VL GD   ++Y+      + + PK +G  +   ++ H    
Sbjct  167  RGWLYKEGQRVRNWKRRYFVLTGD--HIAYFAK----QGENPKGEGRVVSVILDLH----  216

Query  74   EGGGVKPYGFKL  85
                 KP G  L
Sbjct  217  -----KPLGMLL  223

>PYAR_19914
Length=788

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SYY++K +   ++   KG   +  +
Sbjct  139  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK-VDARNRDHLKGRVNVVSV  195

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE-----VAHNALGKN  121
            +    S  G G   + F  V        K F   V T  ++  W+      V H+A  KN
Sbjct  196  KAEKVSKSGHGFD-FSFDTVEG------KTFHCSVPTETERLMWVYFLEAGVDHSATKKN  248

Query  122  VTP  124
              P
Sbjct  249  NKP  251

>PYIW_13172
Length=939

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SYY+SK +   ++   KG   +A +
Sbjct  143  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK-VDARNRNHLKGRVNVASV  199

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  +Q  W+
Sbjct  200  KIEKVSKSGHGFD-FAFET---SEG---KVFHCSVPTQMEQLSWI  237

>PYAP_13695
Length=348

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G ++K+W+RR+MVL G  L  +YYD++ I  S + KEKGSF +  +E    SD 
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTERI--SPRVKEKGSFQVITVELS--SDI  65

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
              G       L+ H  G G +   +Y ++  +   W     +A
Sbjct  66   QNG-------LIVH--GRGGRVLKLYTDSTDNTNGWYHAIMDA  99

 Score = 40.0 bits (92),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            Q    G++TK G  +K+W+RR+  L GDTL  SY+DS
Sbjct  151  QVQHSGWLTKEGMRVKNWKRRWFTLRGDTL--SYFDS  185

>H310_00230
Length=1248

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 17/113 (15%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAE  65
            +  +  +C GY+TK+GH  KSW+RRY VL G  L  SYY   T Y+S   +      LAE
Sbjct  219  SSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY---TDYESANKQ-----CLAE  268

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +   D     G +  + F             + VY +T +++ +WL VA  AL
Sbjct  269  VGIEDVQVWDGEMHGFMFTTTEQV------MYYVYADTERERQKWL-VALKAL  314

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 6/60 (10%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
           C GY+TKRGHV+ +W+ R+ VL      +SYY+ +++      K+ G   LA++   +Y+
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLRPHA-NLSYYEDESM-----SKKLGQVHLAKVAPWEYN  65

>PHYKE_2479
Length=171

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (52%), Gaps = 10/102 (10%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            ++  EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A ++  
Sbjct  72   RSKWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASVKMD  128

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
              +  G G   + F+          K F   V T  DQ  W+
Sbjct  129  KVAKNGHGFD-FSFETTEG------KVFHCSVPTQFDQLAWV  163

>PYU1_G012870
Length=352

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 19/98 (19%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF--ILAEIEKHDYS  72
            G+V K+G ++++W++R+MVL G  L  +YYD+ +I  S K KEKGSF  I AE+     S
Sbjct  7    GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDTASI--SPKTKEKGSFQVITAELS----S  58

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
            D   G       L+ H  G G +   +Y ++A+    W
Sbjct  59   DIQNG-------LLVH--GKGGRVLKLYTDSAESSRAW  87

 Score = 38.5 bits (88),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            +L L D       G++ K G  +K+W++RY  L G+TL  SYYDS
Sbjct  141  SLPLDDAGSIHHSGWLKKEGSRIKNWKKRYFTLHGNTL--SYYDS  183

>PYU1_G001063
Length=783

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G  L  SYY+SK +   ++   KG   +A +
Sbjct  140  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESK-VDARNRSHLKGRVQVASV  196

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  DQ  W+
Sbjct  197  KLEKTSKSGHGFD-FSFET---SEG---KVFHCSVPTKFDQLTWV  234

>PYIR_15309
Length=937

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SYY+SK +   ++   KG   +A +
Sbjct  141  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK-VDARNRSHLKGRVNVASV  197

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  +Q  W+
Sbjct  198  KVEKVSKSGHGFD-FSFET---SEG---KVFHCSVPTQMEQLSWV  235

>PYIW_21108
Length=2593

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 73/164 (45%), Gaps = 17/164 (10%)

Query  9     KQTSCEGYVTKRGHVMKS-WRRRYMVLDGDTLKVSYYDSKTIYKSDKPK---EKGSFILA  64
             K+   EGYV  R H + + WR R+ VL+G  L + Y DS      D+ +   EK   I  
Sbjct  2152  KRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDRERTALEKHDLIAV  2210

Query  65    EIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTP  124
             E     YS   G    +GF++   A G  Y E C  V T  +QT+WL V  +A+    T 
Sbjct  2211  EKWHPTYSANLGSGSRFGFRVENEAGG--YLE-CT-VTTEDEQTKWLAVVSDAVSDLAT-  2265

Query  125   QASVDQRASALLGHRAPSGFLTSAPVQ--LRNVNKTKEELLRKA  166
                     S ++   A   F++ A ++  L+   K K  L  K+
Sbjct  2266  -----HATSKMMARDAVLPFISGAAMEGYLKTKEKKKLALFWKS  2304

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 52/112 (46%), Gaps = 6/112 (5%)

Query  8     FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
              ++   EGY+ KRGH++ S R+RY VL  +   + Y+ +    ++   +  GSF + EI 
Sbjct  1228  LREALMEGYLVKRGHLIPSMRKRYCVLLKNA-SLEYFATHEDSRNPAIRPHGSFQV-EIV  1285

Query  68    KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                +         +G +L       G   FC   + A+D+T W+    +A+ 
Sbjct  1286  SDWHGKTASKSYDHGMEL---ETSDGKTFFCAAYK-AEDKTAWMHAFKHAIA  1333

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ KRG ++ + +RRY VL G T+   Y +     +   P++    +L  ++  D+  
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKG-TMLAYYTNEDECKRQATPRD----VLEVVQARDWDG  56

Query  74   EGGGVKPYGFKL-VGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 + Y     + +  G  Y+  C   ++ +D+  W++   +AL
Sbjct  57   ASALRQHYKHAFEIDYLGGATYQCHC---DSLEDKQLWMQAIQHAL  99

>PPTG_13401
Length=927

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A +
Sbjct  102  DLPMVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  158

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  159  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQIAWV  196

>PPTG_14630
Length=398

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 57/114 (50%), Gaps = 17/114 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +YYD+  +  + KP  KGSF +  +E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLVPTVKP--KGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASV  128
            G         L+ H  G G +   +Y  +A+  + W  +  +A     TPQ  V
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA--TTATPQQFV  108

 Score = 38.5 bits (88),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SY++S+
Sbjct  149  EQVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  185

>PYAR_25500
Length=473

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 9/99 (9%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            + EGY+ K+  V+  WR  Y VL+GDTL  +YY+S+  + S+  K  G   + ++   D 
Sbjct  60   AFEGYLHKKSEVLSHWRATYCVLEGDTL--AYYESREDFISNT-KLIGRIQVQDVGDDDQ  116

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
            S   G  KP+GF+++      G++   +   TA ++ QW
Sbjct  117  SAPNG--KPHGFRIM----TEGHRAHHLSSRTAFEKDQW  149

>PHYCA_503112
Length=214

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A +
Sbjct  110  DLPIVEWEGYVTKRGHLVRNWKSRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  166

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  167  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQLAWV  204

>HYAP_07348
Length=973

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 53/118 (45%), Gaps = 12/118 (10%)

Query  4    DLTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            +L DF  +   EG++ K+G  +K W+RR+ V DG TL  SYY SK   K  KP       
Sbjct  29   NLPDFDASFMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISK---KDRKPNAVIPLE  83

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
               +E    S+     + Y   L   A G  Y   C+  E     TQWL V   A+ +
Sbjct  84   GCSVEDGGLSETWNSPRIY---LTDPATGIMY---CLSAEEGTVVTQWLHVLRAAVAR  135

>SDRG_01408
Length=916

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 12/115 (10%)

Query  4    DLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFIL  63
            D+ + ++   EG+V K+G  +  W  RY+VLDG TL  +YY  +   +S K   +G  +L
Sbjct  115  DIGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGK-NLRGRMVL  171

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              +   D+     G K +GF +     GH     C   E  KD   W+E+   AL
Sbjct  172  TYVGP-DFK----GKKAHGFMI--ETKGHKRFHLCCATELEKD--MWVEMMQTAL  217

>PITG_11303
Length=293

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            CEGY+TKRGHV  +W+ RY  L G+ L+  YY S+
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE  246

>PYIR_23372
Length=1415

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 61/118 (52%), Gaps = 19/118 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  +++SW+  Y VL+GDT+  +YY+S+  + S+      S ++  I+    
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDFISN------SKLMGRIQIQGV  373

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQAS  127
             D+  G KP GF+++  GH   H      +   T  ++ QW      A+ K   P++S
Sbjct  374  EDDNMG-KPNGFRVITEGHRTNH------LSSRTGFEKDQWKRAITVAITK--APESS  422

>SPRG_00889
Length=994

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 12/115 (10%)

Query  4    DLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFIL  63
            DL + ++   EG+V K+G  +  W  RY+VLDG TL  +YY  +   +S K   +G  +L
Sbjct  113  DLGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGK-NLRGRMVL  169

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              +   D+  +    K +GF +     GH     C   E  KD   W+E+   AL
Sbjct  170  TYVGP-DFKSK----KAHGFMI--ETKGHKRFHLCCATELEKD--MWVEMMQTAL  215

>PYAR_14615
Length=517

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G   KSW+RR+ V DG TL  SYY S+   K  KP        A I     + 
Sbjct  38   EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR---KDRKPN-------AIIPLESCTV  85

Query  74   EGGGV-KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            E GG+ + +    +    G     +C+  E  +  T WL V   A+ K
Sbjct  86   EDGGISETWNSPRIYLTDGTTGTMYCLSAEDGEVVTAWLNVLRTAIAK  133

>PITG_18067
Length=924

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A +
Sbjct  102  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  158

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  159  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQLAWV  196

>PHALS_06533
Length=930

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A +
Sbjct  104  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VEARNRSHLKGRVNVASV  160

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  161  KVDKVAKNGHGFD-FSFETTEG------KVFHCSVPTHFDQLAWV  198

>CCA17102
Length=884

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 17/125 (14%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYV KRGH++++W+ R+  L+G+  ++SYY+SK   +  +   KG   LA +
Sbjct  103  DLPAVEWEGYVIKRGHLVRNWKMRFFTLEGN--RLSYYESKGDAQQ-RVHLKGRVKLASV  159

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL-------EVAHNALG  119
                 S  G G   + F+          K F   V T  DQ  W+       E A+   G
Sbjct  160  RIEAVSRLGNGFD-FTFETAES------KVFHCSVPTKLDQLLWIHFMETGAECANMRAG  212

Query  120  KNVTP  124
            + V P
Sbjct  213  RAVGP  217

>PYIR_13555
Length=355

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 4/53 (8%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
           G+V K+G ++++W++RYMVL G  L  +YYD+ ++  + K KEKGSF +  +E
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQL--TYYDTASL--TAKTKEKGSFQVITVE  58

 Score = 38.5 bits (88),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            G++ K G  +KSW++RY  L G+TL  SYYDS
Sbjct  160  GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDS  189

>PHYRA_77834
Length=936

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSYY++K +   ++   KG   +A +
Sbjct  112  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  168

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G + + F+          K F   V T  DQ  W+
Sbjct  169  KVDKVAKNGHGFE-FSFETTEG------KVFHCSVPTHFDQLAWV  206

>PHALS_06568
Length=388

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++KSW++RYMVL G  L  +YYD+  + +  KPK     I  E+     +D 
Sbjct  12   GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDTAKVDQKVKPKGSCQVITVELS----TDI  65

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
              G       L+ H  G G +   +Y  +A+  + W  +  +A
Sbjct  66   QNG-------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA  99

 Score = 38.9 bits (89),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 28/39 (72%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +Q +  G++ K G  +KSWRRR+ VL G++L  SY++S+
Sbjct  147  EQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNSE  183

>PYVX_14527
Length=1269

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 60/118 (51%), Gaps = 19/118 (16%)

Query  15    GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
             G+V K+G ++++W++R+MVL G  L  +YYD+  +  S   K KGSF L  +E       
Sbjct  903   GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDTARLTPS--VKAKGSFTLITVELSTEIQN  958

Query  75    GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRA  132
             G         L+ H  G G +   +Y ++A+  + W    +N + +      +VD+R+
Sbjct  959   G---------LLVH--GRGGRVLKLYTDSAESTSMW----YNRIMEATAAPGNVDRRS  1001

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15    GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
             G++ K G  +KSW+RR+  L GD L  SY+DS+
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSE  1079

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +Q +  G+V K G +++SW++R++V  G  L  +YY  K   + +  +  G+   A IE+
Sbjct  583  EQVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYY--KNTDRENHAQLLGALTAARIER  638

 Score = 31.6 bits (70),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            G++ K G   K+W++RY VL G+ L  S
Sbjct  714  GWLEKEGQHFKTWKKRYFVLRGNRLTYS  741

>PYAP_22195
Length=901

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W+RR+ V +G TL  SYY S+   K  KP          +E      
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR---KDRKPNAVIPLETCTVE------  86

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            +GG  + +    +    G     +C+  E A+    WL V  NA+ K
Sbjct  87   DGGLSETWNSPRIYLTDGTSGVMYCLSAEDAEVVNAWLTVLRNAVAK  133

>H310_13627
Length=678

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 19/114 (17%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD-SKTIYKSDKPKEKGS  60
            N+ L D +     G++ K+GH++K+W+RR+ VLDG  L+    D   T+ KS   K KG 
Sbjct  257  NIGLDDTQLDRKSGWLYKQGHILKNWKRRFFVLDGSVLRYFSEDVDATVPKSTTHKLKGE  316

Query  61   FIL-----------AEIEKHDYS---DEGGGVKPYGFKLVGHAPGHGYKEFCVY  100
             +L             +   D++   D  GG    GF L+  A     +E  +Y
Sbjct  317  VLLFHKDTTVHYVDIHLSGRDFTFAIDTSGG----GFSLMLQASSLDEREDWIY  366

>CCI42457
Length=906

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 2/41 (5%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            D      EGYV KRGH++++W+ R+  L+G+  +VSYY+SK
Sbjct  123  DLPAVEWEGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESK  161

>PYAP_17290
Length=835

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 59/123 (48%), Gaps = 15/123 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SYY++K +   ++   KG   +A +
Sbjct  146  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENK-VDARNRDHLKGRVNVASV  202

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE-----VAHNALGKN  121
            +    S  G G   + F+          K F   V T  +Q  W+      +  NA+ +N
Sbjct  203  KLDKVSKSGHG-HDFSFETTEG------KVFHCSVPTEMEQLAWVYFLEAGIDSNAMKRN  255

Query  122  VTP  124
              P
Sbjct  256  NKP  258

>PYIR_17453
Length=2619

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 54/113 (48%), Gaps = 10/113 (9%)

Query  13    CEGYVTKRGHVM-KSWRRRYMVLDGDTLKVSYYDSKTIY---KSDKPKEKGSFILAEIEK  68
             CEGYV  R H +  +WR R+ VL+ DT    Y D+       +  K  EK   I  +   
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLE-DTRLYLYPDTSAALSEGREQKALEKHDLIAVKKWH  2218

Query  69    HDYS-DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
               YS + G G   +GF++   A   GY E  V +E   +QT+WL    NA+ +
Sbjct  2219  PTYSTNLGNGSSRFGFRVENEAG--GYLECTVIIE--DEQTKWLAAITNAVSE  2267

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  9     KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
             +Q   EGY+ KRGH++ S R+RY VL  +TL+  Y+ +    ++   +  GSF
Sbjct  1217  RQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPAIRPHGSF  1267

>PYIW_18491
Length=1684

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 54/101 (53%), Gaps = 17/101 (17%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  ++++W+  Y VL+GDT+  +YY+S+  + S+      S ++  I+    
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDFISN------SKLIGRIQIQGV  358

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQW  110
             D+  G KP GF+++  GH   H      +   T  ++ QW
Sbjct  359  EDDNMG-KPNGFRIITEGHRTNH------LSSRTGFEKDQW  392

>PYVX_16714
Length=1030

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 48/107 (45%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG  L  SYY S+   K  KP          ++    S+
Sbjct  160  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISR---KDRKPNAVIPLEGCTVQDGGISE  214

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL V  NA+ +
Sbjct  215  TWNSPRIY---LTDGATGVMY---CLSAEDGTAVTQWLAVLRNAVAR  255

>PHYSO_478611
Length=522

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 64/138 (46%), Gaps = 22/138 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +YYD+  +  +   K KGSF +  +E       
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVDPTV--KAKGSFQVITVELSTDIQN  196

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRASA  134
            G         L+ H  G G +   +Y  +A+  + W  +  +A      PQ +   R S 
Sbjct  197  G---------LLVH--GRGGRVLKLYTASAEATSSWYNMILDATA-TAPPQFAPPDRFST  244

Query  135  LLGHRAPSGFLTSAPVQL  152
            L      S   TS PV +
Sbjct  245  L------SAASTSKPVDV  256

 Score = 38.5 bits (88),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SY++S+
Sbjct  277  EQVAHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  313

>H257_06721
Length=1238

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAE  65
            +  +  +C GY+TK+GH  KSW++RY VL G  L  SYY   T Y S   +      LAE
Sbjct  225  SSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY---TDYDSTNKQ-----CLAE  274

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +   D     G +  + F             + VY E+ +++ +WL
Sbjct  275  VGIEDVQVWDGEMHGFMFTTSEQV------VYYVYAESERERQKWL  314

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 7/72 (10%)

Query  1   MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60
           +  D +D ++  C GY+TKRGHV+ +W+ RY VL      +SYY+ +++      K+ G 
Sbjct  3   LGFDYSD-EEILCRGYLTKRGHVVTNWKMRYFVLRPHA-SLSYYEDESM-----AKKLGQ  55

Query  61  FILAEIEKHDYS  72
             LA++   +Y+
Sbjct  56  VHLAKVAPWEYN  67

>PYIR_22246
Length=559

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 48/92 (52%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  ++L++ Y+ S+  Y  +K   +G    + + K D        KP GF+  
Sbjct  43   WKKRYCVIYKESLQIVYFQSEADY--EKGTIRGKIPFSTVHKWD-------GKPNGFQF-  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +  K F VY ETA++Q QWL     A+
Sbjct  93   -YTPSN--KCFRVYTETAEEQEQWLAAMQTAI  121

>PYAR_18690
Length=2455

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 14/110 (13%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY----DSKTIYKSDKPKEKGSFILAEIEKH  69
             EGY+ KRGH++ S R+RY VL  + L  +YY    DS+    SD  +  GSF + EI   
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSR---NSDTSQPLGSFRV-EIVSD  1191

Query  70    DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
              +         +G +L  H    G   FC    +++++TQW+   H+ + 
Sbjct  1192  WHGKTAMQTYEFGMELETH---DGKTFFCAAF-SSEEKTQWIRAFHHGIA  1237

>PYIR_23012
Length=965

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 50/107 (47%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W+RR+ V D  TL  SYY ++   K  KP       +  +E     D
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCDARTL--SYYINR---KDRKPNA-----VIPLEGCTVQD  87

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
             GG  + +    +    G     +C+  E  +  TQWL V  NA+ K
Sbjct  88   -GGLSETWNSPRIYLTDGTSGVMYCLSAEDGEAVTQWLLVLRNAVTK  133

>H257_06469
Length=76

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
           EGYV K+GHV+KSW+RRY  LD  T  + Y     I  +D
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEYLTELAIALAD  41

>H310_05457
Length=269

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (48%), Gaps = 21/105 (20%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +Q   +G+V KRG  ++SW+RR+ +L  + L  SYYD   I    +P++ G  +L     
Sbjct  177  RQDVMKGWVEKRGSRIRSWKRRFFILRENLL--SYYD---INLEGQPQKGGDVVL-----  226

Query  69   HDYSDEGGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
               S E   VKP G  FK+         +    + E A D  +WL
Sbjct  227  ---SIENSTVKPNGLEFKMTNG------RSLVGFTEEADDHARWL  262

 Score = 31.2 bits (69),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 5/34 (15%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKT  48
           GYV +   + K W+RR+MVL+G  L  SYY ++T
Sbjct  39  GYVYR---LSKKWKRRFMVLEGRDL--SYYGNET  67

>PYU1_G009508
Length=328

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (72%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   K+WRRRY +L  DT  +SYYDS
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>PITG_10462
Length=1028

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP          ++    S+
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  172

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  173  TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  213

>PHYRA_82040
Length=1054

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 53/117 (45%), Gaps = 12/117 (10%)

Query  5    LTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFIL  63
            L D+  T   EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP        
Sbjct  133  LADYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEG  187

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
              ++    S+     + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  188  CTVQDGGLSETWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  238

>CCI40991
Length=801

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/171 (24%), Positives = 65/171 (38%), Gaps = 34/171 (20%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY-----------------YDSKTI  49
            D  +T  EGY+ K+GHV++SWR RY VL G     +                  Y SK I
Sbjct  102  DLFETDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDCCVDYSSKEI  161

Query  50   YKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQ  109
              +D  + +G   +   E+ +    G         LV        K F +   +  +   
Sbjct  162  AMADTERYRGRVTVTGAERDESRTNG--------VLVSTTVN---KVFSIQTSSTIESDL  210

Query  110  WLEVAHNALGKNVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKE  160
            W+ +   A+        S  Q+ S   G        +S  ++ RN+N TK+
Sbjct  211  WIRMISQAVAN------STGQKTSLTSGSLLAQTVRSSGDLKTRNMNVTKQ  255

>PYAR_16228
Length=862

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 59/122 (48%), Gaps = 21/122 (17%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
            N D T  K    EG + K+G ++K W++R+ V DG TL  SYY ++        +E    
Sbjct  22   NFDPTFMK----EGPLQKKGQMLKGWKQRWFVCDGRTL--SYYSNR--------RESRPS  67

Query  62   ILAEIEKHDYSDEGGGVKPYGFK---LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            ++ E+ K+   ++GG  + +  K   L  +A G  Y   C+  E  K  + WL V  N +
Sbjct  68   VVVEL-KYCTVEDGGRSETWNSKRIHLTDNATGTLY---CLTSEDGKIASDWLAVFRNCI  123

Query  119  GK  120
             +
Sbjct  124  AR  125

>PHYCA_564296
Length=957

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 52/116 (45%), Gaps = 11/116 (9%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVD  129
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +     A+ D
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVARVNNGTAATD  142

>H310_00209
Length=1198

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 14/113 (12%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
            F   + EGY++K+G ++ +W+  Y VL+G TL +  YDS+  + +D    K   IL    
Sbjct  255  FGGIAFEGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADA-GLKVRVILV---  308

Query  68   KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
              D +D+    +P+GF +       G+K   +   TA +Q QW+      L K
Sbjct  309  --DVNDDVA--RPHGFAI----KTEGHKTLHLASRTAFEQEQWVRAIRLQLTK  353

>PHYRA_79348
Length=1240

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 58/114 (51%), Gaps = 17/114 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DTL  ++YD++  + S+      + ++  I+ 
Sbjct  263  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYDTREDFISN------TKLIGRIQL  314

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                DE  G KP GF+L+  G+   H      +   TA ++ QW      A+ K
Sbjct  315  QGIEDEDMG-KPNGFRLIAEGNHINH------LSSRTAFEKEQWKRAISIAISK  361

>PYIW_20891
Length=291

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 38/53 (72%), Gaps = 4/53 (8%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
           G+V K+G ++++W++R++VL G  L  +YYD+ ++  + K KEKGSF +  +E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGKQL--TYYDTASL--TPKTKEKGSFQVITVE  57

 Score = 35.4 bits (80),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            G++ K G  +K+W++RY  L G+TL  SY+DS
Sbjct  97   GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDS  126

>PHYSO_558498
Length=967

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>H310_06666
Length=887

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 49/105 (47%), Gaps = 11/105 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SYY SK         EK    +  +E     D
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKL--------EKKPNAVIPLESATVQD  73

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             GG  + +    +    G     +C+  +     +QWLEV   A+
Sbjct  74   -GGTSETWNSPRIYLTDGTSGTMYCLSGDEGDVVSQWLEVLDRAV  117

>PHYKE_1044
Length=521

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>PPTG_08785
Length=944

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>PHYRA_73297
Length=119

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 58/134 (43%), Gaps = 23/134 (17%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIY-KSDKPKEKGSFILAEIEK  68
            QT  +GY+ +RG  +KSWRRRY + +         D   +Y K+D P  +   +L E   
Sbjct  2    QTVVDGYLERRGRHLKSWRRRYFIFE---------DGMLLYKKNDNPAAR---VLHEDRV  49

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASV  128
             D     G  +P+G  L       G +   +   + +D  +W    H+A+   +  Q  V
Sbjct  50   FDVLYWAG--RPHGLCL----KLRGDRVVYLTARSEEDAARW----HDAIESYLVEQRCV  99

Query  129  DQRASALLGHRAPS  142
            +    AL   R PS
Sbjct  100  EDLRRALCRGRLPS  113

>PHALS_09729
Length=949

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SYY S+   K  +P          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRRPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLQVAVAR  133

>H257_08182
Length=859

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 4/55 (7%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
           G++ K+G  +K+W++RYMVL G    V+YYD   +     P EKG+ +L ++ ++
Sbjct  10  GWIYKQGSRVKTWKKRYMVLQGR--HVTYYDKSVL--EPNPTEKGALVLVDVTQN  60

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 6/40 (15%)

Query  9    KQTSC----EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY  44
            ++TSC    EG++ K+G  +KSW+RRY V+ G  L  +YY
Sbjct  655  RRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYY  692

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 4/38 (11%)

Query  11   TSC---EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            TSC    G++ K G  +KSW+RRY  L G  L V Y D
Sbjct  437  TSCAHHRGWLQKEGLAIKSWKRRYFTLHGRML-VYYKD  473

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYY  44
            G++ K G  +++W+RRY VL GD L  +YY
Sbjct  234  GWLYKEGQHVRNWKRRYFVLTGDHL--AYY  261

>PYIW_17818
Length=1188

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 7/48 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            G++ K+G ++KSW+RRY VL+GD+L+  Y+D+      DKP   G  +
Sbjct  505  GWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDN-----IDKPARGGGIV  545

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 28/49 (57%), Gaps = 8/49 (16%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
            C G++ K G  +K+W+RRY  L G TL+         +KS++ K  GS+
Sbjct  830  CSGWLNKEGGTIKTWKRRYFSLHGTTLR--------YFKSERKKLLGSY  870

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (48%), Gaps = 6/63 (10%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHD  70
            ++CEG++ K+G   K W+RRY  L  D L+  +         D P E    + A  + +D
Sbjct  343  STCEGWLLKQGRASKQWKRRYFSLAHDQLEYRH------TPEDFPNEDEVVVNAHFDNYD  396

Query  71   YSD  73
              D
Sbjct  397  QRD  399

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            G++ K G  +KSW++R+ VL G+ L  +YY+
Sbjct  179  GWLLKEGSKVKSWKKRFFVLRGNVL--TYYE  207

 Score = 32.3 bits (72),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (67%), Gaps = 2/33 (6%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            EG++ K+G   K+W++RY VL  +  ++ YY S
Sbjct  627  EGWLFKKGQNFKTWKQRYFVL--ERTRLVYYAS  657

>SDRG_14286
Length=670

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 70/166 (42%), Gaps = 15/166 (9%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH-DYSD  73
            G++ K GH  K+W+ R+ VLDG  L+   Y +  + K+  PK KG  +L   +    Y+D
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ---YYTDDVSKAKTPKLKGEVLLFHKDTTVHYAD  333

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQA----SVD  129
            E    + + F +       G     +   +  D+  W+    +A+    +  A    + D
Sbjct  334  EPATGRAFCFAIDA-----GAYSLLLQAPSELDREAWIYAIEDAILCRDSYCALDDQAAD  388

Query  130  QRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
             R S ++  R+ S   TS    +  V       L  AIV L H  T
Sbjct  389  DRRSEVMRRRSLSA--TSVTASMGGVQDDDMHALYDAIVGLYHDAT  432

>PYU1_G009249
Length=2580

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 75/164 (46%), Gaps = 28/164 (17%)

Query  15    GYVTKRGHVMKS-WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHD---  70
             GYV  R H + + WR R+MVL G +  + Y DS    + D+  E+       +EKH+   
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKK----ALEKHNLVA  2155

Query  71    -------YSDEGGGVKP----YGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                    Y    G        YGF++   A G  Y E C+ V T ++QTQW++   +A  
Sbjct  2156  IAKWHPTYVSTFGSAHSSSNRYGFRVENEAGG--YLE-CI-VATEQEQTQWMKTISDA--  2209

Query  120   KNVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELL  163
               VT  ++  Q AS ++   A   F+  A ++     K K+ LL
Sbjct  2210  --VTALSASSQLASNVMLRDAALPFIPGAAMEGYLKMKEKKSLL  2251

 Score = 39.7 bits (91),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 52/114 (46%), Gaps = 23/114 (20%)

Query  7     DFKQTSCEGYVTKRGHVMKSWRRRYMVL--DGDTLKVSYYDSKTIYKSDKPKEKGSFILA  64
             D +Q   EGY+ KRGH++ S R+RY VL   G+TL+  YY +    ++      GSF + 
Sbjct  1172  DDRQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLE--YYATHEDSRNPSVAPHGSFRVD  1229

Query  65    EIEKHDYSDEGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWL  111
              +     SD  G       K V     HG        K F     +A+++ +W+
Sbjct  1230  TV-----SDWHG-------KTVAQVYAHGMELETLDGKTFFCAAYSAEEKHKWM  1271

>PITG_20103
Length=1301

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 9/79 (11%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY++K+  V+ SW+  Y VL+ DTL  ++Y+++  + S+      S ++  I+ 
Sbjct  221  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQL  272

Query  69   HDYSDEGGGVKPYGFKLVG  87
                DE  G KP GF+++ 
Sbjct  273  QSIEDEDMG-KPNGFRVIA  290

>PPTG_06823
Length=1321

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 58/114 (51%), Gaps = 17/114 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY++K+  V+ SW+  Y VL+ DTL  ++Y+++  + S+      S ++  I+ 
Sbjct  244  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQL  295

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                DE  G KP GF+++  G+   H      +   TA ++ QW      A+ K
Sbjct  296  QGIEDEDMG-KPNGFRVIAEGNHVNH------LSSRTAFEKEQWKRAISIAISK  342

>PHYCA_529660
Length=345

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (44%), Gaps = 26/128 (20%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD-------  53
            MN+   D K +   G++ KRG   K+W++R+ +L+G  L  +YY    +  SD       
Sbjct  86   MNIPTQDLKGSVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASDVLGGGTQ  143

Query  54   --KPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQT--Q  109
                  +G   +A++E  D +        +G K+        Y    +YV+    ++  Q
Sbjct  144  CLDLPVRGGLRVAKVELSDMTS-------FGLKIT------SYSGRVLYVQAGDQESREQ  190

Query  110  WLEVAHNA  117
            WL+V   A
Sbjct  191  WLKVLKEA  198

>H310_01921
Length=341

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 58/112 (52%), Gaps = 21/112 (19%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE-KHDYSD  73
            G+V K+G ++KSW++RYMVL    L  +Y++S+ +      K KGSF +  +E  HD  +
Sbjct  24   GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKV--EGNSKAKGSFQVITVEIAHDIKN  79

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQ  125
                       L+ H  G G +   +Y +TA+   +W+    NA+ +  + Q
Sbjct  80   ----------GLLVH--GTGGRVMKLYTDTAEGCEEWI----NAIAQATSGQ  115

 Score = 35.8 bits (81),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTI  49
            C G++ K G  +K+W+RRY  L G +L  +Y+D+  +
Sbjct  164  CFGWLAKEGGRVKNWKRRYFSLQGRSL--TYFDNANM  198

>PHALS_12503
Length=340

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
            MN+   D K +   G++ KRGH  K+W++R+ +L+G  + ++YY    +  SD
Sbjct  87   MNIPTQDLKGSVFYGWLWKRGHSFKTWKKRFFLLNG--VALTYYKQCCVIASD  137

>PYIR_15118
Length=1222

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   K+WRRRY +L  D   +SYYDS
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>SPRG_09128
Length=620

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 53/119 (45%), Gaps = 9/119 (8%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH-DYSD  73
            G++ K GH  KSW+ R+ VLDG  L+   Y +  + K   PK KG  +L   +    Y+D
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ---YYTDDVSKVKTPKLKGEVLLFHKDTTVHYAD  324

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRA  132
            E    + + F +       G     +   + +D+  W+    +A+    +  A  DQ A
Sbjct  325  EPAAGRAFCFAIDA-----GAYSLLLQAASERDREAWIYAIEDAILCRDSYSALDDQAA  378

>H310_08803
Length=916

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 35/55 (64%), Gaps = 4/55 (7%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
           G+V K+G  +K+W++RYMVL G    ++YYD   +     P EKG+ +L ++ ++
Sbjct  10  GWVYKQGSRVKTWKKRYMVLQGR--HITYYDKSVL--EPNPIEKGALVLVDVTQN  60

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTI  49
            EG++ K G  MK+W+RRY +L G  L   YY ++ +
Sbjct  688  EGWMLKEGSKMKNWKRRYFILKGTELM--YYKNEML  721

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYY  44
            G++ K G  +++W+RRY VL GD L  +YY
Sbjct  240  GWLHKEGQHVRNWKRRYFVLTGDHL--AYY  267

 Score = 32.3 bits (72),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVL  34
            K TS  G++ K G  +KSW+RRY  L
Sbjct  451  KHTSHSGWLQKEGKSIKSWKRRYFTL  476

>PHYCA_504801
Length=398

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +YYD+  +  +   K KGSF +  +E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVNPTT--KAKGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            G         L+ H  G G +   +Y  +A+  + W  +  +A
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA  99

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SY++S+
Sbjct  150  EQVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  186

>PYIW_18911
Length=1196

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   K+WRRRY +L  D   +SYYDS
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>PYVX_13084
Length=1267

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 42/176 (24%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+ K+G   K+WRRRY VL  D   +SY+ SK     D   + G   +         DE
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSK-----DDLMKLGEIAI---------DE  287

Query  75   GGGVKPYGFKLVGHAPGHGY----------KEFCVYVETAKDQT--QWLEVAHNALGKNV  122
               V+P        AP  G+          ++  +  ET ++++   W++     +G  +
Sbjct  288  STTVEP--------APKDGFPNRFIVEHKGRKLVLLAETTENESMESWVK----CIGSCI  335

Query  123  TPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTK--EELL--RKAIVTLEHAR  174
              + ++ +RAS    +R   G   S   Q+R        EELL  R +I  +E++R
Sbjct  336  EFRKTLAKRASGSFDNRRSGGSGDSFRSQMRLSENASMVEELLNDRASIPRMENSR  391

>PHYKE_9146
Length=557

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 46/92 (50%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L+++Y+ S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVVYKDELQITYFLSLEDF--EKRSIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +    F VY ETA+DQ +WLEV    L
Sbjct  92   -YTPSNTC--FRVYTETAEDQLKWLEVMQKVL  120

>PYU1_G012274
Length=873

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 59/118 (50%), Gaps = 19/118 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  +++SW+  Y VL+G+T+  +YY+S+  +  +        ++  I     
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTK------LIGRIHIQSV  361

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQAS  127
             D+  G KP GF+++  GH   H      +   TA ++ QW      A+ K   P+A+
Sbjct  362  EDDHMG-KPNGFRILTEGHRTNH------LSSRTAFEKDQWKRAITAAITK--APEAA  410

>PYIW_21526
Length=963

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 49/111 (44%), Gaps = 13/111 (12%)

Query  12   SC--EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            SC  EGY+ K+G  +K W+RR+ V D  TL  +YY ++   K  KP          ++  
Sbjct  34   SCMKEGYLQKKGQRLKGWKRRWFVCDARTL--AYYINR---KDRKPNAVIPLEGCTVQDG  88

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
              S+     + Y   L   A G  Y   C+  E  +   QWL V  NA  K
Sbjct  89   GLSETWNSPRIY---LTDAASGVMY---CLSAEDGEAVAQWLTVLRNAATK  133

>SDRG_02135
Length=306

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 2/33 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
           EGY+ K+GHV+K+WRRRY  L   +L  +YYDS
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>PPTG_07800
Length=154

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ +RG  +KSWRRR+ + +         D   +YK  K  +  S +L E    D   
Sbjct  35   EGYLYRRGRHLKSWRRRFFIFE---------DGMLLYK--KNDDTTSRVLDEDRVFDILY  83

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRAS  133
              G  +P+G  L       G +   +   + +D T+W    H+ +   +T Q  ++    
Sbjct  84   WSG--RPHGLCL----KLRGDRLIYLTARSEEDATRW----HDTIESYLTEQRCIEDLRR  133

Query  134  ALLGHRAPS  142
            AL   R PS
Sbjct  134  ALCRGRLPS  142

>H257_16349
Length=262

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 21/100 (21%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V KRG   +SW+RR+ VL  + L  +YYD   I    +P++ G  +L        S 
Sbjct  175  KGWVEKRGSRFRSWKRRFFVLRDNIL--AYYD---INLEGQPQKGGDVVL--------SI  221

Query  74   EGGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E   VKP G  FK+         +    + E A D  +WL
Sbjct  222  ENSTVKPNGLEFKMSSG------RTLVGFTEEANDHARWL  255

>PHYKE_4911
Length=46

 Score = 38.9 bits (89),  Expect = 0.002, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYK  51
           G+V K+G ++K+W++R+MVL G  L  +YYD+  + K
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKMMK  43

>PHYRA_73430
Length=395

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 51/103 (50%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++++W++R+MVL G  L  +YYD+  +      K KGSF +  +E       
Sbjct  12   GWVFKQGSLVRNWKKRFMVLRGRQL--TYYDTAKV--DPTVKAKGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            G         L+ H  G G +   +Y  +A+  + W  +  +A
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWFNMILDA  99

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 4/48 (8%)

Query  2    NLDLTD--FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            +L L+D   +Q +  G++ K G  +KSW+RRY VL G+ L  SY++S+
Sbjct  137  SLPLSDDGSEQVTHSGWIKKEGARVKSWKRRYFVLRGNAL--SYFNSE  182

>PHYSO_350197
Length=557

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 45/92 (49%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L++ Y+ S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDF--EKRAIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +    F VY ET +DQ +WLEV   AL
Sbjct  92   -YTPSNNC--FRVYTETPEDQLKWLEVMQKAL  120

>PYU1_G012859
Length=1183

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 61/136 (45%), Gaps = 25/136 (18%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKH  69
            Q++C G++ K+G  +K+W+RRY  L G TL+    ++ ++ +        SF ++ +EK 
Sbjct  808  QSNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR--------SFTISHVEKQ  859

Query  70   DYSDEGGGV-KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV----TP  124
                 G  V    G KL+            +  E+ +D  +WL     ++        +P
Sbjct  860  PQVALGLEVMTTSGRKLM------------LTAESKEDYGRWLRALQASISAESSVPKSP  907

Query  125  QASVDQRASALLGHRA  140
             A V Q+  A  G RA
Sbjct  908  TAPVQQQHDADAGGRA  923

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 33/49 (67%), Gaps = 7/49 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFIL  63
            G++ K+GH+++SW++RY VL GD+L+  Y+++      DKP   G  ++
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN-----IDKPPRGGGIVV  538

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +CEG++ K+GH  K W+RRY  L+ D L+
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 6/54 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
            +G++ K G  MK+W++R++VL G+ L  SYY  +T   S  P   GS ++ ++E
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADET--PSSPP--LGSLVIRQVE  244

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            EG++ K+G   K+W++RY VL+   L   YYD
Sbjct  613  EGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  642

>H257_01308
Length=897

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 49/105 (47%), Gaps = 11/105 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SYY +K         EK    +  +E     D
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKL--------EKKPNAVIPLESATVQD  73

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             GG  + +    +    G     +C+  +     +QWL+V   A+
Sbjct  74   -GGTSETWNSPRIYLTDGTSGTMYCLSGDEGDVVSQWLDVLDRAV  117

>H257_03363
Length=316

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 56/117 (48%), Gaps = 19/117 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE-KHDYSD  73
            G+V K+G ++KSW++RYMVL    L  +Y++++ I      K KGSF +  IE  HD  +
Sbjct  8    GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKI--EGNSKAKGSFQVITIEIAHDIKN  63

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN--VTPQASV  128
                       L+ H  G G +   +Y ++A+    W+            + PQ SV
Sbjct  64   ----------GLLVH--GTGGRVMKLYTDSAESCEDWINAITQVTSAQPPLVPQVSV  108

 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTI  49
            C G++ K G  +++W+RRY  L G +L  +Y+D+  +
Sbjct  147  CTGWLAKEGGRVRNWKRRYFSLQGRSL--TYFDNANM  181

>CCA25510
Length=1139

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            GY+ K+G   KSWRRRY +L  D   ++YY SK
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  229

>PYAP_24144
Length=1022

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (50%), Gaps = 15/115 (13%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            K  + EGY+ K+  ++  WR  Y VL+GDTL  +YY+S+  +  +      + ++  I+ 
Sbjct  309  KGIAFEGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESREDFILN------ARLIGRIQV  360

Query  69   HDYSDE---GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                D+       KP+GF+++      G++   +   TA ++ QW     +A+ K
Sbjct  361  QGVDDDNLPAATGKPHGFRVL----TEGHRIHHLGSRTAFEKDQWKRAIKSAIAK  411

>PYVX_13261
Length=1382

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 68/169 (40%), Gaps = 11/169 (7%)

Query  14   EGYVTKRGHV--MKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            EG++ K G+   +  WR+R+ VLD  T  +SY D +T  +   P    S ++A+     Y
Sbjct  666  EGWLHKVGNFSSLTRWRKRWFVLDQSTCTLSYADDETSPRKLIPLRNCSVLIADTMNQKY  725

Query  72   SDE--GGGVK----PYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQ  125
            +      G +     + FK+    P    +++ +  ET +++ +W+   H          
Sbjct  726  TTAPVNKGTRKERQTWCFKV---RPQSSSRDYIISAETKQEREEWMFAIHTVSRSTDLDG  782

Query  126  ASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHAR  174
            A +D   +       PS      P   R  N   E   +  I  ++H R
Sbjct  783  AFLDNNENFRESITLPSSLFGPFPDSPRVDNNADEAEGKNDIDGIDHQR  831

>PITG_14197
Length=349

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
            MN+ + + K ++  G++ KRG   K+W++R+ +L+G  L  +YY    +  SD
Sbjct  90   MNIPIQELKGSAFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  140

 Score = 34.7 bits (78),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 13/100 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +GY+  RG ++ SW++R+M L    L V    S+T   SD  +    F +    +    D
Sbjct  259  QGYLHLRGGLLPSWKKRFMTLTDGHLTVR--RSRTQRSSDPQEADKPFDVISAVRWSGHD  316

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
             G  +     +L  H      KE  VY +   D + WLE 
Sbjct  317  NGLCI-----RLENH------KELYVYADHDVDASMWLEA  345

>SPRG_06061
Length=1159

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 13/98 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++ +W+  Y VL+G TL V  YD++  + +D   +    +LA        D
Sbjct  224  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YDTREDFIADVGLKVRMLLLA-------VD  274

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G K  GF +     GH  +       TA ++ QW+
Sbjct  275  EENGAKANGFSI--RTEGHKVQHMA--SRTAFERDQWI  308

>PHYSO_343629
Length=977

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY  43
            D      EGYVTKRGH++++W+ R+  L+G+ +  ++
Sbjct  123  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>HYAP_13757
Length=262

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1   MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
           M + + D K     G++ KRGH  K+W++R+ +L+G  L  +YY    +   D
Sbjct  1   MKIPMQDLKGAVFYGWLWKRGHTFKTWKKRFFLLNGAAL--TYYKQCCVITWD  51

>H310_06667
Length=896

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 71/159 (45%), Gaps = 18/159 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK-PKEKGSFILAEIEKHDYS  72
            EGY+ K+G ++K W++R+ V DG +L  SY+ +    K+DK P        A ++    S
Sbjct  37   EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHT----KADKTPSAVIPLETATVQGGGTS  90

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQRA  132
            +   G K     +     G  Y   C+  E      QWL+V  +A+      +A+ D   
Sbjct  91   ERWNGPK---INVTDTVSGVVY---CLSGEDGATVMQWLDVLQHAVQHISNTKAATD--C  142

Query  133  SALLGHRA---PSGFLTSAPVQLRNVNKTKEELLRKAIV  168
            +  L H++   PSG   +    +R   +     + ++IV
Sbjct  143  TTPLRHKSHSFPSGMKANTDFSIRGSPRKPPASISESIV  181

>HYAP_09511
Length=1295

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 53/107 (50%), Gaps = 13/107 (12%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DT+  ++Y+++  + S+  K  G   L  IE 
Sbjct  238  RDIAFEGYLSKKSDVLVSWKATYCVLEEDTM--AFYETREDFISNM-KLIGRIQLQAIED  294

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
             D        KP GF+L+      G +   +   TA ++ QW    H
Sbjct  295  EDAD------KPNGFRLI----AEGNRINHLSSRTAFEKEQWKRAIH  331

>SPRG_01860
Length=674

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 53/125 (42%), Gaps = 27/125 (22%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
            N D T  K    EGY+ K+G ++K W++R+ V DG +L  SYY S    K  KP      
Sbjct  15   NYDPTYMK----EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISS---KDKKPN-----  60

Query  62   ILAEIEKHDYSDEGGGVKPYGFKLVGHAP------GHGYKEFCVYVETAKDQTQWLEVAH  115
              A I     S + GG+         H+P      G     +C+  E     + WL V  
Sbjct  61   --AVIPLESASVQDGGLSE-----TWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLT  113

Query  116  NALGK  120
             A+ +
Sbjct  114  KAVAR  118

>H257_06698
Length=1199

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 18/109 (17%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY++K+G ++ +W+  Y VL+G TL +  YDS+  + +D    K   IL E+     +D
Sbjct  257  EGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADV-GLKVRVILLEV-----ND  308

Query  74   EGGGVKPYGF--KLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            +    KP+GF  K  GH   H      +   TA ++ QW+      L K
Sbjct  309  DVA--KPHGFAIKTEGHKTQH------LASRTAFEKEQWIRAIRLQLVK  349

>SDRG_08236
Length=864

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SYY S    K  KP        A I     S 
Sbjct  23   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYISS---KDKKPN-------AVIPLESASV  70

Query  74   EGGGVKPYGFKLVGHAP------GHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            + GG+         H+P      G     +C+  E     + WL V   A+ +
Sbjct  71   QDGGLSE-----TWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLTKAVAR  118

>PYVX_19030
Length=556

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L++ YY   T+   +K   +G    + + K D        KP GF+  
Sbjct  40   WKKRYCVIHKDVLQIVYY--LTLEDFEKGAIRGKIPFSSVHKWD-------GKPNGFQF-  89

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +  K F VY ET ++QT+W++   + +
Sbjct  90   -YTPYN--KCFRVYTETPEEQTRWVDAMQSLI  118

>PYU1_G011261
Length=1328

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 54/118 (46%), Gaps = 31/118 (26%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHD  70
            T   G++ K+G   +S++RRYM L+G  L  SYY         KP++K    L+  EK  
Sbjct  165  TFISGFLRKKGEKNRSFKRRYMELNGTVL--SYY-------KKKPEKKSGIPLSAAEKKA  215

Query  71   YSDEGGGV---------------KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
            Y  E G +               +P+G  LV  A     + + +  E+ +D  +WL+V
Sbjct  216  Y--ERGSIDLDRVSSLQPMENKSEPFGIHLVTTA-----RTWVIAAESDQDYQRWLKV  266

>PYIR_21831
Length=154

 Score = 40.4 bits (93),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 2/42 (5%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKP  55
            EG++TK+GHVM++ + RY VL   TL  SY+ +K   K  KP
Sbjct  68   EGFLTKKGHVMRTQKERYFVLRQHTL--SYFRAKWSEKKSKP  107

>SDRG_08800
Length=881

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query  2   NLDLTDFKQ-TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
           NL+  D +     EG+V+K+GH++++W+ RY  L+ + L  SYY+SK
Sbjct  53  NLESLDLQSGFEWEGFVSKKGHLVRNWKLRYFTLESNLL--SYYESK  97

>CCI43456
Length=126

 Score = 39.7 bits (91),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query  2   NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKP  55
           NL +   +  + EG +TKR   MK WR+RY +L G+ L    Y SK+  K+D P
Sbjct  9   NLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKS--KNDAP  56

>PHALS_06636
Length=2386

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 52/122 (43%), Gaps = 11/122 (9%)

Query  2     NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY----DSKTIYKSDKPKE  57
             +LD+        EGY+ KRGH + S R+RY VL  + L  SYY    DSK          
Sbjct  1085  SLDVPSDANILMEGYLMKRGHKIPSMRKRYCVLVRNEL--SYYVTHDDSKNPNSGATTNR  1142

Query  58    KGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
              G F +  +     SD  G    + +K          K F     +AKD+ +W++  H+ 
Sbjct  1143  LGFFHVDIV-----SDWHGKTSTHTYKHAMELETKDGKTFFCAASSAKDKQKWIDAFHHG  1197

Query  118   LG  119
             + 
Sbjct  1198  IA  1199

>H310_06378
Length=837

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
           EG+V K+GH++++W+ RY  L+G+ L  SYY++K
Sbjct  59  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>PYIR_16780
Length=1352

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query  14   EGYVTKRGHVMK--SWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILA----EIE  67
            EG++ K G   +  SW++R+ V+D  T  +SY D  T  +   P    S + A    EI 
Sbjct  641  EGWLQKVGFSARFTSWKKRWFVVDQSTCTLSYADDPTAPRKIIPLRYCSIMPADEMNEIS  700

Query  68   KHDYSDEGGG--VKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
             H   ++G    V+ + FK+    P +  +++ +  ET +++ +W+   H
Sbjct  701  THAPVNKGTRKLVQSWCFKV---RPQNSSRDYIMRAETKQEREEWMLAIH  747

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 16/110 (15%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK------TIYKSDKPK-EKGSFIL  63
            T   G++ K+G   +S++RRYM L+G  L  SYY  K       + + DK   E+G+  L
Sbjct  158  TFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKPEKHGIPLSREDKKAYERGNIDL  215

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
              +      +     +PYG  LV  A     + + +  E+ +D  +WL+V
Sbjct  216  ERVSSLQPMESKS--EPYGIHLVTTA-----RTWVIAAESEQDYHRWLKV  258

>H257_13567
Length=836

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
           EG+V K+GH++++W+ RY  L+G+ L  SYY++K
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>SPRG_05449
Length=723

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query  2   NLDLTDFKQ-TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
           NL+  D +     EG+V+K+GH++++W+ RY  L+ + L  SYY+SK
Sbjct  53  NLESLDLQSGFEWEGFVSKKGHLVRNWKLRYFTLESNLL--SYYESK  97

>SDRG_12776
Length=1184

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 13/98 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++ +W+  Y VL+G TL V  Y+S+  + +D   +    +LA        D
Sbjct  228  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YESREDFIADVGLKVRMLLLA-------VD  278

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G K  GF +     GH  +       TA ++ QW+
Sbjct  279  EENGAKANGFSI--RTEGHKVQHMA--SRTAFERDQWI  312

>PYU1_G009178
Length=336

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 28/128 (22%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK------  54
            MN+ + + K T+  G++ K+G   K+W++R+ +L G  L  +YY    +  SD       
Sbjct  78   MNIPMQELKGTAYYGWLWKKGSSFKTWKKRFFLLHGRAL--TYYTQTCVIASDALGTQCL  135

Query  55   --PKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQ---TQ  109
              P + G      +++ + SDE      YG K V    G       ++++ A DQ    Q
Sbjct  136  DVPAKGG----LRVQRVELSDE----TKYGLK-VTSTSGR-----ILHIQ-AGDQDARMQ  180

Query  110  WLEVAHNA  117
            WLEV   A
Sbjct  181  WLEVLEEA  188

>PHYSO_315255
Length=1301

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 56/114 (49%), Gaps = 17/114 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DTL  ++Y+++  + S+  K  G   L  IE 
Sbjct  221  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNT-KLIGRIQLQGIEH  277

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
             D        KP GF+++  G+   H      +   TA ++ QW      A+ K
Sbjct  278  EDMG------KPNGFRVIAEGNHINH------LSSRTAFEKEQWKRAISIAISK  319

>PHYSO_320361
Length=344

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +YY    +  SD
Sbjct  86   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  136

>PYAP_16297
Length=2466

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 7/106 (7%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             EGY+ KRGH++ S R+RY +L  + L  +YY +    ++ + +  GSF + EI    +  
Sbjct  1168  EGYLVKRGHLVPSMRKRYCMLVKNVL--TYYLTHEDSRNTEIQPLGSFRV-EIVSDWHGK  1224

Query  74    EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                    YG +L  H    G   FC    + +++ QW+   H+ + 
Sbjct  1225  TTTQTYEYGMELETH---DGKTFFCAAF-SNEEKVQWMRAFHHGIA  1266

 Score = 32.0 bits (71),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 61/139 (44%), Gaps = 19/139 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+  +    +++Y VL G  LK+  +D+   Y S + ++     +      D+  
Sbjct  513  EGYLVKKSSLFPVMKKKYCVLRG--LKLGIFDTHEAYGSSRQRDVEHEDILVCGVSDWDG  570

Query  74   EGGGVK-PYGFKLVGHAPGHGYKEFCVYVETAKD--QTQWLEVAHNAL----GKNVTPQA  126
             G  +   YGF++      H  +   +    A D  + +W+   H AL     K ++P++
Sbjct  571  HGALLHYNYGFQI------HTVRHQMIQCSAANDNEKEKWMSGIHEALLKFKDKMLSPRS  624

Query  127  ----SVDQRASALLGHRAP  141
                ++D   S LL   +P
Sbjct  625  ETEIALDATRSDLLDRLSP  643

>HYAP_09304
Length=1144

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   KSWRRR+ +L  D   +SYY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PPTG_19471
Length=348

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +YY    +  SD
Sbjct  89   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  139

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 48/102 (47%), Gaps = 19/102 (19%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTI---YKSDKPKEKGSFILAEIEKHD  70
            +GY+  RG ++ SW++R+M L    L V    ++ +    ++DKP E    +++ +    
Sbjct  258  QGYLHVRGGLLPSWKKRFMTLTDGHLTVRRRRTQRLSDPQEADKPFE----VISAVR---  310

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
            +S    G+     +L  H      KE  VY +   D + WLE
Sbjct  311  WSGHDNGL---CIRLENH------KELYVYADHDADASMWLE  343

>CCI43793
Length=1117

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            GY+ K+G   KSWRRR+ +L  D   ++YY SK
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASK  207

>SDRG_00080
Length=298

 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 39/77 (51%), Gaps = 11/77 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE-----KH  69
            GYV K+G  +K+W+RRYMVL  DTL   YY S+    + KP  +G F +  I       H
Sbjct  75   GYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERA--TTKP--RGFFRVTGIAYAPDLPH  128

Query  70   DYSDEGGGVKPYGFKLV  86
                +G G +   F L 
Sbjct  129  GLIADGTGTRRLKFTLA  145

>PHALS_11367
Length=1329

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 55/112 (49%), Gaps = 13/112 (12%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DTL  ++Y+++  + S+      S ++  I+ 
Sbjct  254  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQL  305

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                DE  G KP GF +     GH      +   TA ++ QW      A+ K
Sbjct  306  QAIEDEEMG-KPNGFCVTAEG-GHVSH---MSSRTAFEKEQWKRAISIAISK  352

>PHYKE_38
Length=227

 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (43%), Gaps = 28/129 (22%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD-------  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +YY    +  SD       
Sbjct  2    MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGCAL--TYYTQCCVIASDVLGGGTQ  59

Query  54   --KPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQ---T  108
                  +G   +A+ E  D       +  +G K+        Y    +YV+ A DQ    
Sbjct  60   CMDLPVRGGLRVAKAELSD-------MTSFGLKIT------SYSGRVLYVQ-AGDQDSRM  105

Query  109  QWLEVAHNA  117
            QWL+V   A
Sbjct  106  QWLKVLKEA  114

>PYVX_22589
Length=1375

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 19/121 (16%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY+ K+  ++ +W+  Y VL+ DTL  +Y++S+  + S+      S ++  ++ 
Sbjct  276  RSISFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESREDFISN------SKLIGRVQI  327

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQA  126
                D+  G K  GF++V  GH   H      +   TA ++ QW      A+ K  TP+ 
Sbjct  328  QAVEDDDMG-KSNGFRIVTEGHHVNH------LSSRTAFEKDQWKRAIAIAISK--TPEL  378

Query  127  S  127
            S
Sbjct  379  S  379

>CCA19118
Length=125

 Score = 38.9 bits (89),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 6/54 (11%)

Query  2   NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKP  55
           NL     +  + EG +TKR   MK WR+RY +L G+ L    Y SK+  K+D P
Sbjct  8   NLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL----YFSKS--KNDAP  55

>H257_01309
Length=895

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK-PKEKGSFILAEIEKHDYS  72
            EGY+ K+G ++K W++R+ V DG TL  SY+ +      DK P        A ++    S
Sbjct  48   EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHTNL----DKTPSAIIPLETATVQDGGTS  101

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            +   G + Y    +          +CV  E +    QWL +   A+ +
Sbjct  102  ERWNGPRIYVTDTISGV------VYCVSGEDSTSVLQWLVILQRAVQR  143

>PYVX_14593
Length=964

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKT  48
            K   C G++ K+G    SW+RRY  L G TLK  YY S+T
Sbjct  604  KLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKSET  641

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  13   CEGYVTKRGHVMKSWRRRYMVL  34
            CEG++ KRG   K+W+ RY  L
Sbjct  254  CEGWLEKRGARSKTWKSRYFFL  275

>PHYRA_83696
Length=337

 Score = 40.4 bits (93),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +YY    +  SD
Sbjct  79   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  129

>CCI45857
Length=905

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 47/107 (44%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W++R+ V DG TL  SYY +    K  +P    S     ++    S+
Sbjct  40   EGYLQKKGQRLKGWKQRWFVCDGRTL--SYYITS---KDRRPNAIISLDGCTVQDGGMSE  94

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E A     WL V   A+ +
Sbjct  95   TWQSPRIY---LTDRATGILY---CLSSEDAPVVIDWLHVLRKAVTR  135

>PYIW_25250
Length=245

 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 26/127 (20%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK------  54
            MN+   D K T   G++ K+G   K+W++R+ +L G  L  +YY    +  +D       
Sbjct  84   MNIPTQDLKGTVYYGWLWKKGSSFKTWKKRFFLLHGRAL--TYYTQCCVIATDSLGTQCL  141

Query  55   -PKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQT---QW  110
                KG   +A +E    +        YG K V  + G       +Y++ A DQ    QW
Sbjct  142  DVTAKGGLRVAGVELTSETK-------YGLK-VTSSSGR-----VLYIQ-AGDQAARMQW  187

Query  111  LEVAHNA  117
            LEV  +A
Sbjct  188  LEVLDDA  194

>H310_04842
Length=1081

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (44%), Gaps = 16/114 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEI--EKHDY  71
            EG V K+G  +  W  RY+VLDG  L+  YY  +   +  K   +G  IL  +  E H  
Sbjct  118  EGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARLGK-HLRGKLILTHVSPEIHKK  174

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQ  125
             +    V+  G K+           F +  +T  ++  W+E+   A+ +   PQ
Sbjct  175  KEHTFAVETTGRKM-----------FFMSCDTELEKDMWVEMIQAAISEAAAPQ  217

>H257_09823
Length=654

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD-SKTIYKSDKPKEKGSFIL  63
            G++ K GHV K+W+RR+ VLDG  L+    D   T  KS   K KG  +L
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQYFTDDVDATTPKSKTHKLKGEVLL  314

>CCA26890
Length=1530

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKS---DKPKEKGSFILAEI  66
            GY+ KRG   KS+RRRYM L+G+ L  SYY  K   KS   +K   +GS  L  +
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENV  349

>SPRG_16312
Length=261

 Score = 40.0 bits (92),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE-----KH  69
            GYV K+G  +K+W+RR+MVL  DTL   YY S+        K +G F +  +       H
Sbjct  43   GYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERAMA----KPRGFFRVTSVAYAPDLPH  96

Query  70   DYSDEGGGVKPYGFKLV  86
                +G G +   F L 
Sbjct  97   GLIADGTGTRRLRFTLA  113

>HYAP_13688
Length=1036

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 55/132 (42%), Gaps = 20/132 (15%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHD--  70
            CEG+V K G   K W++RYM L    L+         Y+   P E+ S   AE+   D  
Sbjct  244  CEGWVEKLGQRSKVWKKRYMSLASGMLE---------YRKG-PIEQLS---AELCVTDVR  290

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVTPQASVDQ  130
            YS         GF         G    CV  E+ +D  +W+    +A+GK   PQA    
Sbjct  291  YSSRYSNALVIGFGSSKSPSDRG--TICVRTESTRDLDEWMRALCDAVGK---PQAEGFS  345

Query  131  RASALLGHRAPS  142
            R S+ L  +  S
Sbjct  346  RQSSSLARKRGS  357

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (51%), Gaps = 5/69 (7%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS-D  73
           G+  KRG  ++SW+ RY VL G  L V Y  +K+    D   E+G   +  +   DYS D
Sbjct  10  GWGAKRGSKVRSWKNRYFVLRGREL-VYYSGAKSDGSGDGVDERGRLKVVNV---DYSPD  65

Query  74  EGGGVKPYG  82
              G+  YG
Sbjct  66  RKNGLLIYG  74

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYY  44
            C G++ K G  +KSW+RRY  L G   K+SYY
Sbjct  698  CVGWLRKEGGNVKSWKRRYFTLYG--AKLSYY  727

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            +   S  G++ K+G   K+W+RRY VL+   L  S
Sbjct  502  YDDNSFCGWLLKKGQNFKTWKRRYFVLERSRLAYS  536

>PYAP_19753
Length=1340

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (49%), Gaps = 18/105 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK------TIYKSDKPK-EKGSFILAEIE  67
            GY+ KRG   +S++RRYM L+G TL  SYY  K       + + DK   E+GS  L  + 
Sbjct  160  GYLRKRGEHNRSYKRRYMELNGATL--SYYKKKPEKNGIPLSRDDKKSYERGSIDLDRVS  217

Query  68   KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
                 D     +P+G  LV        + + +  E+ +D  +WL+
Sbjct  218  SIQPIDS----EPFGMHLVTTT-----RTWAISAESEQDFLRWLK  253

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 51/108 (47%), Gaps = 10/108 (9%)

Query  15   GYVTKRGHV-MKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAE--IEKHDY  71
            G++ K G      WRRR+  LD  +  +SY + +   K   P +  S ++A+   EK+  
Sbjct  636  GWLQKLGFSRWTKWRRRWFELDQGSCSLSYAEDENAPKKHIPLKFCSLMVADEMNEKYTT  695

Query  72   SDEGGGVK----PYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
            +    G +     + FK+    P +  +++ +  ET +++ +W+   H
Sbjct  696  APVNKGTRKERQTWCFKV---RPQNSSRDYIISAETKQEREEWMLAIH  740

>CCA23572
Length=868

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 47/107 (44%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W++R+ V DG TL  SYY +    K  +P    S     ++    S+
Sbjct  3    EGYLQKKGQRLKGWKQRWFVCDGRTL--SYYITS---KDRRPNAIISLDGCTVQDGGMSE  57

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E A     WL V   A+ +
Sbjct  58   TWQSPRIY---LTDRATGVLY---CLSSEDAPVVIDWLHVLRKAVAQ  98

>HYAP_11712
Length=558

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  + L++ Y+ S   +  ++   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDF--ERRTIRGKIPFSSVHAWD-------GKPNGFQFY  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              A  H ++   VY ETA DQ +WLEV    +
Sbjct  93   TPA-DHCFR---VYTETAADQLKWLEVMQKCI  120

>PYU1_G003229
Length=810

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 25/31 (81%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYD  45
            G++ K+GH MKSW+RR+ V++G T  ++Y++
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 38.9 bits (89),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 12/54 (22%)

Query  9   KQTSCE--GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK-PKEKG  59
           K T C+  G+ +K+G ++KSW+RRY VL G  L         IY S++ P  KG
Sbjct  23  KSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL---------IYFSERSPSGKG  67

 Score = 38.5 bits (88),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  8    FKQTS-CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFI  62
            F +T+ CEG++ KRG    +W++R+  L+G   ++ Y DS      + PK +GS +
Sbjct  254  FNETNMCEGWLYKRGQRSTAWKKRFFTLNG--FQLQYQDS----PGENPKGEGSVV  303

 Score = 37.7 bits (86),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 28/59 (47%), Gaps = 15/59 (25%)

Query  3    LDLTDFKQTS-------CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDK  54
            L   DF + S       C G++ K G  +K+W+ RY  L G TL        T +KSDK
Sbjct  685  LPYMDFSRASLDDSLPGCSGWLRKEGSTVKNWKLRYFTLKGTTL--------TYFKSDK  735

 Score = 37.0 bits (84),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            +G++ K+G   K+W+RRY VLDG  L  S
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKLSYS  548

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +G++ K G   K+W++R+M L+G  +K
Sbjct  147  QGWLFKEGQNFKTWKKRFMTLEGRVIK  173

>PYAR_13491
Length=1080

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 27/101 (27%), Positives = 44/101 (44%), Gaps = 12/101 (12%)

Query  17   VTKRGHVMKSWRRRYMVLDGDTLKVSYYDS--KTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            +TK+G   ++W+ R+ +L  D   +SYY S  K       P    S +L +         
Sbjct  2    LTKQGSWRRNWKTRFFILRSDYPSLSYYKSEEKLELLGSVPITGDSLVLDK-------SA  54

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
            GGG  P+ F+L   A G       +  ET  +Q +W++   
Sbjct  55   GGGHAPFRFQLRTDAVGAA---LLLETETRDNQQRWMDACQ  92

>PHYRA_83071
Length=2300

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 56/128 (44%), Gaps = 23/128 (18%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLK--VSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
             EGY+ KRGH + S R+RY VL G+ L   V++ DSK           G F +A +     
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNELSYFVTHDDSKNPGGGATTAPLGKFRVAVV-----  1186

Query  72    SDEGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWLEVAHN--ALGKNV  122
              D  G       K   H+  HG        K F     TAK++  W++      AL +N 
Sbjct  1187  GDWHG-------KTATHSYEHGMELETSDGKTFFCAASTAKEKQLWVDAIRRGIALARNQ  1239

Query  123   TPQASVDQ  130
               +A +++
Sbjct  1240  QRRAEIEE  1247

 Score = 32.0 bits (71),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (48%), Gaps = 7/67 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+  +  +  S  RRY VL G+TL   +     + K D P   G   +AE+ + D   
Sbjct  289  EGYLLCQHPMRTSMHRRYYVLTGNTLCWYHDQDAFVNKMDAP--SGVLHVAEVAEWD---  343

Query  74   EGGGVKP  80
              G VKP
Sbjct  344  --GKVKP  348

>H310_09363
Length=1954

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 8/53 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSF  61
            K+TSC GY+ KRG V  + +RRYM+L  + L          YK++    KG F
Sbjct  842  KRTSCAGYLMKRGEVNVTMQRRYMILQDNEL--------VYYKTNPELNKGWF  886

>PYIW_19873
Length=185

 Score = 38.9 bits (89),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKE-----KGSFILAE---  65
            EG++ K+GHV+++ + RY VL   TL  SY+ +K   K  KP       KG   LA    
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSDI  113

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            +    +SD+      +  + +  A G  YK   + V  A+++ +W++    A
Sbjct  114  VTPAPHSDQW-----FRIQKLPDAGGKSYK-LDLKVANAEERQEWIDAIRGA  159

>HYAP_02230
Length=1195

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (42%), Gaps = 30/186 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G +TK+G   ++W+ R+ +L  D   + Y+ S+     DK +  G   + E +       
Sbjct  157  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSE-----DKLELLGEIAITE-DTIVLDRS  210

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL----EVAHNALGKNVTPQASVDQ  130
            GGG  P+ F++   A         +  E+   Q +W+    E+A        +   SV  
Sbjct  211  GGGTAPFRFQIRSDA-----HTLLLEAESRDSQKRWMDSCQELADAIRASKFSVNTSVSS  265

Query  131  RASALLGHRA----PSGFL-------TSAPVQLRNVNKTKEELLRKAIVTLEHAR--TVG  177
             + AL   R+      G         TSA  Q  NV++T+  ++ +  V L   R  TVG
Sbjct  266  LSGALESRRSSVVKAVGMTRLTDVGETSASSQ--NVDETENSVVDETDVCLRRPRRLTVG  323

Query  178  DNTVSE  183
            D+  ++
Sbjct  324  DSLTTQ  329

>HYAP_11713
Length=417

 Score = 39.7 bits (91),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (48%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  + L++ Y+ S  +   ++   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYANELQIVYFLS--LEDFERRTIRGKIPFSSVHAWD-------GKPNGFQFY  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              A  H ++   VY ETA DQ +WLEV    +
Sbjct  93   TPA-DHCFR---VYTETAADQLKWLEVMQKCI  120

>CCI10928
Length=1530

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 26/43 (60%), Gaps = 2/43 (5%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKS  52
            + +  GY+ KRG   KS+RRRYM L G+ L  SYY  K   KS
Sbjct  297  EVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKS  337

>CCA27157
Length=553

 Score = 39.7 bits (91),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 53/106 (50%), Gaps = 20/106 (19%)

Query  15   GYVTKRGHVMKS-------WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67
            G +  RG + K        W++RY V+  ++L++ YY+++  +  +K   +G    A + 
Sbjct  23   GEILLRGFLYKRPEQNSLLWKKRYCVIVKNSLQIVYYENEEDF--EKGVIRGKIPFASVH  80

Query  68   KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
            K D        KP GF+   + P +  K + VY +T K+Q +W+ +
Sbjct  81   KWD-------GKPNGFQF--YTPSN--KCYRVYTDTPKEQEEWVAI  115

>PYAR_19122
Length=554

 Score = 39.7 bits (91),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 53/121 (44%), Gaps = 27/121 (22%)

Query  5    LTDFKQTSCEGYVTKRGHVMKS-------------WRRRYMVL-DGDTLKVSYYDSKTIY  50
            + DFK    EG     G ++ +             W++RY V+  G TL++ YY+S+  +
Sbjct  1    MADFKNFLAEGKAAGAGEIVIAGILFKRPDKNALVWKKRYCVIYSGSTLQIVYYESQDDF  60

Query  51   KSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
              +K   +G    A + K D        KP GF+   + P +  + + VY  T  +Q  W
Sbjct  61   --EKRNIRGKIAFASVHKWD-------GKPNGFQF--YTPSN--QCYRVYTATEDEQRNW  107

Query  111  L  111
            L
Sbjct  108  L  108

>HYAP_13690
Length=377

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK  47
            KQ +  G++ K G  +KSW+RRY VL G  L  SY++S+
Sbjct  132  KQVTHTGWLKKEGARVKSWKRRYFVLRGSVL--SYFNSE  168

>PHYSO_529931
Length=2211

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 52/119 (44%), Gaps = 23/119 (19%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLK--VSYYDSKTIYKSDKPKEKGSFILAEIEKHDY  71
             EGY+ KRGH + S R+RY VL G+ L   V++ DSK           G+F + E+     
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNELSYFVTHDDSKNPGGGATTNPLGNFRV-EV-----  1042

Query  72    SDEGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWLEVAHN--ALGKN  121
                   V  +  K   H   HG        K F     +AK++ QW++      AL +N
Sbjct  1043  ------VGDWHGKTAAHTYEHGMELETTDGKTFFCAASSAKEKQQWVDAFRRGIALARN  1095

>PHYCA_504712
Length=208

 Score = 38.5 bits (88),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 42/107 (39%), Gaps = 19/107 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            C G++ K G  +K+W+RRY  L G TL          +KSD      SF +  +      
Sbjct  85   CSGWLRKEGGTVKNWKRRYFTLHGPTL--------CYFKSDNGALLRSFTVCHV------  130

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                 V     +L         ++  V  ET  D  +WL+  H A+ 
Sbjct  131  -----VTLRTRRLCLEITTEVGRKLLVASETQADLDRWLDHLHRAIA  172

>PYVX_21654
Length=855

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W R Y VLD     +S+Y S+T +  D+   +G+     + +      GG    YGF++ 
Sbjct  580  WERYYFVLDRLDGALSFYISET-HAKDRTFVRGTSRPVSVSEGIPVHVGGQRTVYGFQI-  637

Query  87   GHAPGHGYKEFCVYVETAKDQTQWL-EVAHNALGKNVTPQASVDQRASALLGHRA  140
             +  GHG   F V V++   +  WL E+  +    N  PQ S  Q+  +L+   A
Sbjct  638  -NTQGHG--SFMVLVDSIDSRLTWLTEIVASVAAAN-PPQGSASQKRLSLVNDDA  688

>PYIR_13168
Length=1353

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 49/104 (47%), Gaps = 12/104 (12%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAE-IEKHDYSD  73
            G++TK+GH+ K+W+ R+ VL  D    +YY +K      K K +G  +L + I    + D
Sbjct  116  GWLTKQGHMWKTWKTRFFVLYADG-TFAYYKNK-----GKKKMQGCLMLNDGIVTVKHVD  169

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
                 KPY F++       G+ +   Y  +  +   W+    +A
Sbjct  170  VRKIGKPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PHYCA_509385
Length=557

 Score = 39.3 bits (90),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (47%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+    L++ Y+ S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDF--EKRAIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P      F VY ETA+DQ +W+E   N +
Sbjct  92   -YTPSDNC--FRVYTETAEDQAKWIETMQNCI  120

>PPTG_18989
Length=1213

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   KSWRRR+ +L  D   + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>PHALS_07930
Length=1200

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDS  46
            GY+ K+G   KSWRRR+ +L  D   + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>H310_06449
Length=1361

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 19/123 (15%)

Query  2    NLDLTDFKQTS---C---EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKP  55
            NLD+ DF  T    C    G++ KRGH   +W+RR+ VL  D  K+ Y+      K ++ 
Sbjct  85   NLDV-DFSCTPGSPCIVHAGWLIKRGHNWHTWKRRWFVLTSDA-KLEYFK-----KPNRK  137

Query  56   KEKGSFILAE-IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVA  114
            K KG   L + I +  + D       Y F +       G+       ET  D   W+   
Sbjct  138  KSKGKVDLNDGIVQVQFVDVHHVEHMYAFSIT-----KGFYTLLCSCETGDDADTWVRNL  192

Query  115  HNA  117
             N 
Sbjct  193  RNV  195

Lambda      K        H        a         alpha
   0.311    0.128    0.359    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 21572263215

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40