Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SPRG_06335147551231235893e-79
SDRG_01782147551231235372e-71
H257_06293147551231243064e-36
H310_09224147551231263049e-36
PYIR_13454147551291042701e-30
PYIW_19970147551301062692e-30
PYU1_G001736147551231062664e-30
PHYSO_321155147551361092451e-26
PHYKE_8392147551381102432e-26
PHYRA_95903147551341092405e-26
CCI44820147551231052371e-25
CCA17542147551201052361e-25
PHYCA_11834147551341092311e-24
PYAP_17747147551341082292e-24
PHALS_06479147551361092274e-24
PYVX_18180147551351082181e-22
PPTG_17126147551361092172e-22
PITG_18455147551321092092e-21
HYAP_07103147551641432043e-20
CCA251601323992848700.97
PHYKE_8932346953466691.4
PITG_04454384237455663.9
PPTG_07484384240752654.6
PHYCA_5252955773137827654.7
PYAR_237841313691364654.7
PPTG_235521830152029655.4
SPRG_2026513646932943647.1
PYAP_2384210098645547647.3
PYIW_2524716490448663639.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SPRG_06335

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SPRG_06335                                                            231        3e-79
SDRG_01782                                                            211        2e-71
H257_06293                                                            122        4e-36
H310_09224                                                            121        9e-36
PYIR_13454                                                            108        1e-30
PYIW_19970                                                            108        2e-30
PYU1_G001736                                                          107        4e-30
PHYSO_321155                                                          99.0       1e-26
PHYKE_8392                                                            98.2       2e-26
PHYRA_95903                                                           97.1       5e-26
CCI44820                                                              95.9       1e-25
CCA17542                                                              95.5       1e-25
PHYCA_11834                                                           93.6       1e-24
PYAP_17747                                                            92.8       2e-24
PHALS_06479                                                           92.0       4e-24
PYVX_18180                                                            88.6       1e-22
PPTG_17126                                                            88.2       2e-22
PITG_18455                                                            85.1       2e-21
HYAP_07103                                                            83.2       3e-20
CCA25160                                                              31.6       0.97 
PHYKE_8932                                                            31.2       1.4  
PITG_04454                                                            30.0       3.9  
PPTG_07484                                                            29.6       4.6  
PHYCA_525295                                                          29.6       4.7  
PYAR_23784                                                            29.6       4.7  
PPTG_23552                                                            29.6       5.4  
SPRG_20265                                                            29.3       7.1  
PYAP_23842                                                            29.3       7.3  
PYIW_25247                                                            28.9       9.6  

>SPRG_06335
Length=123

 Score = 231 bits (589),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MDTTIRaaykkllklakSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60
            MDTTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY
Sbjct  1    MDTTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFM  120
            LKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFM
Sbjct  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>SDRG_01782
Length=123

 Score = 211 bits (537),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 116/123 (94%), Gaps = 0/123 (0%)

Query  1    MDTTIRaaykkllklakSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60
            MD TIRAAYKKLLKLAKSVPQEQRAQTLEKVR EFRAH GAATPEELDQLLRKAQSKISY
Sbjct  1    MDATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFM  120
            LKIVTPKKS S  QG+HFVYKNGQRIDGRELSADSATIKT DYNAMMTKHVQLVRRQHFM
Sbjct  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>H257_06293
Length=123

 Score = 122 bits (306),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 2/124 (2%)

Query  1    MDTTIRaaykkllklakSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P +Q+   L+K+R +FR+    +T EELD+L+ KAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60

Query  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGREL-SADSATIKTADYNAMMTKHVQLVRRQHF  119
            LKIVTPK++P  G    F+YK+G+R+D + L    + TIKT D NAMM +HV+L+RRQHF
Sbjct  61   LKIVTPKRTPQSGP-QRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>H310_09224
Length=123

 Score = 121 bits (304),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 98/126 (78%), Gaps = 6/126 (5%)

Query  1    MDTTIRaaykkllklakSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P EQ+   L+KVR EFR+H    + ++LD+++ KAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60

Query  61   LKIVTPKKSP--SPGQGNHFVYKNGQRID-GRELSADSATIKTADYNAMMTKHVQLVRRQ  117
            LKIVTPK++P  SP     ++YK+G+R+D G    + +ATIKT D+NAMM +HV+LVRRQ
Sbjct  61   LKIVTPKRAPQTSP---QRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQ  117

Query  118  HFMDRK  123
            HFMDRK
Sbjct  118  HFMDRK  123

>PYIR_13454
Length=129

 Score = 108 bits (270),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 70/104 (67%), Gaps = 1/104 (1%)

Query  20   PQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNHFV  79
            P+ +R  TL ++R+EFR     + P+EL+ LL +AQS I YLKIVTP+KS   G  N ++
Sbjct  27   PEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVTPRKSSDAGVKN-YI  85

Query  80   YKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            YKNGQR++   +  D A     DYNA M +H +L+RRQHFMDRK
Sbjct  86   YKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129

>PYIW_19970
Length=130

 Score = 108 bits (269),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 1/106 (1%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            ++P+ +R  T +++R+EFR+    + P+EL+ LL +AQS ISYLKIVTP+KS   G  N 
Sbjct  26   TLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVTPRKSSDAGVKN-  84

Query  78   FVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            ++YKNGQR++   +  D A  +  DYN  M +H +L+RRQHFMDRK
Sbjct  85   YIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PYU1_G001736
Length=123

 Score = 107 bits (266),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 1/106 (1%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            ++P ++R  T+E++R EFR H G   P+E+  LL +AQS I YLKIVTP+ +   G  N 
Sbjct  19   TLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTPRATSDAGVKN-  77

Query  78   FVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            +VY  G+R++    + D A  KTADYNA M +HVQL+RRQHFMDRK
Sbjct  78   YVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123

>PHYSO_321155
Length=136

 Score = 99.0 bits (245),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 74/109 (68%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +R Q+L+++R EFR+H     PE +  L+++AQS +SYLKIVTP+   + G    
Sbjct  21   SLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIVTPRGESNTGV-QR  79

Query  78   FVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            F+Y+NGQR++  E  A   ++A  KT D  A + +H QL+RRQ+FMDRK
Sbjct  80   FIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRK  128

>PHYKE_8392
Length=138

 Score = 98.2 bits (243),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 73/110 (66%), Gaps = 4/110 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQG-N  76
            ++P+ +R Q+L ++R EFR H   + P+E+ +LL+ AQS +SYLKIVTP+       G  
Sbjct  21   ALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKIVTPRDETESNSGVQ  80

Query  77   HFVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
             ++Y+NGQR++  EL     ++A  KT D  A + +H QL+RRQHFMDRK
Sbjct  81   RYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130

>PHYRA_95903
Length=134

 Score = 97.1 bits (240),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 74/109 (68%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +R Q+L+++R EFR+H     P+E+  L+++AQS + YLKIVTP+   + G    
Sbjct  19   SLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPRAESNKGI-QR  77

Query  78   FVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            ++Y+NGQR++  E+ A   ++A  KT D    + +H QL+RRQHFMDRK
Sbjct  78   YIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRK  126

>CCI44820
Length=123

 Score = 95.9 bits (237),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 65/105 (62%), Gaps = 1/105 (1%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P E++A TL  +R EFR H     P +L QLL +AQS I YLKIVTP K    G   H
Sbjct  20   SLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVTPHKRSDSGV-KH  78

Query  78   FVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDR  122
            FVYK+G+RI+    + + A  K  D    + +H QL+RRQ+FMDR
Sbjct  79   FVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>CCA17542
Length=120

 Score = 95.5 bits (236),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 1/105 (1%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P E++A TL  +RTEFR H   + P +L QLL +AQS I YLKIVTP K    G    
Sbjct  17   SLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVTPHKRSDSGV-KR  75

Query  78   FVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDR  122
            F++K+G+RI+    +++ A  K  D    + +H QL+RRQHFMDR
Sbjct  76   FMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PHYCA_11834
Length=134

 Score = 93.6 bits (231),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +R  +++++R EFR+H     P+E+ +LL++AQS + YLKIVTP+   + G    
Sbjct  19   SLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTPRAESNTGV-QR  77

Query  78   FVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            F+Y++G+R++  EL     ++A  KT D  A + +H QL+RRQ+FMDRK
Sbjct  78   FIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRK  126

>PYAP_17747
Length=134

 Score = 92.8 bits (229),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 73/108 (68%), Gaps = 4/108 (4%)

Query  18   SVPQE-QRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGN  76
            S+P E +R  T++++R+EFR+   A  P+E+  L+++AQ+KI YLKIVTP+ +   G  +
Sbjct  19   SLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTADAGVKS  78

Query  77   HFVYKNGQRIDGRELSA--DSATIKTADYNAMMTKHVQLVRRQHFMDR  122
             FVY NG+R+D  ++    + A  KT D+   M +H QL+RRQHFMDR
Sbjct  79   -FVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMDR  125

>PHALS_06479
Length=136

 Score = 92.0 bits (227),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            ++PQ +R  +++++R EFR H     P+E+ + +++AQS +SYLKI+TP+   + G    
Sbjct  21   NLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITPRTESNTG-VQR  79

Query  78   FVYKNGQRIDGRELSA---DSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            F+Y+NGQR++  +      ++A  KT D  A   +H QL+RRQ+FMDRK
Sbjct  80   FIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRK  128

>PYVX_18180
Length=135

 Score = 88.6 bits (218),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 4/108 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +RA T+ ++RTEFR+H       E+ +LL++AQS++ YLKIVTP + PS      
Sbjct  20   SLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIVTP-RGPSASGVKR  78

Query  78   FVYKNGQRIDGRELSADSAT---IKTADYNAMMTKHVQLVRRQHFMDR  122
            ++Y+NGQR+D     A        KT D    + +H QL+RRQHFMDR
Sbjct  79   YIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDR  126

>PPTG_17126
Length=136

 Score = 88.2 bits (217),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 71/109 (65%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +R  +++++R +FR H     P+E+  L+++AQS +SYLKIVTP+   + G    
Sbjct  21   SLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIVTPRAESNMGV-QR  79

Query  78   FVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            ++Y+NGQR++  E      ++A  KT D    + +H QL+RRQ+F+DRK
Sbjct  80   YIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRK  128

>PITG_18455
Length=132

 Score = 85.1 bits (209),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 71/109 (65%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNH  77
            S+P+ +R  +++++R +FR+H     P+E+  L+++AQS +SYLKIVTP+   + G    
Sbjct  17   SLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIVTPRAESNTGV-QR  75

Query  78   FVYKNGQRIDGREL---SADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123
            ++Y+NGQR++  E      ++A  K  D    + +H QL++RQ+FM+RK
Sbjct  76   YIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRK  124

>HYAP_07103
Length=164

 Score = 83.2 bits (204),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 72/143 (50%), Gaps = 37/143 (26%)

Query  18   SVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGN-  76
            S+P+ +R ++L+++R EFR H     P+E+  LL++AQS I +LKIVTP+        + 
Sbjct  14   SLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVTPRAESGGFMASL  73

Query  77   ---------------------------------HFVYKNGQRIDGREL---SADSATIKT  100
                                              FVY++G+RID  EL     ++A  KT
Sbjct  74   AFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKT  133

Query  101  ADYNAMMTKHVQLVRRQHFMDRK  123
             D  A M +H QL+RRQHFMDRK
Sbjct  134  QDIEAGMKRHHQLLRRQHFMDRK  156

>CCA25160
Length=928

 Score = 31.6 bits (70),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 0/48 (0%)

Query  37   AHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKNGQ  84
            A T   TP   D LL + Q  + + + VTP  S S G G  + +K+ +
Sbjct  849  ARTIPTTPSHFDTLLLRPQKALDFRQTVTPFTSLSIGVGEKYQWKDAE  896

>PHYKE_8932
Length=534

 Score = 31.2 bits (69),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/66 (29%), Positives = 26/66 (39%), Gaps = 0/66 (0%)

Query  23   QRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKN  82
            Q  + LE+ R EF A   +      D L      + +Y    TP +  S    +H  Y N
Sbjct  321  QELKQLEEQRAEFSARQASIAASASDPLYNSGYQENAYRPPTTPTRGRSSSSNDHHGYSN  380

Query  83   GQRIDG  88
            G R  G
Sbjct  381  GHRSYG  386

>PITG_04454
Length=374

 Score = 30.0 bits (66),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (55%), Gaps = 0/55 (0%)

Query  48   DQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTAD  102
            ++LL K +++ +Y   V+PKK P   QGN  +Y     +  ++L  D   ++T +
Sbjct  46   EKLLFKYETESTYTSPVSPKKIPYRKQGNRSLYTEENLLRRQKLMEDPGVLQTIE  100

>PPTG_07484
Length=407

 Score = 29.6 bits (65),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 27/52 (52%), Gaps = 0/52 (0%)

Query  48  DQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIK  99
           ++LL K ++  +Y   V+PKK P   QGN  +Y     +  ++L  D   +K
Sbjct  46  EKLLFKYETDTTYTSPVSPKKIPYRKQGNRSLYTEENLLKRQKLMEDPGVLK  97

>PHYCA_525295
Length=1378

 Score = 29.6 bits (65),  Expect = 4.7, Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  59   SYLKIVTPKKSPSPGQGNHFVYKNGQR  85
            SY  + TPKKS SP  G  FV +  +R
Sbjct  730  SYALVATPKKSKSPADGEAFVVEVKER  756

>PYAR_23784
Length=913

 Score = 29.6 bits (65),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 30/64 (47%), Gaps = 5/64 (8%)

Query  29   EKVRTEFRAHTGAATPEELD--QLLRKAQSKISYLKIVTPK---KSPSPGQGNHFVYKNG  83
            E  R  + A  GA +PEE+D   LL+  Q  I + + V  +    S S G       ++G
Sbjct  383  EATRAHYLAQVGALSPEEMDVTSLLKALQRTIMFERDVADRFEGSSGSSGDNEDEFDESG  442

Query  84   QRID  87
            Q ID
Sbjct  443  QLID  446

>PPTG_23552
Length=1520

 Score = 29.6 bits (65),  Expect = 5.4, Method: Composition-based stats.
 Identities = 15/29 (52%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  83   GQRIDGRELSADSATIKTADYNAMMTKHV  111
            GQ  DGREL   + TIKTA      +KHV
Sbjct  216  GQHEDGRELPTLTHTIKTAALKLSSSKHV  244

>SPRG_20265
Length=329

 Score = 29.3 bits (64),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 24/43 (56%), Gaps = 3/43 (7%)

Query  18   SVPQEQRAQTLEKVRTEFRAHT---GAATPEELDQLLRKAQSK  57
            SVP++++AQ L +V  E R  T    AA P  L QLLR   + 
Sbjct  262  SVPRDEKAQLLRQVAFEHRRPTIRNEAAWPPSLLQLLRACWAS  304

>PYAP_23842
Length=455

 Score = 29.3 bits (64),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 12/47 (26%), Positives = 22/47 (47%), Gaps = 0/47 (0%)

Query  44   PEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKNGQRIDGRE  90
            P  ++   R     + +++   PKK  + G G+H  + N   +DG E
Sbjct  231  PSSVEFCERTVAETMKFIQKYQPKKRSAAGGGDHIGWSNASTLDGDE  277

>PYIW_25247
Length=486

 Score = 28.9 bits (63),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query  39   TGAATPEELDQLLRKAQSKISYLKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATI  98
            TG   P  LD  L    S  SY  + TP+ S S G    F+++ G   D   LS  + T 
Sbjct  37   TGTQLPARLD--LVDDDSSFSYQTVRTPRDSTSAGTARFFLHQEGP--DADRLSVTTNTP  92

Query  99   KTA  101
            +T+
Sbjct  93   RTS  95

Lambda      K        H        a         alpha
   0.315    0.127    0.351    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40