Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_167201475362862833020.0
SPRG_141031475362862831480.0
H310_085901475364060625440.0
H257_084361475364260425040.0
PYIR_134521475364561120130.0
PYAP_177619907562260820010.0
PYIW_199721475360960619300.0
PHYKE_83911475377863119190.0
PHYCA_5561601475364963218880.0
PITG_184521475385662918820.0
PYAR_135699907549449218010.0
HYAP_070951475361361717940.0
PHALS_064811475364461817070.0
PYVX_181701475351054017040.0
PHYSO_3489011475352652817020.0
PHYRA_508551475348949116460.0
SPRG_0407412408750949910761e-139
SDRG_1440812408752851010623e-137
SDRG_12187109044624706369e-75
SDRG_038221356704944806335e-74
SDRG_03823114284974796204e-72
PYIW_25301109045125156199e-72
SDRG_150451241574944756171e-71
PYAP_21882109045025006162e-71
PHALS_08068109044974846152e-71
SDRG_111311368074944756119e-71
PHYSO_254571109044894936082e-70
PYAR_17512109045335136103e-70
SPRG_11769109044534766034e-70
PYIR_17506109045094936022e-69
SPRG_05609114284964805952e-68
PHYKE_103271090612004846199e-68
PPTG_18033109045004935891e-67
PHYRA_71927109044855005872e-67
H310_144471462305014595752e-65
CCI11048114284964665672e-64
PHYCA_504517114284934795662e-64
PPTG_09787114284934795583e-63
HYAP_08763114284734625573e-63
H257_09722114285184875578e-63
PITG_14083114284934795559e-63
PHYSO_550665114284914815551e-62
PHYRA_72037114284934795532e-62
PYAP_234351008029514775742e-62
H257_170371462304984595453e-61
PITG_13427109044634735424e-61
PHALS_09136114284934805374e-60
CCA23647114284964685357e-60
PHYCA_7619109044624715258e-59
H310_11259114285194855192e-57
PHYKE_6836114284934795156e-57
PYVX_21517109044825135014e-55
HYAP_04843109044303964703e-51
PYAR_177141008024444774625e-50
PYIR_23431114284684654513e-48
PYVX_16175114284464633897e-40
CCA22989124014944793812e-38
CCI10477124014944773715e-37
PYU1_G014259109042442193389e-35
PYAP_226451707615654833602e-34
SPRG_199431356703432503389e-34
PYIR_20273124015054913344e-32
HYAP_12621124015014783256e-31
SDRG_14446151564954783062e-28
CCI50816151568074793051e-27
CCA16670151565204842983e-27
PYVX_21248124015024382973e-27
PYAR_20075170764694752911e-26
PYVX_20512151565284892884e-26
PPTG_0093815665505342851e-25
PYU1_G011605151565244832795e-25
PHYRA_7388315665515062789e-25
PHYRA_72215124014994822733e-24
PHALS_10055151565164852724e-24
PYAR_16840151565365022663e-23
PYIW_19795151565194832653e-23
PHYSO_556052124015004792644e-23
PPTG_09121151565204882645e-23
PHYRA_47253151564814852626e-23
PHYCA_123621124014954812626e-23
PYIW_251901648732061852477e-23
PHYCA_50444515665485272601e-22
PHYKE_9680124014984632573e-22
PITG_15359124014964822573e-22
PHALS_1202815665795042584e-22
H257_01186151564964722555e-22
PHYCA_555180151565214912493e-21
H310_00561151564974792483e-21
PYIR_1413215665135062451e-20
PYU1_G00569915665505432451e-20
SPRG_09825124014924772386e-20
PHYSO_48941815664714592351e-19
SDRG_06945124014924772352e-19
PYU1_G00173714753133952162e-19
H310_02523124014944432342e-19
PHALS_09942124014964642342e-19
PHYKE_2864151564864852323e-19
H310_0764115665485192334e-19
PYAP_19280151565124832325e-19
PYIW_24688114282592602225e-19
SPRG_04114151563763332277e-19
H257_16541124014944662298e-19
PYIW_2025715665034872281e-18
CCA1403015665605142281e-18
SDRG_0506015665595202282e-18
SPRG_1205415665585202282e-18
PYAP_1914815665355172272e-18
PITG_18935150674804832262e-18
HYAP_0414915665645512263e-18
PITG_0177815664704632234e-18
H257_0745015665673672236e-18
CCI3999315665505162155e-17
PYVX_2349915665195132093e-16
PYAR_1666415665774082051e-15
PYIR_21896151565185051987e-15
PITG_19065151564164011922e-14
PHYKE_980715665575101942e-14
HYAP_08069650262552151802e-13
PPTG_13000124013872931814e-13
PHYSO_562795151564153261781e-12
PPTG_247122910367621292e-08
HYAP_13613151564232261334e-07
PITG_19802156311851581213e-06
SPRG_0423112415790521048e-05
HYAP_080686502510056950.002
PYIW_2756812401128118970.002
SPRG_17626132408148115910.013
HYAP_03065634701139850.31
SDRG_0650112817662342840.37
PYAP_15943241513930790.38
SPRG_1164112817662342840.39
SPRG_186431333348534760.49
CCI40989241655279830.54
PITG_02760241516530780.79
PPTG_0344943561350117800.88
SDRG_05159241655157810.98
H310_0629614909759031791.4
PHYKE_5677241621130771.4
PYVX_18330241655830791.5
PYU1_G004385241656230791.6
PHYCA_118996634703165781.9
PPTG_05518241655430772.4
SPRG_08354241655055772.5
H310_07705241654630763.2
SDRG_023051508838746754.1
PPTG_004918491154291764.3
SPRG_050721508838746754.3
SPRG_1408512974934091745.0
PYIW_147818177733946736.7
PHYRA_756181508840034736.8
PYU1_G0099888177728446736.9
PYIR_136108177733946736.9
PPTG_162941508840630737.2
PHYSO_261176241654130729.3
CCA232376096217977739.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_16720

Length=628
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_16720                                                            1276       0.0   
SPRG_14103                                                            1217       0.0   
H310_08590                                                            984        0.0   
H257_08436                                                            969        0.0   
PYIR_13452                                                            780        0.0   
PYAP_17761                                                            775        0.0   
PYIW_19972                                                            748        0.0   
PHYKE_8391                                                            743        0.0   
PHYCA_556160                                                          731        0.0   
PITG_18452                                                            729        0.0   
PYAR_13569                                                            698        0.0   
HYAP_07095                                                            695        0.0   
PHALS_06481                                                           662        0.0   
PYVX_18170                                                            660        0.0   
PHYSO_348901                                                          660        0.0   
PHYRA_50855                                                           638        0.0   
SPRG_04074                                                            419        1e-139
SDRG_14408                                                            413        3e-137
SDRG_12187                                                            249        9e-75 
SDRG_03822                                                            248        5e-74 
SDRG_03823                                                            243        4e-72 
PYIW_25301                                                            243        9e-72 
SDRG_15045                                                            242        1e-71 
PYAP_21882                                                            241        2e-71 
PHALS_08068                                                           241        2e-71 
SDRG_11131                                                            239        9e-71 
PHYSO_254571                                                          238        2e-70 
PYAR_17512                                                            239        3e-70 
SPRG_11769                                                            236        4e-70 
PYIR_17506                                                            236        2e-69 
SPRG_05609                                                            233        2e-68 
PHYKE_10327                                                           243        9e-68 
PPTG_18033                                                            231        1e-67 
PHYRA_71927                                                           230        2e-67 
H310_14447                                                            226        2e-65 
CCI11048                                                              223        2e-64 
PHYCA_504517                                                          222        2e-64 
PPTG_09787                                                            219        3e-63 
HYAP_08763                                                            219        3e-63 
H257_09722                                                            219        8e-63 
PITG_14083                                                            218        9e-63 
PHYSO_550665                                                          218        1e-62 
PHYRA_72037                                                           217        2e-62 
PYAP_23435                                                            225        2e-62 
H257_17037                                                            214        3e-61 
PITG_13427                                                            213        4e-61 
PHALS_09136                                                           211        4e-60 
CCA23647                                                              210        7e-60 
PHYCA_7619                                                            206        8e-59 
H310_11259                                                            204        2e-57 
PHYKE_6836                                                            202        6e-57 
PYVX_21517                                                            197        4e-55 
HYAP_04843                                                            185        3e-51 
PYAR_17714                                                            182        5e-50 
PYIR_23431                                                            178        3e-48 
PYVX_16175                                                            154        7e-40 
CCA22989                                                              151        2e-38 
CCI10477                                                              147        5e-37 
PYU1_G014259                                                          134        9e-35 
PYAP_22645                                                            143        2e-34 
SPRG_19943                                                            134        9e-34 
PYIR_20273                                                            133        4e-32 
HYAP_12621                                                            129        6e-31 
SDRG_14446                                                            122        2e-28 
CCI50816                                                              122        1e-27 
CCA16670                                                              119        3e-27 
PYVX_21248                                                            119        3e-27 
PYAR_20075                                                            116        1e-26 
PYVX_20512                                                            115        4e-26 
PPTG_00938                                                            114        1e-25 
PYU1_G011605                                                          112        5e-25 
PHYRA_73883                                                           111        9e-25 
PHYRA_72215                                                           109        3e-24 
PHALS_10055                                                           109        4e-24 
PYAR_16840                                                            107        3e-23 
PYIW_19795                                                            106        3e-23 
PHYSO_556052                                                          106        4e-23 
PPTG_09121                                                            106        5e-23 
PHYRA_47253                                                           105        6e-23 
PHYCA_123621                                                          105        6e-23 
PYIW_25190                                                            99.8       7e-23 
PHYCA_504445                                                          104        1e-22 
PHYKE_9680                                                            103        3e-22 
PITG_15359                                                            103        3e-22 
PHALS_12028                                                           103        4e-22 
H257_01186                                                            102        5e-22 
PHYCA_555180                                                          100        3e-21 
H310_00561                                                            100        3e-21 
PYIR_14132                                                            99.0       1e-20 
PYU1_G005699                                                          99.0       1e-20 
SPRG_09825                                                            96.3       6e-20 
PHYSO_489418                                                          95.1       1e-19 
SDRG_06945                                                            95.1       2e-19 
PYU1_G001737                                                          87.8       2e-19 
H310_02523                                                            94.7       2e-19 
PHALS_09942                                                           94.7       2e-19 
PHYKE_2864                                                            94.0       3e-19 
H310_07641                                                            94.4       4e-19 
PYAP_19280                                                            94.0       5e-19 
PYIW_24688                                                            90.1       5e-19 
SPRG_04114                                                            92.0       7e-19 
H257_16541                                                            92.8       8e-19 
PYIW_20257                                                            92.4       1e-18 
CCA14030                                                              92.4       1e-18 
SDRG_05060                                                            92.4       2e-18 
SPRG_12054                                                            92.4       2e-18 
PYAP_19148                                                            92.0       2e-18 
PITG_18935                                                            91.7       2e-18 
HYAP_04149                                                            91.7       3e-18 
PITG_01778                                                            90.5       4e-18 
H257_07450                                                            90.5       6e-18 
CCI39993                                                              87.4       5e-17 
PYVX_23499                                                            85.1       3e-16 
PYAR_16664                                                            83.6       1e-15 
PYIR_21896                                                            80.9       7e-15 
PITG_19065                                                            78.6       2e-14 
PHYKE_9807                                                            79.3       2e-14 
HYAP_08069                                                            73.9       2e-13 
PPTG_13000                                                            74.3       4e-13 
PHYSO_562795                                                          73.2       1e-12 
PPTG_24712                                                            54.3       2e-08 
HYAP_13613                                                            55.8       4e-07 
PITG_19802                                                            51.2       3e-06 
SPRG_04231                                                            44.7       8e-05 
HYAP_08068                                                            41.2       0.002 
PYIW_27568                                                            42.0       0.002 
SPRG_17626                                                            39.7       0.013 
HYAP_03065                                                            37.4       0.31  
SDRG_06501                                                            37.0       0.37  
PYAP_15943                                                            35.0       0.38  
SPRG_11641                                                            37.0       0.39  
SPRG_18643                                                            33.9       0.49  
CCI40989                                                              36.6       0.54  
PITG_02760                                                            34.7       0.79  
PPTG_03449                                                            35.4       0.88  
SDRG_05159                                                            35.8       0.98  
H310_06296                                                            35.0       1.4   
PHYKE_5677                                                            34.3       1.4   
PYVX_18330                                                            35.0       1.5   
PYU1_G004385                                                          35.0       1.6   
PHYCA_118996                                                          34.7       1.9   
PPTG_05518                                                            34.3       2.4   
SPRG_08354                                                            34.3       2.5   
H310_07705                                                            33.9       3.2   
SDRG_02305                                                            33.5       4.1   
PPTG_00491                                                            33.9       4.3   
SPRG_05072                                                            33.5       4.3   
SPRG_14085                                                            33.1       5.0   
PYIW_14781                                                            32.7       6.7   
PHYRA_75618                                                           32.7       6.8   
PYU1_G009988                                                          32.7       6.9   
PYIR_13610                                                            32.7       6.9   
PPTG_16294                                                            32.7       7.2   
PHYSO_261176                                                          32.3       9.3   
CCA23237                                                              32.7       9.8   

>SDRG_16720
Length=628

 Score = 1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/628 (100%), Positives = 628/628 (100%), Gaps = 0/628 (0%)

Query  1    MWSRSVRISRVGQrstwrssstmssVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKAT  60
            MWSRSVRISRVGQRSTWRSSSTMSSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKAT
Sbjct  1    MWSRSVRISRVGQRSTWRSSSTMSSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKAT  60

Query  61   IHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF  120
            IHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF
Sbjct  61   IHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF  120

Query  121  FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD
Sbjct  121  FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180

Query  181  YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLI  240
            YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLI
Sbjct  181  YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLI  240

Query  241  TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA  300
            TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA
Sbjct  241  TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA  300

Query  301  VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR  360
            VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR
Sbjct  301  VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR  360

Query  361  SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLN  420
            SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLN
Sbjct  361  SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLN  420

Query  421  ATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGR  480
            ATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGR
Sbjct  421  ATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGR  480

Query  481  LLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEW  540
            LLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEW
Sbjct  481  LLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEW  540

Query  541  SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600
            SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV
Sbjct  541  SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600

Query  601  GIHPTTAEIFTTLEITKESGLDASAAGC  628
            GIHPTTAEIFTTLEITKESGLDASAAGC
Sbjct  601  GIHPTTAEIFTTLEITKESGLDASAAGC  628

>SPRG_14103
Length=628

 Score = 1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/628 (98%), Positives = 620/628 (99%), Gaps = 0/628 (0%)

Query  1    MWSRSVRISRVGQrstwrssstmssVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKAT  60
            MWSRSVRISRVGQRSTWRSSSTMSSVNYHVVGWKSCPYYERAANVA SMQTLFPGQVKAT
Sbjct  1    MWSRSVRISRVGQRSTWRSSSTMSSVNYHVVGWKSCPYYERAANVASSMQTLFPGQVKAT  60

Query  61   IHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF  120
            IHEHATKQSFNDWLE SQ+TFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF
Sbjct  61   IHEHATKQSFNDWLEASQATFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAF  120

Query  121  FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD
Sbjct  121  FRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180

Query  181  YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLI  240
            YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKL+
Sbjct  181  YVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLV  240

Query  241  TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA  300
            TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA
Sbjct  241  TSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIA  300

Query  301  VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR  360
            VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLK QGFDVTVMVR
Sbjct  301  VGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMVR  360

Query  361  SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLN  420
            SILLRGFDTDMAARIGTYMEEEAKI+FIKGAVPTSIEQL NGQLKVTHTFGEGIYDTVLN
Sbjct  361  SILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEGIYDTVLN  420

Query  421  ATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGR  480
            ATGR PDVSGLNL AAGVGLNPKTGRIAVTHEQTS PHIYAVGDVIDGPELTPVAIQAGR
Sbjct  421  ATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPVAIQAGR  480

Query  481  LLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEW  540
            LL+KRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAA+E IGADNLGVYHQSFTPLEW
Sbjct  481  LLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQSFTPLEW  540

Query  541  SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600
            SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIA+KLNASY+DFVSTV
Sbjct  541  SLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYDDFVSTV  600

Query  601  GIHPTTAEIFTTLEITKESGLDASAAGC  628
            GIHPTTAEIFTTLEITKESGLDASAAGC
Sbjct  601  GIHPTTAEIFTTLEITKESGLDASAAGC  628

>H310_08590
Length=640

 Score = 984 bits (2544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/606 (78%), Positives = 518/606 (85%), Gaps = 3/606 (0%)

Query  26   VNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQF  85
            +NYHVVGWK CPYY +AA+V  SMQ LFP QVKATIHEH  K+SF +WL  SQ+ FA QF
Sbjct  35   INYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQTEFARQF  94

Query  86   VGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAP-ARNVHANDVD  144
              DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  AP A N H +D  
Sbjct  95   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTS  154

Query  145  --DGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202
              D   YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLGGTCVNVGC
Sbjct  155  SSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGC  214

Query  203  IPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            IPKKLMHQS+I+GELLHKDAE FGW V NA+FDWTKL++SVQDYIHGLNFKYR+DLRDKK
Sbjct  215  IPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDKK  274

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            VKYEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG + AISSDDI
Sbjct  275  VKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDI  334

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEE  382
            FS+   PGKTLVVGASYVALECAGFLKGQGFDVT+MVRSILLRGFD D+A RIG YME E
Sbjct  335  FSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENE  394

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNP  442
            + I FIK +VPTSIE+LPNGQLKVTHT GEGIYDTVLNATGR PDV  LNL AAGV LNP
Sbjct  395  SGIAFIKESVPTSIEKLPNGQLKVTHTHGEGIYDTVLNATGRSPDVQMLNLPAAGVTLNP  454

Query  443  KTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTA  502
            K+GRI VT+EQTSTPHIYA+GDVID PELTPVAIQAG+LL++RLF N   LM Y K+CTA
Sbjct  455  KSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTA  514

Query  503  VFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQ  562
            VFTP+EYGCCGLSE+ A+ + G DN+ VYHQ+FTPLEWSLSH+R LAKECY KLIVD TQ
Sbjct  515  VFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKLIVDTTQ  574

Query  563  NDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLD  622
              RVVGFHYLGPNAGEVTQA+G+A+KL+A+Y+DFV+TVGIHPTTAEIFTTLEITKESG D
Sbjct  575  QKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGED  634

Query  623  ASAAGC  628
            ASA+GC
Sbjct  635  ASASGC  640

>H257_08436
Length=642

 Score = 969 bits (2504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/604 (77%), Positives = 519/604 (86%), Gaps = 1/604 (0%)

Query  26   VNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQF  85
            VNYHVVGWK CPYY +AA+VA SMQ LFP QVKATIHEH  K+SF +WL  SQ+ FA QF
Sbjct  39   VNYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQF  98

Query  86   VGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDD  145
              DAR   H +SPFCYLE     KFVGGCDDTLAFFR+RTQSA +  A + ++HAND  D
Sbjct  99   DNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSD  158

Query  146  G-ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIP  204
                YDWDLVVIGGGSGGLA SKEA+K GQKVLVLDYVKPSP GSTWGLGGTCVNVGCIP
Sbjct  159  ADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIP  218

Query  205  KKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVK  264
            KKLMHQS+I+GE+LHKDA+ FGW+V NATFDW+KL++SVQDYIHGLNFKYRVDLRDKKVK
Sbjct  219  KKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVK  278

Query  265  YENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFS  324
            YEN LGTFKDAHTLTLTN AK K P DVTFRRA+IAVGGRPK L CPG + A+SSDDIFS
Sbjct  279  YENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFS  338

Query  325  RPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAK  384
            +P  PGKTLVVGASYVALECAGFLKGQGFDVT+MVRSILLRGFD D+A RIG YME E+ 
Sbjct  339  KPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESG  398

Query  385  INFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKT  444
            I FIK +VPTSI +L NGQ +VTHT G+ +YDT+LNATGR PDV  LNL AAGV LNPK+
Sbjct  399  IAFIKESVPTSIVKLENGQFQVTHTTGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKS  458

Query  445  GRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVF  504
            GRI V +EQTSTP+IYA+GDVID PELTPVAIQAG+LLS+RLF N  TLM Y K+CTAVF
Sbjct  459  GRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVF  518

Query  505  TPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQND  564
            TP+EYGCCGLSE+ A+ + G +N+ VYHQ+FTPLEWSLSHDR LAKECY KLIVD TQ  
Sbjct  519  TPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDTTQQK  578

Query  565  RVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDAS  624
            RV+GFHYLGPNAGEVTQA+GIAIKLNA+Y+DF++TVGIHPTTAEIFTTLEITKESG+DAS
Sbjct  579  RVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDAS  638

Query  625  AAGC  628
            A+GC
Sbjct  639  ASGC  642

>PYIR_13452
Length=645

 Score = 780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/611 (63%), Positives = 463/611 (76%), Gaps = 15/611 (2%)

Query  27   NYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQST--FATQ  84
             YHV GW+ C +Y++A++V  +M+ L+P  V   +HE   +++F +WL  S +       
Sbjct  41   KYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTEC  100

Query  85   FVGDARATNHYTSPFCYLEDGAGTK-FVGGCDDTLAFFRSRTQSAAAPSA-PARNVHAND  142
            F  D++A  H +SPF +    A T+ F+GGCDDTLA FRS   + A  +A P     A  
Sbjct  101  FGADSKALTHKSSPFVW----ANTRGFIGGCDDTLALFRSGVSAPATLAATPTMVAAAPA  156

Query  143  VDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202
              D A YD+DL+VIGGGSGGLA SKEA+KYG+KV VLDYVKPSP G++WGLGGTCVNVGC
Sbjct  157  PADDAKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGC  216

Query  203  IPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            IPKKLMHQS+++GE +HKDA+AFGW V   TFDW++++ SV  YI  +NFKY+V+LRDKK
Sbjct  217  IPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKK  276

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            VKYEN LG+F DAHTL L +P KG   K VT R  +IAVGGRPK L C G DLAISSDDI
Sbjct  277  VKYENLLGSFVDAHTLELWHPKKG--TKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDI  334

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEE  382
            F R   PGKTLVVGASYVALECAGF+KG G+DV +MVRSILLRGFD DMA +IG +ME E
Sbjct  335  FWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETE  394

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAG  437
            +KI FI+GAVP SI +L +GQL V     +G      +DTVLNATGR PDV+ L L   G
Sbjct  395  SKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVG  454

Query  438  VGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYD  497
            V LNPKTGRIAVT+EQTSTP+IYA+GDVID PELTPVAIQAGRLL++RL++N   LM YD
Sbjct  455  VKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYD  514

Query  498  KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLI  557
            KVCTAVFTPIEYGCCGLSE+A++E  G +NL +YHQ+FTPLEWSLS DR  A  CY K+I
Sbjct  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574

Query  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITK  617
             D  +N  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V+ VGIHPTTAEIFTTLE+TK
Sbjct  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTK  634

Query  618  ESGLDASAAGC  628
             SG  A++ GC
Sbjct  635  SSGESAASGGC  645

>PYAP_17761
Length=622

 Score = 775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/608 (64%), Positives = 465/608 (76%), Gaps = 13/608 (2%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            Y+V GW +CP+Y +A +VA +MQ L+   V     E  ++ +F  WL  S + FA  F  
Sbjct  21   YYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNAAFAQAFGT  80

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS--RTQSAAAPSAPARNVHANDVDD  145
            D+ A  H +SPF +        F+GGCD TLA FRS    +  A PSA +  +    VD+
Sbjct  81   DSPALTHTSSPFVW---SNARGFIGGCDATLAHFRSGVAARPLAGPSA-SPTMTPVAVDE  136

Query  146  GATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPK  205
              TYD+DLVVIGGGSGGLA SKEAAKYG+KV VLDYVKPSP G+TWGLGGTCVNVGCIPK
Sbjct  137  SKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPK  196

Query  206  KLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
            KLMHQSA++GEL+HKDA AFGW +    F WT+L+ SV +YI G+NFKY+V+LRDKKVKY
Sbjct  197  KLMHQSALIGELMHKDAGAFGWNMGEQKFTWTQLVESVNNYIKGINFKYKVELRDKKVKY  256

Query  266  ENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSR  325
            ENFLG+F D HT+ L +  KG   K +T R  ++AVGGRP+ L CPG + AISSDDIF R
Sbjct  257  ENFLGSFVDPHTIELWHHKKGT--KTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFWR  314

Query  326  PTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKI  385
             T PGKTLVVGASYVALECAGFLKG G++V VMVRSILLRGFD DMA RIG +M++E+KI
Sbjct  315  KTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESKI  374

Query  386  NFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAGVGL  440
             FI+GAVP SIE+L NGQL V     +G     ++D+VLNATGR PDVS LNL  AGV L
Sbjct  375  EFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQL  434

Query  441  NPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVC  500
            NPKTGRIAVT+EQTSTP+++A+GDVID PELTPVAIQAGRLL++RL++N  TLM YDKVC
Sbjct  435  NPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVC  494

Query  501  TAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDR  560
            TAVFTPIEYGCCGLSE+AA +  G DNL +YHQSF PLEWSLS DR  A  CY K+I D+
Sbjct  495  TAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICDK  554

Query  561  TQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESG  620
            T++  VVGFHYLGPNAGEVTQA+G+A+K+  +Y+  V+ VGIHPTTAE+FTTLE+TK SG
Sbjct  555  TRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTKSSG  614

Query  621  LDASAAGC  628
              A+A GC
Sbjct  615  ASAAAGGC  622

>PYIW_19972
Length=609

 Score = 748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/606 (61%), Positives = 451/606 (74%), Gaps = 34/606 (6%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            YH+ GW+ C +Y++A++V  +M+ L+P  V   IHE   +++F  WL  S + FA  F  
Sbjct  33   YHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLSASAADFAANFGA  92

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDDGA  147
            D++A  H +SPF                    F +  + +    +AP        VDD  
Sbjct  93   DSKAATHTSSPF--------------------FGKDESPTPTMVAAPV-------VDDNV  125

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKL  207
            TYD+DL+VIGGGSGGLA SKEAAKYG+KV VLDYVKPSP G+TWGLGGTCVNVGCIPKKL
Sbjct  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185

Query  208  MHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYEN  267
            MHQS+++GE +HKDA AFGW+V    FDW +++ SV  YI  +NFKY+V+LRDKKVKYEN
Sbjct  186  MHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245

Query  268  FLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPT  327
             LG+F DAHTL L +P KG   K VT R  +IAVGGRPK L C G +LAISSDDIF R  
Sbjct  246  LLGSFVDAHTLELWHPKKGT--KTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKE  303

Query  328  PPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINF  387
             PGKTLV+GASYVALECAGF+KG G+DV +MVRSILLRGFD DMA++IG +ME E+KI F
Sbjct  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEF  363

Query  388  IKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAGVGLNP  442
            I+GAVP SI +L +GQL V     +G      +DTVLNATGR PDV+ LNL + GV LNP
Sbjct  364  IRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNP  423

Query  443  KTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTA  502
            KTGRIAVT+EQTS P+I+A+GDVID PELTPVAIQAGR+L++RL++N   LM YDKVCTA
Sbjct  424  KTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTA  483

Query  503  VFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQ  562
            VFTPIEYGCCGLSE+A++E  G D L +YHQ+FTPLEWSLS DR  A  CY K+I D T+
Sbjct  484  VFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTR  543

Query  563  NDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLD  622
            N  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+D V+ VGIHPTTAEIFTTLE+TK SG  
Sbjct  544  NKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGES  603

Query  623  ASAAGC  628
            A+A GC
Sbjct  604  AAAGGC  609

>PHYKE_8391
Length=778

 Score = 743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/631 (59%), Positives = 451/631 (71%), Gaps = 34/631 (5%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            +H+ GW++CP + +A  VA +MQ L+P +V    H    + +F  WL TS+  F   F  
Sbjct  152  FHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFKQWLSTSKDHFVMHFGA  211

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS--------------RTQSAAA---  130
            D++A  H TSPF +  +    KFVGGCDD LAFFRS              + ++AA+   
Sbjct  212  DSKAVTHVTSPFVWSSNP--IKFVGGCDDLLAFFRSGVAVGSPQGADPAEKAEAAASIEV  269

Query  131  --PSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQG  188
               S       A  +++  +YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG
Sbjct  270  AESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  329

Query  189  STWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPN-----ATFDWTKLITSV  243
            ++WGLGGTCVNVGCIPKKLMHQS+++GE +H D+  FGW V +     ATFDW +L+++V
Sbjct  330  TSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNV  389

Query  244  QDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGG  303
              YI  +NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K +T R  ++AVGG
Sbjct  390  DSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGT--KQITTRHVVVAVGG  447

Query  304  RPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI  362
            RPK L CPGA+ AISSDDIF  + T PGKTLVVGASYVALECAGFLKG G+DV VMVRSI
Sbjct  448  RPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  507

Query  363  LLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG-----EGIYDT  417
            LLRGFD DMA +IG YME +A I FI+  VP SI +L NGQL V  T       E  +DT
Sbjct  508  LLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDT  567

Query  418  VLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQ  477
            VLNATGR PDV+ L L  AGV LN KTGRI   +EQTSTP+I+A+GDVID PELTPVAIQ
Sbjct  568  VLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQ  627

Query  478  AGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTP  537
            AGR LS+RL++NS   M YDKVCTAVFTPIEYGCCGLSE+ + E  G DN+ VYH++F P
Sbjct  628  AGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVP  687

Query  538  LEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFV  597
            LEWSLS  R  ++ CY K+I D T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V
Sbjct  688  LEWSLSESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMV  747

Query  598  STVGIHPTTAEIFTTLEITKESGLDASAAGC  628
             TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  748  DTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PHYCA_556160
Length=649

 Score = 731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/632 (59%), Positives = 451/632 (71%), Gaps = 35/632 (6%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            +H+ GWK+CP + +A  VA +MQ L+P +V   +H    +++F  WL  SQ  FAT F  
Sbjct  22   FHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKHWLSESQDEFATSFGV  81

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND  142
            D++AT H TSPF +  +   T FVGGCDD L +FRS       Q A    +P       D
Sbjct  82   DSKATKHVTSPFVWSSNP--TAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAEAD  139

Query  143  VDDGAT--------------YDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQG  188
            V    T              YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKPSPQG
Sbjct  140  VPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQG  199

Query  189  STWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSV  243
            ++WGLGGTCVNVGCIPKKLMHQS+++GE++H D   FGW + +      TF+W +L+++V
Sbjct  200  TSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNV  259

Query  244  QDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGG  303
              YI  +NFKY+V+LR K VKYENFLG+F + HTL L +P KG   K +T R  +IAVGG
Sbjct  260  DGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGT--KQITTRDVVIAVGG  317

Query  304  RPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI  362
            RPK L CPG + AISSDDIF  +   PGKTLVVGASYVALECAGFLKG G+DV VMVRSI
Sbjct  318  RPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSI  377

Query  363  LLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDT  417
            LLRGFD DMA +IG YME ++ I FI+  VP SI +L NGQL V  T  +G      +DT
Sbjct  378  LLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDT  437

Query  418  VLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQ  477
            VLNATGR PDV+ LNL  AGV LN K+GRI V +EQTSTP+IYA+GDVID PELTPVAIQ
Sbjct  438  VLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQ  497

Query  478  AGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTP  537
            AGRLLS+RL++NS   M Y+KVCTAVFTPIEYGCCG+SE+ + E  G DN+ VYH +F P
Sbjct  498  AGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVP  557

Query  538  LEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDF  596
            LEWSLS D R  A+ CY K+I D+T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  
Sbjct  558  LEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQM  617

Query  597  VSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628
            V TVGIHPTTAE FTTLE+TK SG   +  GC
Sbjct  618  VDTVGIHPTTAESFTTLEVTKSSGGATTGGGC  649

>PITG_18452
Length=856

 Score = 729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/629 (59%), Positives = 449/629 (71%), Gaps = 41/629 (7%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            +++ GWKSC  + +A  VA +MQ L+P +V    H    + +F  WL  SQ      F  
Sbjct  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQDDITAHFGA  81

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----------------RTQSAAA  130
            D+RAT H TSPF +    + T FVGGCD+ LAFFRS                    SA A
Sbjct  82   DSRATKHVTSPFVW----SSTIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALA  137

Query  131  P----SAP--ARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKP  184
            P    S P  A    +    + A+YD+DLVVIGGGSGGLA SKEAA +GQKV VLDYVKP
Sbjct  138  PETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKP  197

Query  185  SPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKL  239
            SPQG++WGLGGTCVNVGCIPKKLMHQS+++GE+LH D+ +FGW V +       FDW +L
Sbjct  198  SPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQL  257

Query  240  ITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALI  299
            +T+V  YI G+NFKY+V+LR K VKYENFLG+F D HTL L +P KG   K +T R  +I
Sbjct  258  VTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGS--KQITTRDVVI  315

Query  300  AVGGRPKSLDCPGADLAISSDDIFSRPTP-PGKTLVVGASYVALECAGFLKGQGFDVTVM  358
            AVGGRP+ L  PG + AISSDDIF   T  PGKTLVVGASYVALECAGFLKG G+DV VM
Sbjct  316  AVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVM  375

Query  359  VRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----  413
            VRSILLRGFD DMA +IG YME ++ I FI+  VP SI +L NGQL V  T  +G     
Sbjct  376  VRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEE  435

Query  414  IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTP  473
             +D+VLNATGR PD++ L+L  AGV LN KTGRI V HEQTSTP+IYA+GDVID PELTP
Sbjct  436  AFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTP  495

Query  474  VAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQ  533
            VAIQAGRLLS+RL++N+   M YDKVCTAVFTPIEYGCCGLSE+ +++  G D + VYH 
Sbjct  496  VAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHT  555

Query  534  SFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNAS  592
            +F PLEWSLS + RA A+ CY K+I DR ++  VVGFHYLGPNAGEVTQA+G+A+KL  +
Sbjct  556  NFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFT  615

Query  593  YEDFVSTVGIHPTTAEIFTTLEITKESGL  621
            Y+  V TVGIHPTTAE FTTLE+TK SG+
Sbjct  616  YDQMVDTVGIHPTTAESFTTLEVTKSSGV  644

>PYAR_13569
Length=494

 Score = 698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/492 (69%), Positives = 404/492 (82%), Gaps = 7/492 (1%)

Query  142  DVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVG  201
            DVDD ATYD+DLVVIGGGSGGLA SKEAAK+G+KV+VLDYVKPSP G+TWGLGGTCVNVG
Sbjct  5    DVDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVG  64

Query  202  CIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDK  261
            CIPKKLMHQSA++GEL+HKDA AFGW     +F WT+L+ SV +YI G+NFKY+V+LRDK
Sbjct  65   CIPKKLMHQSALLGELMHKDAPAFGWTTGAQSFTWTQLVASVNNYIKGINFKYKVELRDK  124

Query  262  KVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDD  321
            KVKYENFLG+F DAHT+ L +    KP K VT R  +IAVGGRP++L CPG + AISSDD
Sbjct  125  KVKYENFLGSFVDAHTIELWH--HKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDD  182

Query  322  IFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEE  381
            IF R T PGKTLVVGASYVALECAGFLKG G+DV +MVRSILLRGFD DMA RIG +M++
Sbjct  183  IFWRKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQD  242

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAA  436
            E++I FI+G VP SIE+  NG+L V     +G     ++DTVLNATGR PDV+ LNL  A
Sbjct  243  ESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKA  302

Query  437  GVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAY  496
            GV LNPK+GRIA T+EQTSTP+I+A+GDVID PELTPVAIQAGRLL++RL++N  TLM Y
Sbjct  303  GVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDY  362

Query  497  DKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKL  556
            DK+CTAVFTPIEYGCCGLSE+ A    G +NL +YHQSF PLEWSLS +R  A  CY K+
Sbjct  363  DKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVKV  422

Query  557  IVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEIT  616
            I D+T++  VVGFHYLGPNAGEVTQA+G+A+K+  +Y+  V+ VGIHPTTAE+FTTLEIT
Sbjct  423  ICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEIT  482

Query  617  KESGLDASAAGC  628
            K SG  A+A GC
Sbjct  483  KSSGASAAAGGC  494

>HYAP_07095
Length=613

 Score = 695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/617 (57%), Positives = 439/617 (71%), Gaps = 41/617 (7%)

Query  49   MQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGT  108
            M  ++PG+V    H    + +F  WL TS   F TQF  D++AT H TSPF ++ +   T
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNP--T  58

Query  109  KFVGGCDDTLAFFRS-----------------RTQSAAAP---SAPARNVHAND-----V  143
             FVGGCDD LA FRS                  T    AP   +A A  ++ +      V
Sbjct  59   TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118

Query  144  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  203
            +D A+YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSP G++WGLGGTCVNVGCI
Sbjct  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178

Query  204  PKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRVDL  258
            PKKLMHQS+++GE+LH D  +FGW V +      TFDW +L+++V  YI  ++FKY+V+L
Sbjct  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVEL  238

Query  259  RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  318
            R K+VKYEN LG+F D HTL L +P KG   K++T R  +IAVGGRP+ L C G +LA+S
Sbjct  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGT--KEITTRHVVIAVGGRPRQLACLGGELAVS  296

Query  319  SDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGT  377
            SDDIF  +   PGKTLVVGASYVALECAGFLKG G+ V VMVRSILLRGFD DMA++IG 
Sbjct  297  SDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGE  356

Query  378  YMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLN  432
            YME ++ I FI+  VP SI +L +GQL V     +G      +DTVLNATGR PDV+ L 
Sbjct  357  YMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLG  416

Query  433  LSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSAT  492
            L  AGV LN KTGRI V +EQT+TP++YA+GDVID PELTPVAIQAGRLLS+RL++    
Sbjct  417  LDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTV  476

Query  493  LMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAKE  551
             M YDK+CTAVFTPIEYGCCGLSE+ + E  G D++ VYH++F PLEWSL+   R  A+ 
Sbjct  477  QMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAES  536

Query  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFT  611
            CY K++ D+T+N+ V+GFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHPTTAE FT
Sbjct  537  CYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFT  596

Query  612  TLEITKESGLDASAAGC  628
            TLE TK SG   +  GC
Sbjct  597  TLETTKSSGDSTTGGGC  613

>PHALS_06481
Length=644

 Score = 662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/618 (55%), Positives = 430/618 (70%), Gaps = 22/618 (4%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            +++ GWK+CP + +A  +  +MQ L+P ++   I     ++ F  WL+ SQ  FA  F  
Sbjct  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFGA  91

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFRS-----RTQSAAAPSAPARNVHAND  142
             ++A  H TSPF +  +   T FVGGCDD L FFRS     R Q        A  + +  
Sbjct  92   KSKAMKHVTSPFVWSSNP--TTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAE-ISSTA  148

Query  143  VDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202
            V +   +D+DLVVIGGG GGLA SKEAA +GQKV VLDYVKPSPQG+ WGLGGTCVNVGC
Sbjct  149  VQEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGC  208

Query  203  IPKKLMHQSAIMGELLHKDAEAFGWAVPNA-----TFDWTKLITSVQDYIHGLNFKYRVD  257
            IPKKL+HQS+++GE++  D+  FGW   N       FDW +L+ +V  YI  +NFKY+V 
Sbjct  209  IPKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVK  268

Query  258  LRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAI  317
            LR K VKYENFLG+F D HT+ L++P KG   K +T R  +IAVG RP+ L CPG + A+
Sbjct  269  LRSKNVKYENFLGSFVDPHTVKLSHPRKG--TKQITTRNVVIAVGSRPRELTCPGGEYAV  326

Query  318  SSDDIF-SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIG  376
            SSDDIF  +   PGKTLV+GASYVALECAGFLKG G++V VMVRSILLR FD +MA +IG
Sbjct  327  SSDDIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIG  386

Query  377  TYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGL  431
             YME ++ I FI+  VP SI +L N QL V     +G      ++TVLNATGR P+V+ L
Sbjct  387  EYMEVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHL  446

Query  432  NLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491
             L  AGV LN KTGRI V +EQTST +IYA+GDV+D PELTPVAIQ+GRLLS+RL++NS+
Sbjct  447  GLDKAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSS  506

Query  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAK  550
              M YDKVCT VFTPIEYGCCGLSE+ +    G DN+ +YH +F PLEWSLS + R  + 
Sbjct  507  VQMDYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASN  566

Query  551  ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             CY K++ D++++  V+GFHYLGPNAGEV QA+G+A++L  +Y+  V+TVGIHP TAE  
Sbjct  567  SCYIKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESL  626

Query  611  TTLEITKESGLDASAAGC  628
            T LE+TK SG   +  GC
Sbjct  627  TILEVTKSSGGATTGGGC  644

>PYVX_18170
Length=510

 Score = 660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/540 (63%), Positives = 398/540 (74%), Gaps = 38/540 (7%)

Query  96   TSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVV  155
            +SPF +  +   T FVGGCD  L  FRS+     A S P  N                  
Sbjct  2    SSPFVWTSNP--TAFVGGCDALLDRFRSQVPRPNAASKPQAN------------------  41

Query  156  IGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMG  215
                        EA+K+GQKVLVLDYVKPSPQG+ WGLGGTCVNVGCIPKKLMHQSA++G
Sbjct  42   ---------GEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIG  92

Query  216  ELLHKDAEAFGWAVPNA-TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKD  274
            E++HKDA  FGW   NA  FDW++L +SV  YI  LNFKY+VDLRDKKVKYENFLG F D
Sbjct  93   EVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVD  152

Query  275  AHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLV  334
             HT+ L+NP K  P K VT RR ++AVGGRP+ L CPG +L+I+SDDIF R T PGKTLV
Sbjct  153  PHTIELSNPRK--PSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRKTAPGKTLV  210

Query  335  VGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPT  394
            VGASYVALECAGFLKGQG+DV VMVRSILLRGFD DMA RIG YME EA I FI+  VP+
Sbjct  211  VGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPS  270

Query  395  SIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV  449
            SI +L +G+L V  T  +G      +DTVLNATGR PDV  L L  AGV LNPKTGRI V
Sbjct  271  SITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV  330

Query  450  THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEY  509
            T+EQTSTP+I+A+GDVID PELTPVAIQAGRLL++RL++N  TLM Y+KVCTAVFTPIEY
Sbjct  331  TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEY  390

Query  510  GCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVG  568
            GCCGLSE+ ++E  G DN+ VYHQ+FTPLEW+LS D R     CY K+I D+T++  VVG
Sbjct  391  GCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVG  450

Query  569  FHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628
            FHYLGPNAGEVTQA+G+A+KL  +YE  VS VGIHPTTAE FTTLE+TK SG  A+   C
Sbjct  451  FHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>PHYSO_348901
Length=526

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/528 (64%), Positives = 398/528 (75%), Gaps = 19/528 (4%)

Query  118  LAFFRSRTQSAAAPSAPARNVH----ANDVDDGAT-YDWDLVVIGGGSGGLAASKEAAKY  172
            +A  R   Q +A  +     +H     + VD+  T YD+DLVVIGGGSGGLA SKEAA +
Sbjct  1    MAKLRLSIQESALNTKKNMQIHDPSTPSAVDEAETSYDYDLVVIGGGSGGLACSKEAASF  60

Query  173  GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNA  232
            GQKV VLDYVKPSPQG++WGLGGTCVNVGCIPKKLMHQS+++GEL+H D+  FGW + +A
Sbjct  61   GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGWNIASA  120

Query  233  -----TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGK  287
                 TF W +L+ +V  YI G+NFKY+V+LR K VKYENFLG+F DAHTL L +P KG 
Sbjct  121  DGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWHPRKG-  179

Query  288  PPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF-SRPTPPGKTLVVGASYVALECAG  346
              K +T R  +IAVGGRPK L CPG + AISSDDIF  +   PGKTLVVGASYVALECAG
Sbjct  180  -TKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAG  238

Query  347  FLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKV  406
            FLKG G+DV VMVRSILLRGFD DMA +IG YME ++ I FI+  VP SI +L NGQL V
Sbjct  239  FLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLV  298

Query  407  THTFGEG-----IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYA  461
              T  +G      +DTVLNATGR PDV+ L L  A V LN KTGRI V +EQTSTP+IYA
Sbjct  299  KWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPNIYA  358

Query  462  VGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVE  521
            +GDVID PELTPVAIQAGRLLS+RL++NS   M YDK+CTAVFTPIEYGCCGLSE+ + E
Sbjct  359  IGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEEDSKE  418

Query  522  AIGADNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVT  580
              G DN+ VYH++F PLEWSLS + R  A+ CY K+I D+T++  VVGFHYLGPNAGEVT
Sbjct  419  RYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVT  478

Query  581  QAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628
            QA+G+A+KL  +Y+  V TVGIHPTTAE FTTLEITK SG   +  GC
Sbjct  479  QAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKSSGGTTTGGGC  526

>PHYRA_50855
Length=489

 Score = 638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/491 (65%), Positives = 380/491 (77%), Gaps = 12/491 (2%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKL  207
            +YD+DLVVIGGGSGGLA SKEAA +G+KV VLDYVKPSPQG++WGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  208  MHQSAIMGELLHKDAEAFGWAVPNA----TFDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            MHQS+++GE++H D+  FGW V +     TF+W +L+++V  YI  +NFKY+V+LR K V
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
            KYENFLG+F D HTL L +  KG   K +T R  +IAVGGRPK L CPG + AISSDDIF
Sbjct  121  KYENFLGSFVDPHTLELWHHRKG--TKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIF  178

Query  324  -SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEE  382
              +   PGKTLVVGASYVALECAGFLKG G++V VMVRSILLRGFD DMA +IG YME +
Sbjct  179  WMKKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQ  238

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAG  437
            + I FI+  VP SI  L NGQL V  T  +G      +DTVLNATGR PDV+ L L  AG
Sbjct  239  SGIEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAG  298

Query  438  VGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYD  497
            V LN K+GRI V +EQTST +IYA+GDVID PELTPVAIQAGRLLS+RL++NS   M Y+
Sbjct  299  VKLNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYE  358

Query  498  KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLI  557
            KVCTAVFTPIEYGCCGLSE+ + E  G DN+ VYH +F PLEWSLS  R  A+ CY K+I
Sbjct  359  KVCTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVI  418

Query  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITK  617
             D+T++  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+  V TVGIHPTTAE FTTLE+TK
Sbjct  419  CDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTK  478

Query  618  ESGLDASAAGC  628
             SG   +  GC
Sbjct  479  SSGGATTGGGC  489

>SPRG_04074
Length=509

 Score = 419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 247/499 (49%), Positives = 312/499 (63%), Gaps = 31/499 (6%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            + +D+D VVIGGGSGG+AA+KEAA+ G KV + D+VKP+  G+ WGLGGTCVNVGC+PKK
Sbjct  2    SNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKK  61

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNAT-FDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
            +MH S I+G  LH DA   GW VP     +W  L+ +VQ ++  LNF YRV LR  KV+Y
Sbjct  62   IMHYSGILGAGLH-DAAHLGWQVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQY  120

Query  266  ENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPK-SLDCPG-ADLAISSDDIF  323
             N L  F+D HTL+     K  P + +T    LIA GGRP    D PG A+ AI+SDD+F
Sbjct  121  INALARFEDPHTLSYQ--VKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLF  178

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEA  383
            S  T PGKTLVVG SY+ALECAGFL    +  TV VRSILLRGFD  +AA+I   M  + 
Sbjct  179  SLSTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMVAQG  238

Query  384  KINFIKGAVPTSI-EQLPNGQLKV------TH-TFGEGIYDTVLNATGRYPDVSGLNLSA  435
             ++F    +PTSI +    GQL V      TH TF E  +DTVL A GR  D   + L  
Sbjct  239  -MDFRFNTLPTSIVKDEATGQLHVSFANSETHETFTEA-FDTVLYAVGRTADTFNIGLEK  296

Query  436  AGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDG-PELTPVAIQAGRLLSKRLFD-NSATL  493
            AGV   P  G+    +E T+ PHI+AVGDV+ G PELTPVAI+AG  L +RLF  N    
Sbjct  297  AGVKALPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKT  355

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSH---------  544
            M YD + T VFTP+EYG  GLSE+ A+   G D++ VY   F  LEW   H         
Sbjct  356  MNYDLIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQE  415

Query  545  ---DRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVG  601
               D      C  KL+  ++ N++V+GFH++GPNAGEVTQ   +A+ + A+ EDF + +G
Sbjct  416  GDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIG  475

Query  602  IHPTTAEIFTTLEITKESG  620
            IHPT AE F  L +TKESG
Sbjct  476  IHPTDAESFMALTVTKESG  494

>SDRG_14408
Length=528

 Score = 413 bits (1062),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 243/510 (48%), Positives = 312/510 (61%), Gaps = 31/510 (6%)

Query  136  RNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGG  195
            R   A      + +D+D VVIGGGSGG+AA+KEAA+ G KV + D+VKP+  G+ WGLGG
Sbjct  10   RIFQARTTSTMSNFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGG  69

Query  196  TCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNAT-FDWTKLITSVQDYIHGLNFKY  254
            TCVNVGC+PKK+MH S I+G  LH DA   GW +P     +W  L+ +VQ ++  LNF Y
Sbjct  70   TCVNVGCVPKKIMHYSGILGAGLH-DAAHLGWQLPEKVEHNWETLVETVQAHVKKLNFSY  128

Query  255  RVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPK-SLDCPGA  313
            RV LR  KV+Y N L  F+D HTL+     K  P + +T    LIA GGRP    + PG 
Sbjct  129  RVGLRSNKVQYINALARFEDPHTLSYQ--IKNGPTQTLTAAHILIATGGRPTVPKEIPGV  186

Query  314  -DLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMA  372
             + AI+SDD+FS  T PGKTLVVG SY+ALECAGFL    +  TV VRSILLRGFD  +A
Sbjct  187  GEYAITSDDLFSLTTAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVA  246

Query  373  ARIGTYMEEEAKINFIKGAVPTSI-EQLPNGQLKVT-------HTFGEGIYDTVLNATGR  424
            A+I   M  +  ++F    +PTSI +    GQL V+        TF E ++DTVL A GR
Sbjct  247  AKIQDIMVAQG-MDFRFNTLPTSIVKDDATGQLHVSFANSETNETFTE-VFDTVLYAVGR  304

Query  425  YPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDG-PELTPVAIQAGRLLS  483
              D   + L   GV   P  G+    +E T+ PHI+AVGDV+ G PELTPVAI+AG  L 
Sbjct  305  TADTFNIGLEKVGVKALPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLV  363

Query  484  KRLFD-NSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSL  542
            +RLF  N    M YD + T VFTP+EYG  GLSE+ A+   G D++ VY   F  LEW  
Sbjct  364  RRLFKPNYTKTMNYDLIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGA  423

Query  543  SH------------DRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLN  590
             H            D      C  KL+  ++ N++V+GFH++GPNAGEVTQ   +A+ + 
Sbjct  424  VHRQKAESAQEGDYDTEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMG  483

Query  591  ASYEDFVSTVGIHPTTAEIFTTLEITKESG  620
            A+ EDF + +GIHPT AE F  L +TKESG
Sbjct  484  ATKEDFDNVIGIHPTDAESFMALTVTKESG  513

>SDRG_12187
Length=462

 Score = 249 bits (636),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 176/470 (37%), Positives = 250/470 (53%), Gaps = 24/470 (5%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVV+GGGSGG+A+++ AA YG+KVLV++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  211  SAIMGELLHKDAEAFGW-AVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            +A +   +  DA A+G+ AVPN T DW  L      Y+  LN  Y  +L+   V +   L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFAQGL  115

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPP  329
             +F     + +        P D      L+AVGG+P   D PG +  ISSD  F     P
Sbjct  116  CSFGSDGRVQID-----ATPLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDERP  170

Query  330  GKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDTDMAARIGTYMEEEAKINFI  388
             +  VVGA Y+A+E AG L+G G D T+  R   +LR FD  + A +    + +  I   
Sbjct  171  ARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQAVLHDAFQRDG-ITLQ  229

Query  389  KGAVPTSIEQLP-NGQLKVTHTFGE--GIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTG  445
              +    +++ P  G L VT T GE    +D VL ATGR P    L L   G+ L+P  G
Sbjct  230  PHSTIARVDKDPTTGSLSVTTTAGEHHSGFDCVLVATGRTPMTKDLGLEHRGIQLSPN-G  288

Query  446  RIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMA-YDKVCTAV  503
             I V  ++ TS P ++A+GDV+D   LTPVAI AGR L+ RLF       A Y  + + V
Sbjct  289  FIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYTNIPSVV  348

Query  504  FTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQN  563
            F+    G  GL+E  A +    D L VY   F  + +SL ++ A  K      ++    +
Sbjct  349  FSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSL-YEHAHEKPTTAMKLICVGPS  407

Query  564  DRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            +++VG H +G  A E+ Q  G+AIK+ A  +D  + + IHPT AE   TL
Sbjct  408  EKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>SDRG_03822
Length=494

 Score = 248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 173/480 (36%), Positives = 249/480 (52%), Gaps = 30/480 (6%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            ATYD+  +V+G GSGG++++  A  YG KVLV++  + +      GLGGTCVNVGC+PKK
Sbjct  2    ATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGQANDGA---GLGGTCVNVGCVPKK  56

Query  207  LMHQSAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            +M  +A+  E+LH  A A+ +     +    FDW  +      Y+  LN  Y   + + K
Sbjct  57   IMFNAALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDK  115

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            V        F D HT+ +              +  LIAVGG P     PG + AISSD  
Sbjct  116  VDLVMGAAKFVDNHTVEVNGDRYAA-------KHILIAVGGVPAMPPLPGIEHAISSDGF  168

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEE  381
            F+  T P K  VVGA Y+A+E AG       D TV  R + +LR FD  +   + T M E
Sbjct  169  FALETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEM-E  227

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI------YDTVLNATGRYPDVSGLNLSA  435
             A + F++ +  TSIE+  +G L +  T   G+      ++TVL A GR P    L L  
Sbjct  228  HAGVRFVRESGITSIEKAEDGTLTIQATVA-GVAQSFAGFETVLFAIGRTPRTHDLGLET  286

Query  436  AGVGLNPKTGRIAVTHEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSAT-L  493
              + L+P         E T+ P+++AVGDV   G ELTPVAI AGR L+ RLF N     
Sbjct  287  TDIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNAC  346

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECY  553
            + Y ++ T VF+    G  GL+E  AV   GA N+  +  SF+ + +++S ++   +   
Sbjct  347  VNYHQIPTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA-  405

Query  554  CKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             KL+    + + VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  406  MKLVCIGVE-ETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_03823
Length=497

 Score = 243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 175/479 (37%), Positives = 248/479 (52%), Gaps = 28/479 (6%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKL  207
            T  +D +VIGGGSGG ++++ AA YG KVLV++           G+GGTCVNVGC+PKK+
Sbjct  4    TTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKV  60

Query  208  MHQSAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            M  +A+  E+LH  A A+ +     V   +FDW  L      Y+  LN  Y  +L + K+
Sbjct  61   MFNAAMHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKI  119

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
                    F D HT+ +            T +  LIAVGG P     PG + AISSD  F
Sbjct  120  PLIYGAAKFVDNHTIEVNG-------DRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFF  172

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
            +  T P K  VVGA Y+A+E AG       D TV  R + +LR FD  +   + T M E 
Sbjct  173  ALETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEM-EH  231

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI------YDTVLNATGRYPDVSGLNLSAA  436
            A + F++ +  TSIE+  +G L +  T   G+      ++TVL A GR P    L L   
Sbjct  232  AGVRFVRESGITSIEKAEDGTLTIQATVA-GVAQSFAGFETVLFAIGRTPRTHDLGLETT  290

Query  437  GVGLNPKTGRIAVTHEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSAT-LM  494
             + L+P         E T+ P+++AVGDV   G ELTPVAI AGR L+ RLF N     +
Sbjct  291  DIALSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACV  350

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T VF+    G  GL+E  A+E  GA N+ VY  +F  + +++S      K    
Sbjct  351  NYHQIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQKTAMK  410

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             + +   + + V+G H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  411  LMCIG--EEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PYIW_25301
Length=512

 Score = 243 bits (619),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 182/515 (35%), Positives = 255/515 (50%), Gaps = 52/515 (10%)

Query  126  QSAAAPSAPARNVHANDVDDGATYD--WDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYV  182
            +SA    A  R+ HA  V     +   +D +VIG GSGG+A+S+ AA Y   +V V++  
Sbjct  13   RSALLLQATGRSRHALLVSSVRCFSDVYDYLVIGAGSGGMASSRRAALYPNTRVAVVEQA  72

Query  183  KPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVP-------NATFD  235
            +         LGGTCVNVGC+PKK+M+ +A M  +LH+DA  +G+          N  F 
Sbjct  73   R---------LGGTCVNVGCVPKKIMYLAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFH  123

Query  236  WTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFR  295
            W KL      YI  LN  Y  +L + KV        F     + +         K++  +
Sbjct  124  WDKLKERRDAYILRLNDIYERNLGNSKVDLLTGTAVFNAHGNVEMDG-------KEIQAK  176

Query  296  RALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDV  355
              LIAVGG+P   D PG +L I SD  F     P K  VVGA Y+A+E AG L G G + 
Sbjct  177  NILIAVGGKPLIPDIPGKELCIDSDGFFELEQLPKKVAVVGAGYIAVELAGVLHGLGSNT  236

Query  356  TVMVRSI-LLRGFDT-------DMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQ--LK  405
            T+  R   +LR FD        D  A+ G  +  ++ +          +EQ  +G+  L 
Sbjct  237  TIFCRKDGVLRTFDELVRDTLHDAMAKDGIVVRPQSNV--------ARVEQTADGKKTLF  288

Query  406  VTHTFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQ-TSTPHIYAVGD  464
            + +      +DTV+ A GR P  S LNLSAAG+  + K G I V   Q TS  +++AVGD
Sbjct  289  LQNGSEHAGFDTVIYAAGRVPLTSELNLSAAGIATD-KHGFIKVDEYQTTSKSNVFAVGD  347

Query  465  VIDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAI  523
            V     LTPVAI AGR LS RLF   A   ++YD + T VF+    G  GL+E  A E  
Sbjct  348  VCGTTALTPVAIAAGRRLSDRLFGGMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKH  407

Query  524  GADNLGVYHQSFTPLEWSLSHD-----RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGE  578
            G   +  Y   F  + + L +D      A  K      +V   ++++VVG H +G  A E
Sbjct  408  GDAQIKTYTSRFVNMYYGLVNDVDADGAAKPKPMTAMKLVCLGKDEKVVGLHVIGMAADE  467

Query  579  VTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            + Q  G+A+K+ A+  DF + V IHPT  E   T+
Sbjct  468  MLQGFGVAVKMGATKADFDNCVAIHPTAGEELVTM  502

>SDRG_15045
Length=494

 Score = 242 bits (617),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 246/475 (52%), Gaps = 26/475 (5%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +V+G GSGG++ +  A  YG KVLV++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  211  SAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
            +A+  E+LH  A A+ +     +    FDW  +      Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  267  NFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRP  326
                 F D HT+ +         +  T +  LIAVGG P     PG + AISSD  F+  
Sbjct  120  MGAAKFVDNHTIEVNG-------ERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALE  172

Query  327  TPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKI  385
            T P K  VVGA Y+A+E AG       + TV  R + +LR FD  +   + T M E A +
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEM-EHAGV  231

Query  386  NFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAAGVGL  440
             F++ +   +IE+  +G L +  T  GE      ++TVL A GR P    L L    + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  441  NPKTGRIAVTHEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSAT-LMAYDK  498
            + +        E T+ P++YA+GDV   G ELTPVAI AGR L+ RLF N     + Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  499  VCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIV  558
            + T VF+    G  GL+E  A+E  GA N+  +  SF+ + +++  ++   +    KL+ 
Sbjct  352  IPTVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVC  410

Query  559  DRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
               + + VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  411  IGVE-EAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYAP_21882
Length=502

 Score = 241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 174/500 (35%), Positives = 250/500 (50%), Gaps = 41/500 (8%)

Query  134  PARNVHAN-DVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQ-KVLVLDYVKPSPQGSTW  191
            PAR   A+ +  DG    +D +VIG GSGG+A+S+ AA Y   +V V++  +        
Sbjct  16   PARAFSASANAGDGM---YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR--------  64

Query  192  GLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWA-------VPNATFDWTKLITSVQ  244
             LGGTCVNVGC+PKK+M+ +A +G  LH+D   +G+             F W KL     
Sbjct  65   -LGGTCVNVGCVPKKIMYLAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRD  123

Query  245  DYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR  304
             Y+  LN  Y  +L + KV       TF     + +         K++  +  LIAVGG+
Sbjct  124  AYVLRLNGIYGRNLDNSKVDLFRGTATFNAKGNVEVDG-------KEIAAKNVLIAVGGK  176

Query  305  PKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-L  363
            P   D PG +  I SD  F     P K  VVGA Y+A+E AG L G G D T+  R   +
Sbjct  177  PLIPDIPGKEHCIDSDGFFELEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGV  236

Query  364  LRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG--EGIYDTVLNA  421
            LRGFD  +   +   M +E  +N    +  T + +  +G   +    G     +D+V+ A
Sbjct  237  LRGFDELIRTTLHDAMAKEG-VNLRPHSSVTKVIKAADGTKTLVLADGSEHSGFDSVIYA  295

Query  422  TGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTP--HIYAVGDVIDGPELTPVAIQAG  479
             GR P    LNL AAG+  +   G I +   Q +T   +I+AVGDV   P LTPVAI AG
Sbjct  296  AGRVPLTESLNLEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAG  354

Query  480  RLLSKRLFDNSATLMA-YDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPL  538
            R L+ RLF       A Y+ + T VF+    G  GL+ED A    G D + VY   F  +
Sbjct  355  RRLADRLFGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNM  414

Query  539  EWSLSHD-----RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASY  593
             + + ++     +   K      +V + ++++VVG H +G  A E+ Q  G+A+K+ A+ 
Sbjct  415  HYGIINEFGEDGQQKPKPMTAMKLVCQGKDEKVVGVHIIGMAADEMLQGFGVAVKMGATK  474

Query  594  EDFVSTVGIHPTTAEIFTTL  613
             DF S V IHPT AE   T+
Sbjct  475  ADFDSCVAIHPTAAEELVTM  494

>PHALS_08068
Length=497

 Score = 241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 165/484 (34%), Positives = 246/484 (51%), Gaps = 38/484 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++D +VIG GSGG+A+++ AA Y G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  209  HQSAIMGELLH--------KDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRD  260
            + +A M   LH        +DA   G       F+W+KL      Y+  LN  Y  +L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  261  KKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSD  320
             KV        F +   + + +       K+V  ++ LIAVGGRP   D PG +L I SD
Sbjct  134  SKVDLIRGSAKFNERGNVEVDD-------KEVRAKKILIAVGGRPLIPDIPGKELCIDSD  186

Query  321  DIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDTDMAARIGTYM  379
              F   T P K  +VGA Y+A+E AG L   G   +V  R   +LR FD  +   +   M
Sbjct  187  GFFELETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAM  246

Query  380  EEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI--YDTVLNATGRYPDVSGLNLSAAG  437
              +  ++    +    +++  +G   +  T G     +D V+ ATGR P  S LNL  AG
Sbjct  247  ANDG-VHLRPNSTVARVKEAADGTKTLVLTNGSEHRGFDVVICATGRVPLTSTLNLEKAG  305

Query  438  VGLNPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA-TLMA  495
            +  +   G I V   ++T+  ++YAVGDV + P LTPVAI AGR LS RLF       ++
Sbjct  306  ITTD-DNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAKLS  364

Query  496  YDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALA------  549
            Y+ + T +F+    G  GL+E+ A +  G +N+ VY   F  + + L ++   A      
Sbjct  365  YENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVPKE  424

Query  550  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEI  609
            K      +V     ++VVG H +G  A E+ Q  G+A+K+ A+  DF + + IHPT  E 
Sbjct  425  KPKTAMKLVCAGNKEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEE  484

Query  610  FTTL  613
              TL
Sbjct  485  LVTL  488

>SDRG_11131
Length=494

 Score = 239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 166/475 (35%), Positives = 245/475 (52%), Gaps = 26/475 (5%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +V+G GSGG++ +  A  YG KVLV++  +   +    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFN  60

Query  211  SAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
            +A+  E+LH  A A+ +     +    FDW  +      Y+  LN  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  267  NFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRP  326
                 F D HT+ +         +  T +  LIAVGG P     PG + AISSD  F+  
Sbjct  120  MGAAKFVDNHTIEVNG-------ERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALE  172

Query  327  TPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKI  385
            T P K  VVGA Y+A+E AG       + TV  R + +LR FD  +   + T M E A +
Sbjct  173  TQPRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEM-EHAGV  231

Query  386  NFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAAGVGL  440
             F++ +   +IE+  +G L +  T  GE      ++TVL A GR P    L L    + L
Sbjct  232  QFVRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIAL  291

Query  441  NPKTGRIAVTHEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSAT-LMAYDK  498
            + +        E T+ P++YA+GDV   G ELTPVAI AGR L+ RLF N     + Y +
Sbjct  292  STEKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQ  351

Query  499  VCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIV  558
            + T VF+    G  GL+E  A+   GA N+  +  SF+ + +++  ++   +    KL+ 
Sbjct  352  IPTVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVC  410

Query  559  DRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
               + + VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  411  IGVE-EAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PHYSO_254571
Length=489

 Score = 238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 173/493 (35%), Positives = 239/493 (48%), Gaps = 52/493 (11%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            T ++D +VIG GSGG+A+++ AA Y G +V V++  +         LGGTCVNVGC+PKK
Sbjct  13   TTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKK  63

Query  207  LMHQSAIMGELLH--------KDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDL  258
            LM  +A M   LH        +D E  G       FDW KL      Y+  LN  Y  +L
Sbjct  64   LMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNL  123

Query  259  RDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAIS  318
             + KV        F D   + +         K++  +  +IAVGG+P   D PG +L I 
Sbjct  124  ANSKVALIRGSAKFNDKGNVEVDG-------KEILAKNVMIAVGGKPLIPDIPGKELCID  176

Query  319  SDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFD-------TD  370
            SD  F   T P K  VVGA Y+A+E AG L   G D ++  R   +LR FD        D
Sbjct  177  SDGFFELETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLED  236

Query  371  MAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI--YDTVLNATGRYPDV  428
              A+ G ++   + I          +E+  +G   +    G     YD V+ A GR P  
Sbjct  237  AMAKDGVHLRPHSNI--------ARVEKADDGTKTLVLADGSEYSGYDVVIYAAGRVPLT  288

Query  429  SGLNLSAAGVGLNPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF  487
            S L L  AGV  + K G I V   ++TS   + AVGDV   P LTPVAI AGR LS RLF
Sbjct  289  SNLQLDKAGVDTD-KNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLF  347

Query  488  DN-SATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDR  546
                   ++Y+ + T VF+    G  GL+E+ A    G D + VY   F  + + L ++ 
Sbjct  348  GGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEM  407

Query  547  ALA------KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600
              A      K      +V   + ++VVG H +G  A E+ Q  G+A+K+ A+  DF + V
Sbjct  408  DEATGEPKDKPKTAMKLVCAGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCV  467

Query  601  GIHPTTAEIFTTL  613
             IHPT  E   TL
Sbjct  468  AIHPTAGEELVTL  480

>PYAR_17512
Length=533

 Score = 239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 174/513 (34%), Positives = 253/513 (49%), Gaps = 56/513 (11%)

Query  140  ANDVDDGATYDWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCV  198
            ANDV+      +D +VIG GSGG+A+S+ AA Y   +V V++  +         LGGTCV
Sbjct  29   ANDVE------YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCV  73

Query  199  NVGCIPKKLMHQSAIMGELLHKDAEAFGWA--------VPNATFDWTKLITSVQDYIHGL  250
            NVGC+PKK+M+ +A MG LLH+D   +G+         +    F W KL      Y+  L
Sbjct  74   NVGCVPKKIMYLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRL  133

Query  251  NFKYRVDLRDKKVKYENFLGTFKDAHTLTLTN---PAKGK----------------PPKD  291
            N  Y  +L + KV+      TF     + +     PAK                    K+
Sbjct  134  NGIYERNLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKE  193

Query  292  VTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQ  351
            ++ +  LIAVGG+P   + PG +  I SD  F     P K  VVGA Y+A+E AG L G 
Sbjct  194  ISAKNVLIAVGGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVELAGVLHGL  253

Query  352  GFDVTVMVRSI-LLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTF  410
            G D T+  R   +LRGFD  + + +   M+++  +     ++   + +  +G   +    
Sbjct  254  GSDTTIFCRKDGVLRGFDELIRSTLHDAMDKDG-LKLRPHSLVAKVTKQADGTKTLVLQD  312

Query  411  G--EGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQ--TSTPHIYAVGDVI  466
            G     +DTV+ A GR P    LNL  AGV  + + G I +   Q  T+  +I+AVGDV 
Sbjct  313  GTEHAGFDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVC  371

Query  467  DGPELTPVAIQAGRLLSKRLFDN-SATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGA  525
              P LTPVAI AGR LS RLF       M+Y+ + T VF+    G  GL+E  A    G 
Sbjct  372  GTPALTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGD  431

Query  526  DNLGVYHQSFTPLEWSLSHD-----RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVT  580
            D + VY   F  + + + ++     +   K      +V   + ++VVG H +G  A E+ 
Sbjct  432  DAVKVYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEKVVGVHLIGMAADEIL  491

Query  581  QAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            Q  G+A+K+ A+  DF S V IHPT AE   T+
Sbjct  492  QGFGVAVKMGATKADFDSCVAIHPTAAEELVTM  524

>SPRG_11769
Length=453

 Score = 236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 172/476 (36%), Positives = 249/476 (52%), Gaps = 45/476 (9%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVV+GGGSGG+A+++ AA YG+KVLV++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  211  SAIMGELLHKDAEAFGW-AVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            +A +   +  DA A+G+ AVPN T DW  L      Y+  LN  Y  +L+   V + + L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFAHGL  115

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPP  329
             +F        ++  +G           L+AVGG+P   D PG +  ISSD  F     P
Sbjct  116  CSFG-------SDGRRGD--------ERLVAVGGQPVMPDIPGIEHCISSDGFFELDERP  160

Query  330  GKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDT-------DMAARIGTYMEE  381
             +  VVGA Y+A+E AG L+G G D T+  R   +LR FD        D   R G  ++ 
Sbjct  161  ARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQSVLHDAFKRDGITLQP  220

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTFGE--GIYDTVLNATGRYPDVSGLNLSAAGVG  439
             + +  +    P +      G L +T T G+    +D VL ATGR P    L L   G+ 
Sbjct  221  HSTVARVDKVDPAT------GTLSLTTTAGDYHTGFDCVLVATGRTPMTKHLGLEHRGIE  274

Query  440  LNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMA-YD  497
            L+P  G I V  ++ TS P ++A+GDV++   LTPVAI AGR L+ RLF       A Y 
Sbjct  275  LSPN-GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYT  333

Query  498  KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLI  557
             + + VF+    G  GL+E  A +    D + VY   F  + +SL ++ A  K      +
Sbjct  334  SIPSVVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSL-YEHAHEKPTTAMKL  392

Query  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            +     +++VG H +G  A E+ Q  G+AIK+ A  +D  + + IHPT AE   TL
Sbjct  393  ICVGPTEKIVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PYIR_17506
Length=509

 Score = 236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 175/493 (35%), Positives = 245/493 (50%), Gaps = 60/493 (12%)

Query  151  WDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            +D +VIG GSGG+A+S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  210  QSAIMGELLHKDAEAFGWAVP-------NATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
             +A M   LH+DA  +G+          N  F W+KL      YI  LN  Y  +L + K
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKD---VTFRRALIAVGGRPKSLDCPGADLAISS  319
            V        F           A+G+   D   ++ R  LIAVGG+P   D PG +  I S
Sbjct  150  VDLIQGTAAFN----------AQGEVEVDGKVISARNVLIAVGGKPLIPDIPGKEHCIDS  199

Query  320  DDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDT-------DM  371
            D  F     P K  VVGA Y+A+E AG L G G D T+  R   +LR FD        D 
Sbjct  200  DGFFELEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDA  259

Query  372  AARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI----YDTVLNATGRYPD  427
             A+ G  +  ++ +          IE+  +G  K T    +G     +DTV+ A GR P 
Sbjct  260  MAKDGIVVRPQSNV--------ARIEKTLDG--KKTLVLADGSEHAGFDTVIYAAGRIPL  309

Query  428  VSGLNLSAAGVGLNPKTGRIAVTHEQTSTP-HIYAVGDVIDGPELTPVAIQAGRLLSKRL  486
             S LN+SAAG+  + K G I V   QT++  +++AVGDV     LTPVAI AGR LS RL
Sbjct  310  TSNLNISAAGIETD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRL  368

Query  487  FDN-SATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD  545
            F       ++Y+ + T VF+    G  GL+E  A E  G   +  Y   F  + + L ++
Sbjct  369  FGGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNE  428

Query  546  -----RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600
                     K      +V   ++++VVG H +G  A E+ Q  G+A+K+ A+  DF + V
Sbjct  429  LDAEGNTKPKPMTAMKLVCLGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCV  488

Query  601  GIHPTTAEIFTTL  613
             IHPT  E   TL
Sbjct  489  AIHPTAGEELVTL  501

>SPRG_05609
Length=496

 Score = 233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 177/480 (37%), Positives = 249/480 (52%), Gaps = 28/480 (6%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            AT  +D +VIGGGSGG ++++ AA YG KVL+++           G+GGTCVNVGC+PKK
Sbjct  2    ATTVYDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKK  58

Query  207  LMHQSAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            +M  +A+  E+LH  A A+ +     V   +FDW  L      Y+  LN  Y  +L + +
Sbjct  59   IMFNAALHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQ  117

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            +        F D HT+ +            T +  LIAVGG P     PG + AISSD  
Sbjct  118  IPLVYGAAKFVDNHTVEVNG-------DRYTAKHILIAVGGVPAMPPLPGIEHAISSDGF  170

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEE  381
            F+  T P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   + T M E
Sbjct  171  FALETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEM-E  229

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI------YDTVLNATGRYPDVSGLNLSA  435
             A ++F++ +  TSIE+  +G    +   G G+      ++TVL A GR P    L L  
Sbjct  230  HAGVHFVRESGITSIEKAVDGYADDSGD-GGGVPQSFPGFETVLFAIGRTPRTHDLGLET  288

Query  436  AGVGLNPKTGRIAVTHEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSAT-L  493
              + L+          E TS P++YAVGDV   G ELTPVAI AGR L+ RLF N     
Sbjct  289  TDIALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNAC  348

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECY  553
            + Y ++ T VF+    G  GL+E  A+   GA+N+ VY  SF  + +++S      K   
Sbjct  349  INYHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA-  407

Query  554  CKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             KLI    + + VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  408  MKLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PHYKE_10327
Length=1200

 Score = 243 bits (619),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 169/484 (35%), Positives = 246/484 (51%), Gaps = 38/484 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++D +VIG GSGG+A+++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  209  HQSAIMGELLH--------KDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRD  260
              +A +G  LH        +DA + G    +A FDW KL T    Y+  LN  Y  +L +
Sbjct  77   FIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNLAN  136

Query  261  KKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSD  320
             KV+       F D   + +         K+V  +  LIAVGG+P   D PG +L I SD
Sbjct  137  SKVELIRGSAAFNDNGNVVVDG-------KEVRAKNVLIAVGGKPMIPDIPGKELCIDSD  189

Query  321  DIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDTDMAARIGTYM  379
              F     P K  VVGA Y+A+E AG L   G D ++  R   +LR FD  +   +   M
Sbjct  190  GFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM  249

Query  380  EEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG--EGIYDTVLNATGRYPDVSGLNLSAAG  437
            +++  ++  + +    + Q  +G   +    G     YD V+ A GR P  S L L  AG
Sbjct  250  KKDG-VHLQRHSNIARVNQAADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSTLKLDKAG  308

Query  438  VGLNPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDN-SATLMA  495
            +  + K G I V   ++TS   + AVGDV   P LTPVAI AGR LS RLF       ++
Sbjct  309  IATD-KNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMGGAKVS  367

Query  496  YDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD------RALA  549
            Y+ + T VF+    G  GL+E+ A +  G D++ VY   F  + + L ++          
Sbjct  368  YENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDETTGEPKD  427

Query  550  KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEI  609
            K      +V   ++++VVG H +G  A E+ Q  G+A+K+ A+  DF + + IHPT  E 
Sbjct  428  KPKTAMKLVCAGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAIHPTAGEE  487

Query  610  FTTL  613
              TL
Sbjct  488  LVTL  491

>PPTG_18033
Length=500

 Score = 231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 173/493 (35%), Positives = 241/493 (49%), Gaps = 56/493 (11%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++D +VIG GSGG+A+++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  209  HQSAIMGELLHKD-------AEAFGWAVPNAT-FDWTKLITSVQDYIHGLNFKYRVDLRD  260
              +A M   L  D        EA G  +   T FDW KL      Y+  LN  Y  +L +
Sbjct  77   FIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLAN  136

Query  261  KKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSD  320
             KV+       F +   + +         K++  +  LIAVGG+P   D PG +L I SD
Sbjct  137  SKVELIRGSAKFNENGNVEVDG-------KELLAKNVLIAVGGKPLIPDIPGKELCIDSD  189

Query  321  DIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFD-------TDMA  372
              F     P K  VVGA Y+A+E AG L   G D ++  R   +LR FD        D  
Sbjct  190  GFFELEILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAM  249

Query  373  ARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGI--YDTVLNATGRYPDVSG  430
             + G ++   + +          +EQ  +G   V  T G     YD V+ A GR P  S 
Sbjct  250  VKDGVHLRPHSNV--------ARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTSN  301

Query  431  LNLSAAGVGLNPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF--  487
            L L  AGV  + + G I V   ++TS   + AVGDV   P LTPVAI AGR LS RLF  
Sbjct  302  LQLDKAGVTTD-EHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGG  360

Query  488  -DNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-  545
             +NS   ++Y+ + T VF+    G  GL+ED A    G D + VY   F  + + L ++ 
Sbjct  361  LNNSK--VSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEV  418

Query  546  -----RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTV  600
                     K      +V   + ++VVG H +G  A E+ Q  G+A+K+ A+  DF + +
Sbjct  419  DESTGEPKDKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCI  478

Query  601  GIHPTTAEIFTTL  613
             IHPT  E   TL
Sbjct  479  AIHPTAGEELVTL  491

>PHYRA_71927
Length=485

 Score = 230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 173/500 (35%), Positives = 244/500 (49%), Gaps = 52/500 (10%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++D +VIG GSGG+A+++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  209  HQSAIMGELLHKD-------AEAFGWAVPNAT-FDWTKLITSVQDYIHGLNFKYRVDLRD  260
              +A M   L  D        EA G  +   T FDW KL      Y+  LN  Y  +L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  261  KKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSD  320
             KV+  +    F +   + +         K++  +  L+AVGG+P   D PG +L I SD
Sbjct  122  SKVELIHGSAKFNEKGNVEVDG-------KELLAKNVLVAVGGKPLIPDIPGKELCIDSD  174

Query  321  DIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFD-------TDMA  372
              F     P K  VVGA Y+A+E AG L   G D ++  R   +LR FD        D  
Sbjct  175  GFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM  234

Query  373  ARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG--EGIYDTVLNATGRYPDVSG  430
            A+ G ++   + +        T +EQ+ +G   +    G     YD V+ A GR P  S 
Sbjct  235  AKDGVHLRPHSNV--------TRVEQVADGTKTLVLADGSEHSGYDVVIYAAGRVPLTSN  286

Query  431  LNLSAAGVGLNPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDN  489
            L L  A +  + K G I V   ++TS   + AVGDV   P LTPVAI AGR LS RLF  
Sbjct  287  LQLDNADIATD-KHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGG  345

Query  490  SA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRAL  548
                 ++Y+ + T VF+    G  GL+E+ A    G DN  VY   F  + + L ++   
Sbjct  346  MKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDE  405

Query  549  A------KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGI  602
            A      K      +V   + ++VVG H +G  A E+ Q  G+A+K+ A+  DF + + I
Sbjct  406  ATGEPKDKPKTAMKLVCVGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAI  465

Query  603  HPTTAEIFTTLEITKESGLD  622
            HPT  E   TL     SG D
Sbjct  466  HPTAGEELVTLAPWGLSGRD  485

>H310_14447
Length=501

 Score = 226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 155/459 (34%), Positives = 229/459 (50%), Gaps = 23/459 (5%)

Query  166  SKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAF  225
            +  A +YG KVLV++  + +      G+GGTCVNVGC+PKK+M+ + +  E+LH   +  
Sbjct  24   ASRAVEYGAKVLVIERGRVN---GGAGMGGTCVNVGCVPKKIMYNAGVHAEILHSAKDYS  80

Query  226  GWAVPNA---TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTN  282
               V N    +FDW  +      Y++ L+  Y   L ++ + +      F D HT+ +  
Sbjct  81   FKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHVIGAAVFVDDHTVEVNG  140

Query  283  PAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVAL  342
                 P         LIAVGG P+  + PG + A+SSD  F  PT P K  VVGA Y+A+
Sbjct  141  QRYTAP-------HILIAVGGMPQMPNIPGIEHAVSSDGFFDLPTQPKKVAVVGAGYIAV  193

Query  343  ECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPN  401
            E AG       D  V  R + +LR FD  +   +   M  +A + F+  A   SI +  +
Sbjct  194  ELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGVAFVTHAHLESIRKEAD  252

Query  402  GQLKVTHTFGEGI-----YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTST  456
            G L V    GE       +D +++A GR P    + L    V L+     +    E T+ 
Sbjct  253  GSLTVVAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVELSDDGFVVVDAQENTTV  312

Query  457  PHIYAVGDV-IDGPELTPVAIQAGRLLSKRLF-DNSATLMAYDKVCTAVFTPIEYGCCGL  514
              +YA+GDV   G ELTPVAI AGR L+ RLF   +   + Y ++ T VF+    G  GL
Sbjct  313  DGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYHQIPTVVFSHPPIGTIGL  372

Query  515  SEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGP  574
            +E  A+   G DN+ VY  +F+ + ++L+   A   +   KL+    + + V+G H  G 
Sbjct  373  TEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTAMKLVCIGVE-ETVIGAHVAGL  431

Query  575  NAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             A E+ Q  G+AIKL A   DF + V IHPT AE   T+
Sbjct  432  GADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>CCI11048
Length=496

 Score = 223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 228/466 (49%), Gaps = 31/466 (7%)

Query  167  KEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHK------  220
            + AA YG KVL+++  +   +    G GGTCVN GC+PKK+M+ +A   E + +      
Sbjct  22   RRAATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  221  ----DAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAH  276
                  E    +     FDW ++ T    YI  LN  Y  +L + K+       T K   
Sbjct  79   RPFTSKECASHSFSFGDFDWGRMKTKRDAYIERLNGIYTRNLANAKID------TVKGIA  132

Query  277  TLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVG  336
             L   +  +         +  LIAVGG P     PG + AI SD  F   T P K  VVG
Sbjct  133  KLIAKDRVQVNQDSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  337  ASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTS  395
            A Y+A+E AG       D  V  R   +LR FD  +   +   ME++  +NF++ +    
Sbjct  193  AGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKDG-VNFVRKSHLEK  251

Query  396  IEQLPNGQLKVTHTFGE-----GIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-  449
            I +  + +L +T   GE       +D ++ A GR P   GL L   GV LN +TG I V 
Sbjct  252  ITKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALN-ETGHIIVD  310

Query  450  THEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFTPI  507
              E TS P +YA+GDV   G ELTPVAI AGR L+ RLF+N     + Y ++ T VF+  
Sbjct  311  AQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHP  370

Query  508  EYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVV  567
              G  G +E  A+   G +N+  Y   F  L +S++ D    K+   KL+   ++ + VV
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTAMKLVCVGSK-ETVV  429

Query  568  GFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            G H  G  A E+ Q  G+A+K+ A+  DF + V IHPT +E   T+
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYCA_504517
Length=493

 Score = 222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 170/479 (35%), Positives = 239/479 (50%), Gaps = 33/479 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A   E L+++ +   +++  A        FDW  +      YI  LN  Y  +L +  V
Sbjct  64   TAAHVEHLNRNKD---YSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   +        + + +       K  T +  L+A GG P   D PG +  I SD  F
Sbjct  121  DHVQGIAKLVAKDKIQVGD-------KVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   ME+ 
Sbjct  174  KLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEMEK-  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAAG  437
            A + F++      +E+  NG+L    T  GE      +DT+L A GR P    L L   G
Sbjct  233  AGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVG  292

Query  438  VGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLM  494
            V L+ + G I V   E TS P +YA+GD  + G ELTPVAI AGR LS RLF       +
Sbjct  293  VKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T +F+    G  G +E  AVE  G +N+ VY   F  L  S++      K    
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAMK  411

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
              +V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  412  --LVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PPTG_09787
Length=493

 Score = 219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 167/479 (35%), Positives = 240/479 (50%), Gaps = 33/479 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA +G KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A   E L+++ +   +++  A+       FDW  + T    YI  LN  Y  +L + KV
Sbjct  64   TAAHVEHLNRNKD---YSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   +        + +            T +  L+A GG P   D PG +  I SD  F
Sbjct  121  DHVQGIAKLVAKDKIEVAGQV-------YTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   ME+ 
Sbjct  174  KLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEMEK-  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTF-GE----GIYDTVLNATGRYPDVSGLNLSAAG  437
            A + F++ +    +E+  NG+L    T  GE      +DT++ A GR P    L L   G
Sbjct  233  AGVKFVRNSRAVRVEKQENGKLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEIG  292

Query  438  VGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLM  494
            V L+ + G I V   E TS P +YA+GD  + G ELTPVAI AGR LS RLF       +
Sbjct  293  VKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T +F+    G  G +E  A+   G +N+ VY   F  L  S++      K    
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAMK  411

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
              +V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  412  --LVTVGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>HYAP_08763
Length=473

 Score = 219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 157/462 (34%), Positives = 230/462 (50%), Gaps = 25/462 (5%)

Query  163  LAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLH--K  220
            +A+++ AA YG KVLV++  +   Q    GLGGTCVN GC+PKK+M  +A   E L+  K
Sbjct  1    MASARRAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAK  57

Query  221  DAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTL  280
            D            FDW+K+ T    YI+ L   Y+ +L + +V +   +  F   + + +
Sbjct  58   DYSIHTAEFAFGDFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNKVQV  117

Query  281  TNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYV  340
             +       +  T +  LIA GG P   D PG +  I SDD F     P K  VVGA Y+
Sbjct  118  AD-------RVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQPQKVAVVGAGYI  170

Query  341  ALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQL  399
            A+E AG       D T+  R   +LR F+  +   +   M E+A + F++      +E+ 
Sbjct  171  AVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEM-EKAGVTFVRNMSAVGVEKQ  229

Query  400  PNGQLKV---THTFGEGI--YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-THEQ  453
             +G+L +    H   +    +DT+L A GR P    L L   GV L  + G I V   E 
Sbjct  230  LDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVDAQEN  288

Query  454  TSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFTPIEYGC  511
            TS P +YA+GD  + G ELTPVAI AGR L+ RLF       + Y ++ + +F+    G 
Sbjct  289  TSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPIGT  348

Query  512  CGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHY  571
             G +E  AV   G +N+ VY   F  L  S++      K     + V   + + VVG H 
Sbjct  349  IGYTEPEAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVG--EQETVVGVHV  406

Query  572  LGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             G  A E+ Q  G+A+K+NA+  DF + V IHPT +E   T+
Sbjct  407  AGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>H257_09722
Length=518

 Score = 219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 170/487 (35%), Positives = 243/487 (50%), Gaps = 37/487 (8%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            +T  +D +V+GGGSGG+++++ AA YG  VLV++  +   QG   GLGGTCVNVGC+PKK
Sbjct  24   STTSYDYIVLGGGSGGISSARRAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKK  80

Query  207  LMHQSAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            +M+ +A   E+LH  A+A+ +     V   +FDW  + T    Y+  L+  Y  +L    
Sbjct  81   VMYNAAFHAEILH-SAKAYAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDN  139

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            +   +   +F D HT+ +       P         L+AVGG P+    PG + AISSD  
Sbjct  140  ITLVSGRASFVDNHTIAVDGATFTAP-------HILVAVGGVPQLPSIPGIEHAISSDGF  192

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRS-ILLRGFDTDMAARIGTYMEE  381
            F   T P K  V+GA Y+A+E AG       +  V  R   +LR FD  +   +   M  
Sbjct  193  FGLETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMRR  252

Query  382  EAKINFIKGAVPTSIEQLPNGQLKV------------THTFGEGIYDTVLNATGRYPDVS  429
               + F+  +   SI + P+G L +            TH    G +D ++ A GR P  S
Sbjct  253  SG-VQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRG-FDAIVMAVGRTPRTS  310

Query  430  GLNLSAAGVGLNPKTGRIAVT-HEQTSTPHIYAVGDVID-GPELTPVAIQAGRLLSKRLF  487
            G  +    +  N K G I V   E TS P +YA+GDV + G ELTPVAI AGR L+ RLF
Sbjct  311  GF-MEHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLF  368

Query  488  DNSA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDR  546
                   + Y ++ T VF+    G  G +E  AV   G  N+ VY  SF  L +S+    
Sbjct  369  GGEPDACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPE  428

Query  547  ALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTT  606
               K     + V + +   VVG H  G  A E+ Q  G+A+K+ A   D  + V IHPT 
Sbjct  429  NKPKTAMKLICVGKEET--VVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTA  486

Query  607  AEIFTTL  613
            +E F T+
Sbjct  487  SEEFVTM  493

>PITG_14083
Length=493

 Score = 218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 167/479 (35%), Positives = 238/479 (50%), Gaps = 33/479 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A   E L+++ +   +++  A+       FDW  + T    YI  LN  Y  +L + KV
Sbjct  64   AAAHVEHLNRNKD---YSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   +        + +            T +  L+A GG P   D PG +  I SD  F
Sbjct  121  DHVQGIAKLVAKDKIEVAGQV-------YTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   M E+
Sbjct  174  KLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEM-EK  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAAG  437
            A +NF++ +    +E+  NG+L    T  GE      +D+++ A GR P    L L   G
Sbjct  233  AGVNFVRNSRAVRVEKQDNGKLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVG  292

Query  438  VGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLM  494
            V L  + G I V   E TS   +YA+GD  + G ELTPVAI AGR LS RLF       +
Sbjct  293  VKL-AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T +F+    G  G +E  A+   G +N+ VY   F  L  S++      K    
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMK  411

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
              +V     + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  412  --LVTVGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PHYSO_550665
Length=491

 Score = 218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 168/481 (35%), Positives = 236/481 (49%), Gaps = 37/481 (8%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D VVIGGGSGG+A+++ AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A   E L ++ +   +++  A        FDW  + T    YI  LN  Y  +L + +V
Sbjct  64   AAAHVEHLARNKD---YSINTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   +        + +         K  T +  L+A GG P   D PG +  I SD  F
Sbjct  121  DHVQGIAKLVAKDKVEVAG-------KVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   ME+ 
Sbjct  174  KLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEMEK-  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVT-------HTFGEGIYDTVLNATGRYPDVSGLNLSA  435
            A + F++      +E+  +G+L          H F +  +D +L A GR P    L L  
Sbjct  233  AGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPD--FDAILYAVGREPRTKDLGLEE  290

Query  436  AGVGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-T  492
             GV L+ + G I V   E TS P +YA+GD  I G ELTPVAI AGR LS RLF      
Sbjct  291  VGVKLS-EGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDA  349

Query  493  LMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKEC  552
             + Y ++ T +F+    G  G +E  AV   G +N+  Y   F  L  S++      K  
Sbjct  350  CLNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTA  409

Query  553  YCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTT  612
                +V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T
Sbjct  410  MK--LVTVGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  613  L  613
            +
Sbjct  468  M  468

>PHYRA_72037
Length=493

 Score = 217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 170/479 (35%), Positives = 235/479 (49%), Gaps = 33/479 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D VVIGGGSGG+A+++ AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A   E LH++ +   +++  AT       FDW  +      YI  LN  Y  +L + KV
Sbjct  64   AAAHVEHLHRNED---YSIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   + T      + +         K  T +  L+A GG P   D PG +    SD  F
Sbjct  121  DHVQGIATLVAKDQVEVAG-------KVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   ME+ 
Sbjct  174  RLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEMEK-  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAAG  437
            A + F++      +++  +G+L    T  GE      +D +L A GR P    L L   G
Sbjct  233  AGVKFVRNTRAVRVDKQDDGKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVG  292

Query  438  VGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLM  494
            V L    G I V   E TS P +YA+GD    G ELTPVAI AGR LS RLF       +
Sbjct  293  VKL-ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T +F+    G  G +E  AV   G +N+ VY   F  L  S++      K    
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMK  411

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             + V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  412  LVTV--GEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PYAP_23435
Length=951

 Score = 225 bits (574),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 173/477 (36%), Positives = 241/477 (51%), Gaps = 29/477 (6%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D VVIGGGSGG+A+++ AA YG KVL+++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  211  SAIMGELLHKDAEAFGWAVPNA----TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
            +A   E L ++ +      P A     FDW  + T    YI  LN  Y  ++ +  +   
Sbjct  528  AAAHVEHLARNGDYSINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGIDLV  587

Query  267  NFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRP  326
              + T   ++ + +         K  T +  L+AVGG P     PG + AI SD  F   
Sbjct  588  QGVATLVSSNQIEVDG-------KVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKLE  640

Query  327  TPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKI  385
            + P K  VVGA Y+A+E AG       +  +  R   +LR FD  +   +   ME+   +
Sbjct  641  SQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEMEKHG-V  699

Query  386  NFIKGAVPTSIEQLPNGQLKVTHTFGEGI------YDTVLNATGRYPDVSGLNLSAAGVG  439
            NF++ +    IE+  +G+L + H   +G       +D VL A GR P   GL L  AGV 
Sbjct  700  NFVRRSRIEKIEKQADGKLTI-HAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGVK  758

Query  440  LNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLMAY  496
            LN   G I V   E TS P +YA+GD    G ELTPVAI AGR L+ RLF N     + Y
Sbjct  759  LN-DGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLHY  817

Query  497  DKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKL  556
             ++ T VF+    G  G +E  AV   GAD + VY   F  L  S++      K     +
Sbjct  818  HQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMADPENKGKTAMKLV  877

Query  557  IVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             V    ++ VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE F T+
Sbjct  878  CVG--DDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>H257_17037
Length=498

 Score = 214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 223/459 (49%), Gaps = 23/459 (5%)

Query  166  SKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAF  225
            +  A +YG KVLV++  + +      G+GGTCVNVGC+PKK+M+ +    E+LH   +  
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILHSAKDYS  79

Query  226  GWAVPNA---TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTN  282
               V N    +FDW  +      Y++ L   Y   L ++ + +     TF D HT+ +  
Sbjct  80   FKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEVNG  139

Query  283  PAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVAL  342
                 P         LIAVGG P+    PG + AISSD  F  PT P K  VVGA Y+A+
Sbjct  140  LRFTAP-------HILIAVGGVPQLPTIPGIEHAISSDGFFDLPTQPKKVAVVGAGYIAV  192

Query  343  ECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPN  401
            E AG       D  V  R   +LR FD  +   +   M +   + F+  +   SI +  +
Sbjct  193  ELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEMAKSG-VTFVTQSHLQSIRKEAD  251

Query  402  GQLKVTHTFGE-----GIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTST  456
            G L +  T  +       ++ +++A GR P    + L    V L+     +    E T+ 
Sbjct  252  GTLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTTV  311

Query  457  PHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSAT-LMAYDKVCTAVFTPIEYGCCGL  514
            P +YA+GD  I G ELTPVAI AGR L+ RLF + A   + Y ++ T +F+    G  GL
Sbjct  312  PGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIGL  371

Query  515  SEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGP  574
            +E  A+   G  N+  Y  SF+ L +SL        +   KL+    + + VVG H  G 
Sbjct  372  TEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVE-ETVVGAHVAGL  430

Query  575  NAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             A E+ Q  G+AIK+ A   DF + V IHPT +E   T+
Sbjct  431  GADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PITG_13427
Length=463

 Score = 213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 165/473 (35%), Positives = 233/473 (49%), Gaps = 41/473 (9%)

Query  163  LAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKD  221
            +A+++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM  +A M   L  D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  222  A-------EAFGWAVPNAT-FDWTKLITSVQDYIHGLNFKY-RVDLRDKKVKYENFLGTF  272
                    EA G  +   T FDW KL      Y+  LN  Y R +L + KV+    L TF
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  273  KDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKT  332
             +   + +         K++  +  LIAVGG+P   D PG +L I SD  F   T P K 
Sbjct  112  NEKGNVEVGG-------KELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETLPKKV  164

Query  333  LVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDTDMAARIGTYMEEEAKINFIKGA  391
             VVGA Y+A+E AG L   G D ++  R   +LR FD  +   +   M +E  ++    +
Sbjct  165  AVVGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAMAKEG-VHLRPHS  223

Query  392  VPTSIEQLPNGQLKVTHTFGEGI--YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV  449
                +E   +G   +  T G     YD V+ A GR P  S L L  AG+  + + G I V
Sbjct  224  NVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGFIPV  282

Query  450  TH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFD--NSATLMAYDKVCTAVFTP  506
               ++TS   + AVGDV   P LTPVAI AGR LS RLF   N A + +Y+ + T VF+ 
Sbjct  283  NELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKV-SYENIPTVVFSH  341

Query  507  IEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD------RALAKECYCKLIVDR  560
               G  GL+E+ A    G D + VY   F  + + L ++          K      +V  
Sbjct  342  PPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVCA  401

Query  561  TQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             + ++VVG H +G  A E+ Q  G+A+K+ A+  DF + + IHPT  E   TL
Sbjct  402  GKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTL  454

>PHALS_09136
Length=493

 Score = 211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 235/480 (49%), Gaps = 35/480 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA  G KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SAIMGELLHKD--------AEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            +A+  E L+++        A+ F +      FDW  + T    YI  LN  Y  +L + +
Sbjct  64   TAVHVEHLNRNKDYSINTCAKDFEFG----DFDWANMKTKRDAYIQRLNGIYERNLSNAQ  119

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            V     +        + +            T +  L+A GG P   D PG +  I SD  
Sbjct  120  VDVIQGIAKIVAKDKIQVAGHI-------YTGKHVLVAPGGVPNIPDIPGKEHVIDSDGF  172

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEE  381
            F     P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   M E
Sbjct  173  FKLEQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEM-E  231

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTF-GEGI----YDTVLNATGRYPDVSGLNLSAA  436
            +A + F++    T IE+  + +L    T  GE      +DT+L A GR P    L L   
Sbjct  232  KAGVEFVRNMSATRIEKSNDDKLTFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEI  291

Query  437  GVGLNPKTGRIAV-THEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSA-TL  493
            GV L    G I V   E T+ P +YA+GDV + G ELTPVAI AGR L+ RLF       
Sbjct  292  GVKL-ADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDAC  350

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECY  553
            + Y ++ T +F+    G  G +E  A+   G +N+ +Y   F  L  +++      K   
Sbjct  351  LNYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAM  410

Query  554  CKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
               +V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT +E   T+
Sbjct  411  K--LVTVGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>CCA23647
Length=496

 Score = 210 bits (535),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 159/468 (34%), Positives = 231/468 (49%), Gaps = 35/468 (7%)

Query  167  KEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHK--DAEA  224
            + AA YG KVL+++  +   +    G GGTCVN GC+PKK+M+ +A   E + +  D   
Sbjct  22   RRAATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  225  FGWAVPNAT--------FDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAH  276
              +A    T        FDW ++      YI  LN  Y  +L + K+  +   G  K   
Sbjct  79   RPFASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKI--DTVTGIAK---  133

Query  277  TLTLTNPAKGKPPKDVTF--RRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLV  334
               L    + +  +D  F  +  LIAVGG P     PG + AI SD  F   T P K  V
Sbjct  134  ---LIAKDRVQVNQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLETQPKKVAV  190

Query  335  VGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVP  393
            VGA Y+A+E AG       D  +  R   +LR FD  +   +   ME+   +NF++ +  
Sbjct  191  VGAGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEMEKNG-VNFVRKSHL  249

Query  394  TSIEQLPNGQLKVTHTFGE-----GIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIA  448
              I +  + +L +T   G+       +D ++ A GR P    L L   GV LN +TG I 
Sbjct  250  EKIVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELN-ETGHII  308

Query  449  V-THEQTSTPHIYAVGDV-IDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFT  505
            V   E TS P +YA+GDV   G ELTPVAI AGR L+ RLF+N     + Y ++ T VF+
Sbjct  309  VDAQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFS  368

Query  506  PIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDR  565
                G  G +E  A+   G +N+  Y   F  L +S++ D    K+   KL+   ++ + 
Sbjct  369  HPPLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVCVGSK-ET  427

Query  566  VVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            VVG H  G  A E+ Q  G+A+K+ A+  DF + V IHPT +E   T+
Sbjct  428  VVGLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYCA_7619
Length=462

 Score = 206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 154/471 (33%), Positives = 224/471 (48%), Gaps = 38/471 (8%)

Query  163  LAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKD  221
            +A+++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM  +A M   LH D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  222  AEAFGWAVP--------NATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFK  273
               +G+              FDW KL      Y+  LN  Y  +L + KV        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  274  DAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTL  333
                + +         K++     +IAVGG+P   D PG +L I SD  F   T P K  
Sbjct  112  QNGNVEVDG-------KEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETLPKKVA  164

Query  334  VVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFDTDMAARIGTYMEEEAKINFIKGAV  392
            VVGA Y+A+E AG L   G + ++  R   +LR FD  +   +   ME++  ++    + 
Sbjct  165  VVGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKDG-VHLCPHSN  223

Query  393  PTSIEQLPNGQLKVTHTFG--EGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-  449
               +EQ  +    +    G     Y+ V+ A GR P  + L L  AGV  +   G I V 
Sbjct  224  VVRVEQAADNTRTLVLADGSEHSGYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQVD  282

Query  450  THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFTPIE  508
             ++QTS  +++AVGD    P LTPVAI AGR LS RLF       ++Y+ + T VF+   
Sbjct  283  EYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHPP  342

Query  509  YGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD------RALAKECYCKLIVDRTQ  562
             G  GL+E  A    G D + VY   F  + + L ++          K      +V   +
Sbjct  343  IGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVCAGK  402

Query  563  NDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            +++VVG H +G  A E+ Q  G+A+K+ A+  DF   + IHPT  E   TL
Sbjct  403  DEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>H310_11259
Length=519

 Score = 204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 165/485 (34%), Positives = 242/485 (50%), Gaps = 33/485 (7%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            +T  +D +V+GGGSGG+A+++ AA YG KVLV   V+        GLGGTCVNVGC+PKK
Sbjct  25   STTSYDYIVLGGGSGGIASARRAASYGAKVLV---VERGRTLGGAGLGGTCVNVGCVPKK  81

Query  207  LMHQSAIMGELLHKDAEAFGW----AVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            +M+ +A + E++H  A+ + +     V   +FDW  + +    Y+  L+  Y  +L    
Sbjct  82   VMYNAAFLAEIMHS-AKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDG  140

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDI  322
            +   + +  F D HT+ + + AK   P        L+AVGG P+    PG +LAISSD  
Sbjct  141  ISLVSGVAAFVDNHTIAV-DGAKFTAP------HILVAVGGTPQLPSIPGIELAISSDGF  193

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEE  381
            F+  T P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   M  
Sbjct  194  FALETQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEM-R  252

Query  382  EAKINFIKGAVPTSIEQLPNGQLKVTHTFGE----------GIYDTVLNATGRYPDVSGL  431
             A + F+  +   SI +  NG L +  T  +            YD V+ A GR P  +  
Sbjct  253  RAGVAFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDC  312

Query  432  NLSAAGVGLNPKTGRIAVT-HEQTSTPHIYAVGDVI-DGPELTPVAIQAGRLLSKRLFDN  489
                  +  + K G I V   E T+ P +YA+GD    G ELTPVAI AGR L+ RLF  
Sbjct  313  GFDRTDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGG  371

Query  490  SA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRAL  548
                 + Y ++ T VF+    G  G +E  A+   G  N+ VY  SF  L ++L   + +
Sbjct  372  EPDACINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDM  431

Query  549  AKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
                   + V + +   VVG H  G  A E+ Q  G+A+K+ A   D  + + IHPT +E
Sbjct  432  PSTAMKVVCVGKEET--VVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASE  489

Query  609  IFTTL  613
               T+
Sbjct  490  ELVTM  494

>PHYKE_6836
Length=493

 Score = 202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 167/479 (35%), Positives = 239/479 (50%), Gaps = 33/479 (7%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D VVIGGGSGG+A+++ AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFN  63

Query  211  SAIMGELLHKDAEAFGWAVPNAT-------FDWTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +A+  E L ++ +   +++  A        FDW+ + T    YI  LN  Y  +L++++V
Sbjct  64   TAMHVEHLARNRD---YSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQV  120

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIF  323
             +   +        + +            T +  L+A GG P   D PG +  I SD  F
Sbjct  121  DHVQGIAKIVAKDKIQVDGQV-------FTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFF  173

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEE  382
                 P K  VVGA Y+A+E AG       D T+  R   +LR FD  +   +   ME+ 
Sbjct  174  KLEQQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEMEK-  232

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFG---EGI--YDTVLNATGRYPDVSGLNLSAAG  437
            A + F++ +    +E+  +G+L    T     E    +DT+L A GR P    L L    
Sbjct  233  AGVKFVRNSRAVRVEKQTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEIN  292

Query  438  VGLNPKTGRIAV-THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSA-TLM  494
            V L+ + G I V   E TS   +YA+GD    G ELTPVAI AGR LS RLF       +
Sbjct  293  VKLS-QDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYC  554
             Y ++ T +F+    G CG +E  AVE  G +N+  Y   F  L  S++      K    
Sbjct  352  NYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMK  411

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
              +V   + + VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  412  --LVCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>PYVX_21517
Length=482

 Score = 197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 164/513 (32%), Positives = 232/513 (45%), Gaps = 98/513 (19%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++DL+VIG GSGG+AAS+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  209  HQSAIMGELLHKDAEAFGW---AVPNAT------FDWTKLITSVQDYIHGLNFKYRVDLR  259
            +  A +   LH+DA  +G+   A P  +      FDW KL      Y+  LN  Y  +L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  260  DKKVKYENFLGTFKDAHTLTLTNPAKGKPPKD---VTFRRALIAVGGRPKSLDCP----G  312
            + KV+       F             GK   D   V  ++ L+AVGG+P   D P    G
Sbjct  138  NSKVELLTGTARFN----------VDGKIEVDGVEVRAKKVLLAVGGKPLIPDIPVAATG  187

Query  313  ADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI-LLRGFD---  368
             +L I SD  F     P K  VVGA Y+A+E AG L   G D T+  R   +LR FD   
Sbjct  188  KELCIDSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWN  247

Query  369  -----------------TDMAARIGTYMEEEAKINFIKGAVP-TSIEQLPNGQLKVTHTF  410
                              D  A+ G  +   + I  ++ A   T    L +G    THT 
Sbjct  248  SQFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADGS---THTG  304

Query  411  GEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGP  469
                +++V+ A GR P    L L  AGV  + + G I V  ++QT+ P I AVGD     
Sbjct  305  ----FESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTI  359

Query  470  ELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLG  529
             LTP+                    +Y+ V T VF+    G  GL+E  A    G + + 
Sbjct  360  ALTPI--------------------SYENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIK  399

Query  530  VYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKL  589
            +Y  +F  + +       +  E  C        ++++VG H +G  A E+ Q  G+A+K+
Sbjct  400  IYKSTFVNMYY------GVVNELVCA-----GPDEKIVGLHVIGMGADEMLQGFGVAVKM  448

Query  590  NASYEDFVSTVGIHPTTAEIFTTLEITKESGLD  622
             A+  D  S V IHPT AE   T+     SG D
Sbjct  449  GATKADLDSCVAIHPTGAEELVTMAPWGLSGAD  481

>HYAP_04843
Length=430

 Score = 185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/396 (35%), Positives = 199/396 (50%), Gaps = 30/396 (8%)

Query  234  FDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVT  293
            FDWTKL T    Y+  LN  Y  +L   KV++      F     + +         K+V 
Sbjct  29   FDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGSARFNKQGNVEVDG-------KEVL  81

Query  294  FRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGF  353
             +  +IAVGG+P   D PG +L I SD  F   T P K  V+GA Y+A+E AG L   G 
Sbjct  82   AKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTLPKKVAVIGAGYIAVELAGVLNALGS  141

Query  354  DVTVMVRSI-LLRGFDTDMAARIGTYMEEEAKINFIKGAVPTS----IEQLPNGQLKVTH  408
            + ++  R   +LR FD D+   + T +E+   I+ +    P S    +EQ  +G   +  
Sbjct  142  ETSIFCRKEGVLRTFD-DI---VRTTLEDAMAIDGLH-LRPNSNVARVEQAADGTNTLVL  196

Query  409  TFGEGI--YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTH-EQTSTPHIYAVGDV  465
            T G     +D V+ A GR P    L+L  AGV  N K G I V   ++TS   ++AVGDV
Sbjct  197  TDGSAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYIVVNEFQETSNSKVFAVGDV  255

Query  466  IDGPELTPVAIQAGRLLSKRLFDNSA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIG  524
               P LTPVA+ AGR LS RLF N     ++Y+ + T VF+    G  GL+E  A    G
Sbjct  256  CGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQAQGKYG  315

Query  525  ADNLGVYHQSFTPLEWSLSH--DRALAK-----ECYCKLIVDRTQNDRVVGFHYLGPNAG  577
             D++ VY   F  + + L +  D A  +     +   KL+    + ++VVG H +G  A 
Sbjct  316  DDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVC-AGKKEKVVGLHMIGMAAD  374

Query  578  EVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            E+ Q  G+A+K+ A+  DF + + IHPT +E   TL
Sbjct  375  EILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYAR_17714
Length=444

 Score = 182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 153/477 (32%), Positives = 226/477 (47%), Gaps = 72/477 (15%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA +G KVL+++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  211  SAIMGELLHKDAE---AFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYEN  267
            +A   E L ++A+     G       FDW  +      YI  LN  Y  ++ + K+    
Sbjct  64   AASHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDLIE  123

Query  268  FLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPT  327
             + +      +T+         K +     L+AVGG P     PG + AI SDD F   T
Sbjct  124  GIASLTAKDAVTVDGKTXXXXGKHI-----LVAVGGVPAMPQIPGIEHAIDSDDFFKLKT  178

Query  328  PPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKIN  386
             P K  VVGA Y+A+E AG       +  +  R   +LR FD  +   +   M++   ++
Sbjct  179  QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMDKHG-VH  237

Query  387  FIKGAVPTSIEQLPNGQLKVTHTFGEGI------YDTVLNATGRYPDVSGLNLSAAGVGL  440
            F++ +   +I + P+G+L V  T  +G+      +D VL A GR P   GL L + GV L
Sbjct  238  FVRRSRIHAIVKQPDGKLSVQATV-DGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKL  296

Query  441  NPKTGRIAVTH-EQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKV  499
            +   G I V   E TS   +YA+GD                          AT   Y+  
Sbjct  297  S-DAGFIEVDKFENTSVDGVYAIGD--------------------------ATTTGYE--  327

Query  500  CTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLS---HDRALAKECYCKL  556
                 TP E          AVE  GAD++ VY  +F  L ++++   H    A +  C  
Sbjct  328  ----LTPPE----------AVEKFGADHVKVYTSTFVNLLYAMADPDHKSKTAMKLVC--  371

Query  557  IVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
                 +N++VVG H  G  A E+ Q  G+AIK+NA+  DF + V IHPT AE   T+
Sbjct  372  ---VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYIR_23431
Length=468

 Score = 178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 148/465 (32%), Positives = 210/465 (45%), Gaps = 62/465 (13%)

Query  167  KEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAE---  223
            + AA YG KVLV   V+   +    GLGGTCVN GC+PKK+M  ++   E L+++A+   
Sbjct  23   RRAATYGAKVLV---VERGRKYDGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  79

Query  224  --------AFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDA  275
                     FG       FDW  + T    YI  LN  Y  +L +  V     +      
Sbjct  80   TTNGSKKFEFG------DFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAK  133

Query  276  HTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVV  335
            + + +            T +  L+AVGG+P   + PG +  I SD  F     P K  VV
Sbjct  134  NQIEVNGVV-------YTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEAQPKKVAVV  186

Query  336  GASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPT  394
            GA Y+A+E AG       D ++  R   +LR FD  +   I     E+A INF++ +   
Sbjct  187  GAGYIAIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINE-ESEKAGINFVRNSRIE  245

Query  395  SIEQLPNGQLKVTHTF-GE----GIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV  449
             I++  +G L +T    GE      +DT+L A GR P    L L   GV L      +  
Sbjct  246  RIDKQADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVD  305

Query  450  THEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIE  508
              E TS P IYA+GD  I G ELTP+                          T VF+   
Sbjct  306  AQENTSVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPP  340

Query  509  YGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVG  568
             G  G +E  A+E  GA+N+ VY   F  L ++++      K      +V   +++ VVG
Sbjct  341  LGTIGYTEPQAIEKFGAENVKVYTSKFVNLLYAMADPDHKGKTAMK--LVTVGEDEVVVG  398

Query  569  FHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
             H  G  A E+ Q  G+A+K+NA+  DF + V IHPT AE   T+
Sbjct  399  VHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>PYVX_16175
Length=446

 Score = 154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 142/463 (31%), Positives = 205/463 (44%), Gaps = 76/463 (16%)

Query  167  KEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFG  226
            + AA +G KVL+++  + +      GLGGTCVN GC+PKK+M  +A   E L++  +   
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGD---  76

Query  227  WAVPN--------ATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTL  278
            ++V            FDW  + T    YI  LN  Y  +L + K+     +      + L
Sbjct  77   YSVTTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQL  136

Query  279  TLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGAS  338
             +         K  T +  L+A GG P     PG + AI SD  F     P K  VVGA 
Sbjct  137  EVDG-------KVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQQPRKVAVVGAG  189

Query  339  YVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIE  397
            Y+A+E AG       +  +  R   +LR FD  +   +   ME+   + F++ +  T I+
Sbjct  190  YIAVEIAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEMEKNG-VQFVRRSHITRID  248

Query  398  QLPNGQLKVTH-----TFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-TH  451
            +L +G+L++T      T   G +DTVL A GR P  + L L A GV L+ K G I V   
Sbjct  249  KLEDGKLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQ  307

Query  452  EQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYG  510
            E TS   +YA+GD    G ELTP                                     
Sbjct  308  ENTSAAGVYAIGDATTTGWELTP-------------------------------------  330

Query  511  CCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFH  570
                    AV   GA+N+ VY  +F  L  +++      K    KL+    Q + VVG H
Sbjct  331  ------PDAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTA-MKLVTVGAQ-ETVVGVH  382

Query  571  YLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
              G  A E+ Q  G+A+KL A+  DF + V IHPT +E   T+
Sbjct  383  VAGEGADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>CCA22989
Length=494

 Score = 151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 134/479 (28%), Positives = 227/479 (47%), Gaps = 40/479 (8%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            ++ ++DL+VIGGG GG  A+ +AA+ G K + ++        S   LGGTC+NVGCIP K
Sbjct  23   SSTEYDLIVIGGGPGGYVAAIKAAQLGMKTVCIE--------SRGTLGGTCLNVGCIPSK  74

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
             +  S+ M      D +A G    +   ++ K++ + +  +  L        +  KV Y 
Sbjct  75   ALLHSSHMFHTAQHDFKAIGIEASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYI  134

Query  267  NFLGTF--KDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISS  319
               GT   KD  +++ ++ +KGK  + +  +  LIA G       P  +D     +  S+
Sbjct  135  KGHGTIVGKDQVSVSYSDESKGK--ETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDST  192

Query  320  DDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTY  378
              +  + TP  + +VVGA  + LE     +  G +VTV+   + +  G D ++       
Sbjct  193  GALVLKSTPK-EMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKT  251

Query  379  MEEEA-KINFIKGAVPTSIEQLPNGQLKVTHTFGEG------IYDTVLNATGRYPDVSGL  431
            ++++  K  F      T + +    ++ +T    +G        D VL ATGR P    L
Sbjct  252  LQKQGFKFKFATKVTSTKVNE---DRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNL  308

Query  432  NLSAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
             L   G+  + K GRI V  H +T  P+IYA+GDVI GP L   A + G + +  +    
Sbjct  309  GLENLGIQTD-KLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGK  366

Query  491  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK  550
               + Y+ +   ++T  E  C G +E+   E   + N+G +     P+  + S  RA+ +
Sbjct  367  QGHVNYNAIPGVIYTFPEVACVGRTEEQLKEEGVSYNVGKF-----PM-IANSRARAVGE  420

Query  551  -ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
             + + K++  +  NDR++G H +  NAGE+     + I+  AS ED   T   HPT +E
Sbjct  421  TDGFVKVLAQK-DNDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

>CCI10477
Length=494

 Score = 147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 137/477 (29%), Positives = 227/477 (48%), Gaps = 42/477 (9%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LM  208
            ++DLVVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  209  HQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            H S +     H D ++ G  V +   ++ K++ + +  +  L        +  KV Y   
Sbjct  78   HSSHLFHTAQH-DFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKG  136

Query  269  LGTF--KDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSL-DCPGADLA---ISSDDI  322
             G    K+  ++ L++ +KG   + +T +  LIA G     L  CP  +     + S   
Sbjct  137  HGKIVAKNQVSVALSDESKGN--ETITAKNILIATGSEVSPLPPCPVDNEKGKIVDSTGA  194

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEE  381
                + P + +VVGA  + LE     +  G +VTV+   + +  G D ++       +++
Sbjct  195  LVLKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQK  254

Query  382  EA-KINFIKGAVPTSIEQLPNG-QLKVTHTFGEG------IYDTVLNATGRYPDVSGLNL  433
            +  K  F      T +    NG  + +T    +G        D VL ATGR P  +GL L
Sbjct  255  QGLKFKFATRVTSTKV----NGDNVTITMEDAKGGNETSMECDVVLVATGRRPFTNGLGL  310

Query  434  SAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSAT  492
             + G+  + K GRI V  H +T+ P IYA+GDVI GP L   A + G + +  +      
Sbjct  311  ESMGIQTD-KMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKHG  368

Query  493  LMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-E  551
             + Y+ +   ++T  E  C G +E+   E   + N+G +     P+  + S  RA+ + +
Sbjct  369  HVNYNAIPGVIYTHPEVACVGKTEEQLKEEGISYNVGKF-----PM-IANSRARAVGETD  422

Query  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
             + K++  +  NDR++G H +  NAGE+     + ++  A+ ED   T   HPT +E
Sbjct  423  GFVKVLAQK-DNDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

>PYU1_G014259
Length=244

 Score = 134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 113/219 (52%), Gaps = 24/219 (11%)

Query  150  DWDLVVIGGGSGGLAASKEAAKY-GQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLM  208
            ++D +VIG GSGG+A+S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  209  HQSAIMGELLHKDAEAFGWAV-------PNATFDWTKLITSVQDYIHGLNFKYRVDLRDK  261
            + +A M  +LH+DA  +G+          N +F W KL      Y+  LN  Y  +L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  262  KVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDD  321
            KV        F     + +         K+V  +  LIAVGG+P   D PG +  I SD 
Sbjct  145  KVDLLQGTAAFNAQGNVEVDG-------KEVKAKNILIAVGGKPLIPDIPGKEHCIDSDG  197

Query  322  IFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR  360
             F     P K  VVGA Y+A+E AG L G G D T+  R
Sbjct  198  FFELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PYAP_22645
Length=1565

 Score = 143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 139/483 (29%), Positives = 215/483 (45%), Gaps = 46/483 (10%)

Query  147   ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
             A+ ++DLVVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  1096  ASSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSK  1147

Query  207   LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
              +  +  M      D   +G  V +   ++  ++ S +  +  L        +  KV Y 
Sbjct  1148  ALLHATHMYHAAQHDFSKYGIEVSDVKMNFDGMMKSKEKAVKTLTGGIEGLFKKNKVTYV  1207

Query  267   NFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLA----ISSDDI  322
                G    A+ +++     G   + +  +  LIA G     L     D A    + S   
Sbjct  1208  KGFGKIVSANEVSVALNDAGN--ETLKAKNILIATGSEVAPLPPVPVDNAAGKIVDSTGA  1265

Query  323   FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRS-ILLRGFDTDMAARIGTYMEE  381
                   P   +V+G   + LE     K  G  VTV+  +  +  G D ++       +++
Sbjct  1266  LELKKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKLLKK  1325

Query  382   EA-KINFIKGAVPTSIEQLPNGQLKVTHTFGEGI--------YDTVLNATGRYPDVSGLN  432
             +  +  F      + +    NG  KVT T              DTVL ATGR P   GL 
Sbjct  1326  QGLQFEFSTKVTASEV----NGD-KVTLTVEPAAGGASSTIEADTVLVATGRRPFTKGLG  1380

Query  433   LSAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491
             L   G+  + K GRI V  H +T  P+I+A+GDVI GP L   A + G        +N A
Sbjct  1381  LEQMGIQTD-KLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIA----CVENIA  1435

Query  492   TL---MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRAL  548
              L   + YD +   ++T  E    G +E+   E   A N+G +     P+  + S  RA+
Sbjct  1436  GLHGHVNYDAIPGVIYTYPEVASVGKTEEQLKEEGVAYNVGKF-----PM-MANSRARAV  1489

Query  549   AK-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
             A+ + + K+I D+T  DR++G H +  NAGE+     + ++  A+ ED   T   HPT +
Sbjct  1490  AESDGFVKVIADKT-TDRILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLS  1548

Query  608   EIF  610
             E F
Sbjct  1549  EAF  1551

>SPRG_19943
Length=343

 Score = 134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 126/250 (50%), Gaps = 18/250 (7%)

Query  140  ANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVN  199
            AN     ATYD+  +V+G GSGG++++  A  YG KVLV++    +      GLGGTCVN
Sbjct  12   ANYARSMATYDY--IVLGAGSGGVSSAHRAVAYGAKVLVIERGHANDGA---GLGGTCVN  66

Query  200  VGCIPKKLMHQSAIMGELLHKDAEAFGWA----VPNATFDWTKLITSVQDYIHGLNFKYR  255
            VGC+PKK+M  +A+  E+LH  A A+ +     +    FDW  +      Y+  LN  Y 
Sbjct  67   VGCVPKKIMFNAALHAEMLHS-ARAYAFKGVQDIQFGAFDWAAMKAKRDAYVKWLNDMYG  125

Query  256  VDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADL  315
              + + KV        F D HT+ +            T +  LIAVGG P     PG + 
Sbjct  126  EGMLEDKVDLVMGAAKFVDNHTVEVNG-------DRYTAKHILIAVGGVPAMPPLPGIEH  178

Query  316  AISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFDTDMAAR  374
            AISSD  F+  T P K  VVGA Y+A+E AG       D T+  R + +LR FD  +   
Sbjct  179  AISSDGFFALETQPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDL  238

Query  375  IGTYMEEEAK  384
            + + ME   K
Sbjct  239  VNSEMEHAGK  248

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)

Query  564  DRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            + VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  264  ETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  313

>PYIR_20273
Length=505

 Score = 133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 140/491 (29%), Positives = 220/491 (45%), Gaps = 56/491 (11%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+ ++DLVVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  30   ASTEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSK  81

Query  207  -LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
             L+H + +     H D   +G  V   + ++ K++ S +  +  L        +  KV Y
Sbjct  82   ALLHSTHLYHSAQH-DFAKYGIEVSEVSMNFGKMMKSKEKAVKTLTGGIEQLFKKNKVTY  140

Query  266  ENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSD  320
                G     + + +     G   + VT +  LIA G       P  +D     +  S+ 
Sbjct  141  IKGHGKIVAKNEVAVALNDSGN--QTVTAKNILIATGSEVSPLPPVPVDNAAGKIVDSTG  198

Query  321  DIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLR---GFDTDMAARIGT  377
             +  +  P    +VVGA  + LE     K  G  VTV+    L R   G D ++      
Sbjct  199  ALELKKVPE-HLVVVGAGVIGLELGSVYKRLGAKVTVV--EYLDRVCPGLDLELGKEFTK  255

Query  378  YMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY--------------DTVLNATG  423
             ++++  + F      T+ E   NG+ K+T T                    D VL ATG
Sbjct  256  LLKKQG-LGFEFSTKVTASE--VNGE-KITLTXXXXXXXXXXAGGAASTIECDAVLVATG  311

Query  424  RYPDVSGLNLSAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLL  482
            R P  +GL L   G+  + K GRI+V  H +T  P+I+A+GDVI GP L   A + G   
Sbjct  312  RRPYTNGLGLENMGIQTD-KFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIAC  370

Query  483  SKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSL  542
            ++ +      +  Y+ +   ++T  E    G +E+   E     N+G +     P+   L
Sbjct  371  AETIAGKHGHV-NYNAIPGVIYTFPEVASVGKTEEQLKEEGVTYNVGKF-----PM---L  421

Query  543  SHDRALA---KECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVST  599
            ++ RA A    +   K+I D+   D+++G H +  NAGE+     + ++  AS ED   T
Sbjct  422  ANSRARAVGEADGLVKVIADKA-TDKILGVHIIASNAGEMISEGVLGMEYGASSEDIART  480

Query  600  VGIHPTTAEIF  610
               HPT +E F
Sbjct  481  CHAHPTLSEAF  491

>HYAP_12621
Length=501

 Score = 129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 220/478 (46%), Gaps = 41/478 (9%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LM  208
            D+DLVVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  209  HQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            H + ++    H + +++G   PN T ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  269  LGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIF  323
            +G       +++T  A  +    +T +  ++A G       P  +D     + + S    
Sbjct  145  VGKLAAKGQVSVT-LADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGAL  202

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEEE  382
            +    P   +VVGA  + LE     K  G  VTV+        G D          ++++
Sbjct  203  ALTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDKGAVKEFLKLLKKQ  262

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTF----GEGIY---DTVLNATGRYPDVSGLNLSA  435
              + F  G   T+ E   NG +    T     G+G     DTVL ATGR    +GL L  
Sbjct  263  G-LEFQFGTKVTASEV--NGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAGLGLEQ  319

Query  436  AGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLM  494
             G+  + K GRI V H  QT  P ++A+GDVI G  L   A + G    + +      + 
Sbjct  320  MGIQTD-KQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKHGHV-  377

Query  495  AYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-EC  552
             Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A+ + 
Sbjct  378  NYGAIPNVIYTFPEFASVGKTEE-ELKAEGVEYNVGKF-----PM-MANSRARTVAEADG  430

Query  553  YCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
              K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  431  MVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  487

>SDRG_14446
Length=495

 Score = 122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 132/478 (28%), Positives = 213/478 (45%), Gaps = 47/478 (10%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DLVVIG G   +  + E+ K G+ V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  210  QSAI-MGELLHKDAEAFGWAVPNATFD-----WTKLITSVQDYIHGLNFKYRVDLRDKKV  263
            +S + +    H+      +A  N T +        +++   D I       RVDL     
Sbjct  80   ESVLHLSGFRHQGFYGKSYARDNITLNDILGRVNTVVSKEMDVIQAQLKAARVDLVPGLA  139

Query  264  KYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKS---LDCPGADLAISSD  320
            ++EN                  G+P + +  ++ L+A G RP     + C G  + + SD
Sbjct  140  RFEN--------ENEVSVEGDDGQPTR-LRGKKFLVACGTRPAHSPLVPCDG-KVILDSD  189

Query  321  DIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIG  376
             I +  T   P   +VVGA  + +E A  L    G +VTV+  R+ +L   D ++ + + 
Sbjct  190  QILNHGTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLK  249

Query  377  TYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSA  435
              M  +    F+ G    S+E   NG +KV    G+ ++ + +L   GR  +  GLNL A
Sbjct  250  MEMRHKGA-RFLLGESIKSVEHFKNG-VKVEFNSGKAMFAEALLYCVGRQANTDGLNLEA  307

Query  436  AGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF---DNSA  491
             G+  N + G I V  + QTS PHIYA GD I  P L   +++ GRL +  ++   D + 
Sbjct  308  VGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTT  366

Query  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPL-EWSLSHDRALAK  550
            + +        ++T  E    G +E    +  GA N  V    F+ L +  +S D     
Sbjct  367  SQLESGNYPYGIYTIPEISMVGKTEQQLTKE-GA-NYAVGLAKFSELAKGQMSGD----I  420

Query  551  ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
            E   KL+ D   + +++G H +G  A E+     +A+ +N     F   V  +PT AE
Sbjct  421  EGILKLLFDPV-SLQLLGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAE  477

>CCI50816
Length=807

 Score = 122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 127/479 (27%), Positives = 209/479 (44%), Gaps = 37/479 (8%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DL+VIG G      + +AAK G+ V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  211  SAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            + + +    H       +++ N T D   ++  V   I       RV  +  +V Y +  
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKNVTID--DILYRVNRVIQSEVDLLRVQFKSARVDYISGH  139

Query  270  GTFKDAHTLTLTN---PAKGKPPKDVTFRRALIAVGGRP-KSLDCP-GADLAISSDDIFS  324
              F+D H +++     PA  K  K +   + L+A G RP  + + P    +   SD I S
Sbjct  140  ARFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILS  199

Query  325  RPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYME  380
                  P   +VVGA  + +E A  L   +G  VTV+  R  +L   D ++ + +   M 
Sbjct  200  WNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMR  259

Query  381  EEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVG  439
                  F+ G    S+++   G L V    G+ ++ D +L   GR  +  GLNL AAG+ 
Sbjct  260  NHGA-RFLLGETIESVDKSSRGVL-VGLKSGKKVHGDALLYVVGRQANTDGLNLEAAGLS  317

Query  440  LNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF-------DNSA  491
             NP+ G ++V T  QT  PHI+AVGD I  P L   +++ GRL S  ++       D+  
Sbjct  318  RNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSIP  376

Query  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKE  551
            + +        ++T  E    G +E           +GV   S    E +       + +
Sbjct  377  SQLKTGNFPYGIYTIPEISMVGHTEKQLTSQQINYEIGVAKYS----ELAKGQMSGASAD  432

Query  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
               K++ D   + ++ G H +G  A E+     +AI + A+   F   V  +PT AE +
Sbjct  433  GMLKILFD-PHSLKLFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLAEAY  490

>CCA16670
Length=520

 Score = 119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 127/484 (26%), Positives = 214/484 (44%), Gaps = 47/484 (10%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DL+VIG G      + +AAK G+ V ++D  K S       +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKS------SVGGVCVHTGTIPSKTFRE  81

Query  211  SAI-MGELLHKDAEAFGWAVPNATFD-----WTKLITSVQDYIHGLNFKYRVDLRDKKVK  264
            + + +    H       +++ + T D       ++I S  D++       R   +  ++ 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFL-------RTQFKSARID  134

Query  265  YENFLGTFKDAHTLTLTN---PAKGKPPKDVTFRRALIAVGGRP-KSLDCP-GADLAISS  319
            Y +    F+D H +++     PA  K  K +   + L+A G RP  + + P    +   S
Sbjct  135  YISGHARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDS  194

Query  320  DDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARI  375
            D I S      P   +VVGA  + +E A  L   +G  VTV+  R  +L   D ++ + +
Sbjct  195  DQILSWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTL  254

Query  376  GTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLS  434
               M       F+ G +  S+E+   G + V    G+ ++ D +L   GR  +  GLNL 
Sbjct  255  THEMRNHGA-RFLLGEIIESVEKSSRG-VSVGLKSGKKVHGDALLYVVGRQANTDGLNLE  312

Query  435  AAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF------  487
            AAG+  NP+ G ++V T  QT  PHI+AVGD I  P L   +++ GRL S  ++      
Sbjct  313  AAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEAN  371

Query  488  -DNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDR  546
             D+  + +        ++T  E    G +E           +GV   S    E +     
Sbjct  372  DDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSLKMNYEIGVAKYS----ELAKGQMS  427

Query  547  ALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTT  606
              + +   K++ D   + ++ G H +G  A E+     +AI + A+   F   V  +PT 
Sbjct  428  GASADGMLKILFDPI-SLKLYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTL  486

Query  607  AEIF  610
            AE +
Sbjct  487  AEAY  490

>PYVX_21248
Length=502

 Score = 119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 125/438 (29%), Positives = 190/438 (43%), Gaps = 31/438 (7%)

Query  189  STWGLGGTCVNVGCIPKK-LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYI  247
            S   LGGTC+NVGCIP K L+H + +     H D   +G  V     +   ++ + +  +
Sbjct  66   SRGKLGGTCLNVGCIPSKALLHSTHLYHSAQH-DFAKYGVEVEGVKANLGGMMKAKEKAV  124

Query  248  HGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGRPK  306
              L        +  KV Y    G     + + +  N  KG   + VT +  +IA G  P 
Sbjct  125  TTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGN--QTVTAKNIMIATGSEPA  182

Query  307  SLDCPGADLA----ISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSI  362
             L     D +    + S    S P  P   +VVGA  + LE     K  G  VTV+    
Sbjct  183  PLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGSKVTVV--EF  240

Query  363  LLR---GFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY----  415
            L R   G D +++      ++++         V  S  +  N  L V  + G        
Sbjct  241  LDRACPGLDLEVSKEFTKLLKKQGLEFQFSTKVTASEVKGDNVTLTVEPSAGGSAASIEC  300

Query  416  DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPV  474
            DTVL ATGR P   GL L   G+  + K GR+ V +H +T  P+IYA GDVI G  L   
Sbjct  301  DTVLVATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSHFRTQIPNIYAFGDVIKGAMLAHK  359

Query  475  AIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGV-YHQ  533
            A + G +    +       + YD +   ++T  E    G +E+         N GV Y+ 
Sbjct  360  AEEEG-VACAEIISGKHGHVNYDAIPGVIYTTPEVASVGKTEEE------LKNEGVTYNV  412

Query  534  SFTPLEWSLSHDRALAK-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNAS  592
               P+  + S  R +A+ + + K++ D+   DR++G H +  NAGE+     + ++  AS
Sbjct  413  GKFPM-MANSRARTIAEADGFVKILADKA-TDRILGVHIIAGNAGEMVAEGVLGLEYGAS  470

Query  593  YEDFVSTVGIHPTTAEIF  610
             ED   T   HPT +E F
Sbjct  471  SEDIARTCHAHPTLSEAF  488

>PYAR_20075
Length=469

 Score = 116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 136/475 (29%), Positives = 207/475 (44%), Gaps = 63/475 (13%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DLVV+GGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
             S  +      D + +G  V +   D+  ++ S +  +  L        +  KV Y    
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSDVQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVTYIKGF  141

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPP  329
            G                   K V      +A+       D  G +  + S    +    P
Sbjct  142  G-------------------KIVAANEVAVALN------DNNGNETIVDSTGALALKKAP  176

Query  330  GKTLVVGASYVALECAGFLKGQGFDVTVMVRS-ILLRGFDTDMAARIGTYMEEEAKINFI  388
               +V+G   + LE     K  G  VTV+  +  +  G D ++       ++++      
Sbjct  177  EHLVVIGGGVIGLELGSVYKRLGSKVTVVEYADRVCPGLDLELGKEFAKLLKKQGLDLQF  236

Query  389  KGAVPTSIEQLPNGQLKVTHTF-----GEGIY---DTVLNATGRYPDVSGLNLSAAGVGL  440
            K  V  S     NG  KVT T      GE      DTVL ATGR P  +GL L   G+  
Sbjct  237  KTKVTAS---QVNGD-KVTLTVEPAAGGEATTIEADTVLVATGRRPFTNGLGLEQMGIQT  292

Query  441  NPKTGRIAV-THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATL---MAY  496
            + K GRI V  H +T  P IYA+GDVI GP L   A + G        +N A L   + Y
Sbjct  293  D-KMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGI----ACVENIAGLHGHVNY  347

Query  497  DKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-ECYCK  555
            + +   ++T  E    G +E+   E   A N+G +     P+  + S  RA+ + + + K
Sbjct  348  NAIPGVIYTHPEVASVGKTEEQLKEEGIAYNVGKF-----PM-MANSRARAVGEGDGFVK  401

Query  556  LIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            ++ D+T  D+++G H +  NAGE+     + I+  A+ ED   T   HPT +E F
Sbjct  402  VLADKT-TDKILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTLSEAF  455

>PYVX_20512
Length=528

 Score = 115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 123/489 (25%), Positives = 204/489 (42%), Gaps = 46/489 (9%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            D+DLVVIG G      + E+AK G++V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  210  QSAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            ++ + +    H       +++ N T D   ++  VQ  +       +  L+  +V Y   
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKNITID--DILYRVQRVVASEVDVIKAQLKAARVDYIAG  146

Query  269  LGTFKDAHTLTLT--------------NPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD  314
              +F+  H L+++              + A G  P  +   + LIA G RP        D
Sbjct  147  TASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLVPVD  206

Query  315  --LAISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFD  368
              +   SD I S      P   +VVGA  + +E A  +    G  VTV+  R  +L   D
Sbjct  207  GKVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILSFCD  266

Query  369  TDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGE-GIYDTVLNATGRYPD  427
            T++ + +   M  +    F+ G    SIE+   G +KV    G+    D +L   GR   
Sbjct  267  TEIISNLMYEMRSKGA-RFLLGETIKSIEKSERG-VKVFFNSGKVATADALLYTVGRQAS  324

Query  428  VSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF  487
              GLNL A G+  NP+       + QT   HIYA GD I  P L   +++ GRL +  ++
Sbjct  325  TDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAACHMW  384

Query  488  DNSATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGV-YHQSFTPLEWS  541
            D+ A L +  ++        ++T  E    G +E    +      +G+  +      + +
Sbjct  385  DDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQQLTKEGVNYEVGIAKYSELAKGQMT  444

Query  542  LSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVG  601
             +    + K  +C        +  + G H +G  A E+     +AI +  S   F + V 
Sbjct  445  GAIAGGMLKILFCP------DSLELFGVHAIGEGATEIIHIGQVAIAMGCSLTYFRNAVF  498

Query  602  IHPTTAEIF  610
             +PT AE +
Sbjct  499  NYPTLAEAY  507

>PPTG_00938
Length=550

 Score = 114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 137/534 (26%), Positives = 223/534 (42%), Gaps = 65/534 (12%)

Query  124  RTQSAAAPSAPARNVHANDV--DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDY  181
            R  +A +  APA N    D   +  A+  +DL+VIG G  G   + ++AK+G+ V ++D 
Sbjct  19   RAANAFSTEAPAENRPLTDTLRELRASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID-  77

Query  182  VKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLIT  241
                       LGG CV+ G +P K   ++A+        A   G A P+  F    ++ 
Sbjct  78   -------KRDMLGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQ  130

Query  242  SVQ-------DYIHGLNFKYRVDLRDKKVKY----ENFLGTFKDAHTLTLTNPAKGKPPK  290
             V+       D       +  V L +   ++    +N +    +    T T+ AK     
Sbjct  131  RVRKVENAETDITRHQLLRNGVQLINGTARFLPGSKNMVAVLSNESYETATD-AKRHSSA  189

Query  291  DVTFR-----RALIAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVA  341
            D+  R     + L+ VG RP +  D P   +    SD++      + P + ++VGA  V 
Sbjct  190  DICKRVLTADKFLVCVGTRPARRPDIPFDGETIFDSDELLWGKVKSVPRRLIIVGAGVVG  249

Query  342  LECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQL  399
            +E A  +    G DVTV+  R  +L   D  ++  +  Y   +    F+ G    S+E+ 
Sbjct  250  MEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEAL-CYSMTQTGTRFLTGETIKSVEKS  308

Query  400  PNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTST  456
            P G++ V    G+ +  D +L   GR  +V GLNL A  VGL+P K GRI V +  QT+ 
Sbjct  309  PKGEVFVHLESGKTVVGDGLLYTVGRQGNVEGLNLEA--VGLSPDKRGRIKVDNNFQTAV  366

Query  457  PHIYAVGDVIDGPELTPVAIQAGRLLSKRL----------FDNSATLMAYDKVCT-----  501
            PHIYA GD+I  P L   +++ GRL S  +            +   +   D+V T     
Sbjct  367  PHIYAAGDIIGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG  426

Query  502  -----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKL  556
                  ++T  E    G +E    +      +GV           L       K  +C  
Sbjct  427  EVFPFGIYTVPEISMVGKNEQQLTKEQVPYEVGVARYEELARGQMLGGVPGFLKIIFCPD  486

Query  557  IVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             +      ++ G H +G  A E+     + +    + E F + V  +PT AE +
Sbjct  487  TL------KIFGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PYU1_G011605
Length=524

 Score = 112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 124/483 (26%), Positives = 203/483 (42%), Gaps = 39/483 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            D+DLVVIG G      + E+AK G++V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  210  QSAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            ++ + +    H       +++   T D   ++  V+  ++      +  L+  +V+Y   
Sbjct  92   EAVLHLSGYRHHGFYGKSYSMKTVTID--DILYRVKRVVNSEVDVIKAQLKAARVEYIPG  149

Query  269  LGTFKDAHTLTLT-NPAKGKPPK------DVTFRRA---LIAVGGRP-KSLDCP-GADLA  316
               F++ H +++  +P  G+  +       V+  RA   LIA G RP  + + P    + 
Sbjct  150  FARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVI  209

Query  317  ISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVM-VRSILLRGFDTDMA  372
              SD I S      P   +VVGA  + +E A  L    G  VTV+  R  +L   D ++ 
Sbjct  210  FDSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEII  269

Query  373  ARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLN  432
            + + TY        F+ G     +E+  NG     ++      D +L   GR     GLN
Sbjct  270  SNL-TYEMRSKGARFLLGETINRVEKTGNGVTVYLNSGKVTSADAMLYTVGRQASTDGLN  328

Query  433  LSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491
            L A  +  NP+ G + V    QT  PHIYAVGD I  P L   +++ GRL +  ++D   
Sbjct  329  LEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWDQEE  387

Query  492  TLMAYD----KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRA  547
             L+            ++T  E    G +E    +      +G+   S    E +      
Sbjct  388  QLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGVNFEIGIAKYS----ELAKGQMSG  443

Query  548  LAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
                   K++ D T   ++ G H +G  A E+     +AI +  S   F   V  +PT A
Sbjct  444  STAGGMLKILFDPT-TLKLFGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFNYPTLA  502

Query  608  EIF  610
            E +
Sbjct  503  EAY  505

>PHYRA_73883
Length=551

 Score = 111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 132/506 (26%), Positives = 221/506 (44%), Gaps = 57/506 (11%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + ++AK+G+ V ++D            LGG CV+ G +P K
Sbjct  42   ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSK  93

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQ-------DYIHGLNFKYRVDLR  259
               ++A+        A   G A P+  F    ++  V+       D       +  V L 
Sbjct  94   TFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLI  153

Query  260  DKKVKY----ENFLGTFKDAHTLTLTNPAKGKPPKDVTFR-----RALIAVGGRP-KSLD  309
            +   ++    +N +    +    T T+ AK     D+  R     + L+ VG RP +  D
Sbjct  154  NGTARFLPGNKNMVAVLSNESYETATD-AKRHTSADICKRVLTADKFLVCVGTRPARHPD  212

Query  310  CP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILL  364
             P   +    SD +      T P + +VVGA  V +E A  +    G DVTV+  R  +L
Sbjct  213  IPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEIL  272

Query  365  RGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATG  423
               D +++  +  Y   +    F+      S+E+  NG++ V    G+ +  D +L   G
Sbjct  273  NMADKEVSEGL-CYSMAQTGTRFLTEETIKSVEKADNGEIFVHLESGKTVVGDGLLYTVG  331

Query  424  RYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRL  481
            R  +V GLNL A  VGL P K GRI V +  QT+ PHIYA GD+I  P L   +++ GRL
Sbjct  332  RQGNVEGLNLEA--VGLAPDKRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRL  389

Query  482  ----------LSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVY  531
                      L+ ++  +   +   D+V T + +  E    G+     +  +G +   + 
Sbjct  390  ASVHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLT  448

Query  532  HQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVG  584
             +  TP E  ++    LA+         + K+I       +++G H +G  A E+     
Sbjct  449  KEQ-TPYEVGMARYEELARGQMLGGVPGFLKIIFC-PDTLKILGVHAIGEGATEIIHIGQ  506

Query  585  IAIKLNASYEDFVSTVGIHPTTAEIF  610
            + +    + E F + V  +PT AE +
Sbjct  507  VVMSTGGNLEYFRNAVFNYPTLAEAY  532

>PHYRA_72215
Length=499

 Score = 109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 227/482 (47%), Gaps = 43/482 (9%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+ D+D+VVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  29   ASSDYDVVVIGGGPGGYVAAIKAAQLGFKTACVE--------SRGKLGGTCLNVGCIPSK  80

Query  207  -LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
             L+H + ++    H D +++G   P  T ++ +++ + +  +  L        +  KV Y
Sbjct  81   ALLHSTHLLHTAQH-DFKSYGIDAPGVTANFPQMMKAKEKAVTTLTGGIESLFKKNKVTY  139

Query  266  ENFLGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISS  319
                G       +++  N  KG   + V  +  +IA G       P  +D     + I S
Sbjct  140  IKGYGKVSAQGEVSVALNDNKGN--ETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDS  196

Query  320  DDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTY  378
                +    P   +VVGA  + LE     K  G  VTV+  +     G D + A +  T 
Sbjct  197  TGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKE-AVKEFTK  255

Query  379  MEEEAKINFIKGAVPTSIEQLPNGQ-LKVTHTFGEG------IYDTVLNATGRYPDVSGL  431
            + ++  ++F  G   T+ E   NG  +K+T    +G        DTVL ATGR    +GL
Sbjct  256  LLKKQGLDFKFGTKVTASE--VNGDVVKLTTEAAKGGNAATIECDTVLVATGRRAFTAGL  313

Query  432  NLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
             L   G+  + K GRI V    +T  P I+A+GDVI G  L   A + G    + +    
Sbjct  314  GLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH  372

Query  491  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALA  549
              +  Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A
Sbjct  373  GHV-NYGAIPGVIYTFPEFASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTVA  424

Query  550  K-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
            + +   K++ D+ + D+++G H +  NAGE+     IA++  AS ED   T   HPT +E
Sbjct  425  EADGLVKVLADK-KTDKMLGVHIIASNAGEMISEGVIALEYGASSEDIARTCHAHPTLSE  483

Query  609  IF  610
             F
Sbjct  484  AF  485

>PHALS_10055
Length=516

 Score = 109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 124/485 (26%), Positives = 203/485 (42%), Gaps = 41/485 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DL+VIG G      + E+AK G++V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            + A++    ++    +G +    T     ++  VQ  +       R  L+  +V      
Sbjct  83   E-AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGF  141

Query  270  GTFKDAHTLTLTNPAKGKPPKDVT------FRRA-----LIAVGGRP--KSLDCPGADLA  316
              F++ H +++      +  K+++        RA     LIA G RP    L      + 
Sbjct  142  ARFENEHEISILRDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPIDGKVV  201

Query  317  ISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVM-VRSILLRGFDTDMA  372
            I SD I SR     P   +V+GA  + +E A  +    G  VTV+  R  +L   D ++ 
Sbjct  202  IDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCDLEII  261

Query  373  ARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGL  431
            + + TY  +     F+ G     +E   N Q+KV    G+ +  D +L   GR     GL
Sbjct  262  SNL-TYEMQSNGARFLLGETVKKVETTKN-QVKVFFNSGKVLSADALLYTVGRQAATDGL  319

Query  432  NLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
            NL A G+  N + G I V    QT  PHIYA GD I  P L   +++ GRL S  ++  +
Sbjct  320  NLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLASCHMWKPN  378

Query  491  ATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD  545
              L A  ++ +      ++T  E    G +E    +      +G+   S    E +    
Sbjct  379  EELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKNCINYEIGIAKYS----ELAKGQM  434

Query  546  RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPT  605
                     K++ D  +   ++G H +G  A E      +A+ +  S   F   V  +PT
Sbjct  435  MGAMAGGTLKILFD-PETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYFRDAVFNYPT  493

Query  606  TAEIF  610
             AE +
Sbjct  494  LAEAY  498

>PYAR_16840
Length=536

 Score = 107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 130/502 (26%), Positives = 211/502 (42%), Gaps = 63/502 (13%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+A++G++V V+D        +  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  211  SAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            + + +    H       +++   T D   ++  V+  +       +  L+  ++ Y   L
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTID--DILYRVKRVVDSEVDVIKAQLKAARIDYLPGL  146

Query  270  GTFKDAHTLTLTN--PAKGKPPKDVTFRRA---LIAVGGRPKSLDCPGAD--LAISSDDI  322
              F++ H +++ +   A G+    V+  +A   LIA G RP        D  + + SD I
Sbjct  147  ARFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDSDQI  206

Query  323  FSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVM-----VRSILLRGFDTDMAAR  374
             S      P   +VVGA  + +E A  L    G  VTV+     VR++L      DM+ R
Sbjct  207  LSGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SRDMSLR  263

Query  375  ------------------IGTYMEEEAKIN---FIKGAVPTSIEQLPNGQLKVTHTFGEG  413
                              I + ++ E ++    F+ G     +E+   G +KV  T G+ 
Sbjct  264  PQGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATG-VKVFLTSGKV  322

Query  414  IY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPEL  471
               D +L   GR     GLNL A G+G N K G + V    QT  PHIYAVGD I  P L
Sbjct  323  TSGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYAVGDCIGAPSL  381

Query  472  TPVAIQAGRLLSKRLFDNSATL---MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNL  528
               +++ GRL +  +++    +   +        ++T  E    G +E           +
Sbjct  382  ASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSEKVNYEI  441

Query  529  GVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIK  588
            G+    ++ L        A       K++ D     RV G H +G  A E+     +AI 
Sbjct  442  GL--AKYSELAKGQMSGGAFG---MLKILFD-PDTLRVHGVHAIGEGATEIIHIGQVAIA  495

Query  589  LNASYEDFVSTVGIHPTTAEIF  610
            +  S   F   V  +PT AE +
Sbjct  496  MGCSLTYFRDAVFNYPTLAEAY  517

>PYIW_19795
Length=519

 Score = 106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 121/483 (25%), Positives = 195/483 (40%), Gaps = 42/483 (9%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+AK G++V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  211  SAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            + + +    H       +++   T D   ++  V+  ++      +  L+  +V+Y   L
Sbjct  89   AVLHLSGYRHHGFYGKSYSMKTVTID--DILYRVKRVVNSEVDVIKAQLKAARVEYIPGL  146

Query  270  GTFKDAHTLTLTNPAKGKPPKD---------VTFRRALIAVGGRP--KSLDCPGADLAIS  318
              F+  H +++   A      D         +   + LIA G RP    L      +   
Sbjct  147  ARFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKVIFD  206

Query  319  SDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAAR  374
            SD I S      P   +VVGA  + +E A  L    G  VTV+  R  +L   D ++ + 
Sbjct  207  SDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEIISN  266

Query  375  IGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG---IYDTVLNATGRYPDVSGL  431
            + TY        F+ G     +E+  +G   VT  F  G     D +L   GR     GL
Sbjct  267  L-TYEMRSKGARFLLGETIKQVEKTEDG---VTVHFNSGKTATADALLYTVGRQASTDGL  322

Query  432  NLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491
            NL A  +  NP+      T  QT+  HIYA GD I  P L   +++ GRL +  ++D   
Sbjct  323  NLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQEE  382

Query  492  TLMAYD----KVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRA  547
             L+            ++T  E    G +E    +      +G+   S    E +      
Sbjct  383  QLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGANYEIGIAKYS----ELAKGQMSG  438

Query  548  LAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
                   K++ D T   +++G H +G  A E+     +A+ +  S   F   V  +PT A
Sbjct  439  STAGGMLKILFDPT-TLKLLGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPTLA  497

Query  608  EIF  610
            E +
Sbjct  498  EAY  500

>PHYSO_556052
Length=500

 Score = 106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 220/479 (46%), Gaps = 43/479 (9%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LM  208
            D+D+VVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+
Sbjct  33   DYDVVVIGGGPGGYVAAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALL  84

Query  209  HQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            H + ++    H D +++G   P    ++ +++ + +  +  L        +  KV Y   
Sbjct  85   HSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKVTYIKG  143

Query  269  LGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDI  322
             G       +++  N  KG   + V  +  +IA G       P  +D     + I S   
Sbjct  144  FGKVSAQGEVSVALNDNKGN--ETVKAKNIIIATGSEVTPLPPVPVDNEAGKI-IDSTGA  200

Query  323  FSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEE  381
             S    P   +VVGA  + LE     K  G  VTV+  +     G D +        +++
Sbjct  201  LSLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLLKK  260

Query  382  EAKINFIKGAVPTSIEQLPNGQ-LKVTHTFGEG------IYDTVLNATGRYPDVSGLNLS  434
            +  + F  G   T+ E   NG  +K+T    +G        DTVL ATGR    +GL L 
Sbjct  261  QG-LEFQFGTKVTASEV--NGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLE  317

Query  435  AAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATL  493
              G+  + K GRI V    +T  P I+A+GDVI G  L   A + G    + +      +
Sbjct  318  QMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKHGHV  376

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-E  551
              Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A+ +
Sbjct  377  -NYGAIPGVIYTFPEFASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTVAESD  428

Query  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
               K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  429  GLVKVLADK-KTDKLLGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  486

>PPTG_09121
Length=520

 Score = 106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 122/488 (25%), Positives = 201/488 (41%), Gaps = 45/488 (9%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+AK G++V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  211  SAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG  270
             A++    ++    +G +    T     ++  VQ  +       R  L+  +V       
Sbjct  84   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFA  142

Query  271  TFKDAHTLTLTNPAKGKPPKD---------------VTFRRALIAVGGRP--KSLDCPGA  313
             F++ H +++      +  K+               +   + LIA G RP    L     
Sbjct  143  RFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPLIPIDG  202

Query  314  DLAISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDT  369
             + I SD I SR     P   +V+GA  + +E A  +    G  VTV+  R  +L   D+
Sbjct  203  KVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDS  262

Query  370  DMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDV  428
            ++ + + TY  +     F+ G     +E   + ++KV    G+ +  D +L   GR    
Sbjct  263  EIISNL-TYEMQSNGARFLLGETVKKVET-TDKRVKVFFNSGKVLSADALLYTVGRQAAT  320

Query  429  SGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF  487
             GLNL A G+  N + G I V    QT  PHIYA GD I  P L   +++ GRL S  ++
Sbjct  321  DGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMW  379

Query  488  DNSATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSL  542
            +    L A  ++        ++T  E    G +E    +      +G+   S    E + 
Sbjct  380  NPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQLTKDCVNYEIGIAKYS----ELAK  435

Query  543  SHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGI  602
                        K++ D     +V G H +G  A E+     +A+ ++ S   F   V  
Sbjct  436  GQMMGAMAGGTLKILFD-PDTLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDAVFN  494

Query  603  HPTTAEIF  610
            +PT AE +
Sbjct  495  YPTLAEAY  502

>PHYRA_47253
Length=481

 Score = 105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 126/485 (26%), Positives = 198/485 (41%), Gaps = 42/485 (9%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+AK G++V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  211  SAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG  270
             A++    ++    +G +    T     ++  VQ  +       R  L+  +V       
Sbjct  53   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFA  111

Query  271  TFKDAHTLTLT-----NPAKGKPPKD-------VTFRRALIAVGGRP--KSLDCPGADLA  316
             F+  H +++      +  KG            V   + LIA G RP    L      + 
Sbjct  112  RFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPIDGQVV  171

Query  317  ISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMA  372
            I SD I SR     P   +VVGA  + +E A  +    G  VTV+  R  +L   D ++ 
Sbjct  172  IDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREII  231

Query  373  ARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGL  431
            + + TY  +     F+ G     +E   N ++KV    G+ +  D +L   GR     GL
Sbjct  232  SNL-TYEMQSNGARFLLGETIKKVETADN-RVKVFFDSGKVLSADALLYTVGRQASTDGL  289

Query  432  NLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
            NL A G+  N + G I V    QT  PHIYA GD I  P L   +++ GRL S  ++   
Sbjct  290  NLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWKPD  348

Query  491  ATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD  545
              L    ++ +      ++T  E    G +E    +      +GV   S    E +    
Sbjct  349  EELAVTSQLESGNYPYGIYTIPEISMVGQTEQQLTKDCVNYEIGVAKYS----ELAKGQM  404

Query  546  RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPT  605
                     K++ D     +V G H +G  A E+     +A+ ++ S   F   V  +PT
Sbjct  405  MGAMAGGTLKILFD-PDTLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDAVFNYPT  463

Query  606  TAEIF  610
             AE +
Sbjct  464  LAEAY  468

>PHYCA_123621
Length=495

 Score = 105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 135/481 (28%), Positives = 222/481 (46%), Gaps = 41/481 (9%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            +T D+D+VVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  25   STNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  76

Query  207  -LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
             L+H + ++    H D +++G   P    ++ +++ + +  +  L        +  KV Y
Sbjct  77   ALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKVTY  135

Query  266  ENFLGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISS  319
                G       +++  N  KG   + V  +  +IA G       P  +D     + I S
Sbjct  136  IKGFGKVSAQGEVSVALNDNKGN--ETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDS  192

Query  320  DDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTY  378
                S    P   +VVGA  + LE     K  G  VTV+        G D   A +  T 
Sbjct  193  TGALSLTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKG-AVKEFTK  251

Query  379  MEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG------IYDTVLNATGRYPDVSGLN  432
            + ++  ++F K +   +  ++    +K+T    +G        DTVL ATGR    +GL 
Sbjct  252  LLKKQGLDF-KFSTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAGLG  310

Query  433  LSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSA  491
            L   G+  + K GRI V    +T  P I+A+GDVI G  L   A + G    + +     
Sbjct  311  LEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHG  369

Query  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK  550
             +  Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A+
Sbjct  370  HV-NYGAIPGVIYTFPEFASVGKTEEE-LKAEGVEYNVGKF-----PM-MANSRARTVAE  421

Query  551  -ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEI  609
             +   K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E 
Sbjct  422  ADGLVKVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEA  480

Query  610  F  610
            F
Sbjct  481  F  481

>PYIW_25190
Length=206

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 96/185 (52%), Gaps = 4/185 (2%)

Query  431  LNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGD-VIDGPELTPVAIQAGRLLSKRLFDN  489
            L L A GV LN     +    E TS   IYA+GD  I G ELTPVAI AGR L+ RLF  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  490  SA-TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRAL  548
                L+ Y ++ T VF+    G  G +E  A+E  GA N+  Y   F  L  +++     
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMADPDHK  121

Query  549  AKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
             K      +V   +++ VVG H  G  A E+ Q  G+A+K+NA+  DF + V IHPT +E
Sbjct  122  GKTAMK--LVTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  609  IFTTL  613
               T+
Sbjct  180  ELVTM  184

>PHYCA_504445
Length=548

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 134/527 (25%), Positives = 221/527 (42%), Gaps = 57/527 (11%)

Query  127  SAAAPSAPARNVHANDV--DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKP  184
            +A +  APA N    D   +  A+  +DL+VIG G  G   + ++AK G+ V ++D    
Sbjct  20   AAFSTEAPAENKPLTDALRELRASEHFDLIVIGSGPAGQKCAIDSAKSGKSVAIID----  75

Query  185  SPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQ  244
                    +GG CV+ G +P K   ++A+        A   G   P+  F    ++  V+
Sbjct  76   ----KRDMMGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVR  131

Query  245  DYIHGLNFKYRVDLRDKKVKYENFLGTF---KDAHTLTLTNP-------AKGKPPKDVTF  294
                      R  L    V+  N    F    +     L+N        A+     D+  
Sbjct  132  KVEDAETDITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAQRHSSADICK  191

Query  295  R-----RALIAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECA  345
            R     + L+ VG RP +  D P   +    SD +      T P + ++VGA  V +E A
Sbjct  192  RVLTADKFLVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYA  251

Query  346  GFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQ  403
              +    G DVTV+  R  +L   D +++  +  Y   +    F+ G    S+E+   G+
Sbjct  252  SMMTIIPGTDVTVIDGRQEILNMADKEVSEAL-CYSMAQTGTRFLTGETIKSVEKTAKGE  310

Query  404  LKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTSTPHIY  460
            + V    G+ +  D +L   GR  +V GLNL A  VGL P K GRI V +  QT+ PHIY
Sbjct  311  VFVHLESGKTVVGDGLLYTVGRQGNVEGLNLEA--VGLEPDKRGRIKVDNNFQTAVPHIY  368

Query  461  AVGDVIDGPELTPVAIQAGRL----------LSKRLFDNSATLMAYDKVCTAVFTPIEYG  510
            A GD+I  P L   +++ GRL          L+ +   +   +   D+V T + +  E  
Sbjct  369  AAGDIIGFPGLASTSMEQGRLASVHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSG-EVF  427

Query  511  CCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQN  563
              G+     +  +G +   +  +   P E   +    LA+         + K+I    + 
Sbjct  428  PFGIYTVPEISMVGKNEQQLTKEQ-VPYEVGKARYEELARGQMLGGVPGFLKIIFC-PET  485

Query  564  DRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             +++G H +G  A E+     + +      E F + V  +PT AE +
Sbjct  486  LKILGVHAIGEGATEIIHIGQVVMSTGGDLEYFRNAVFNYPTLAEAY  532

>PHYKE_9680
Length=498

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 123/463 (27%), Positives = 213/463 (46%), Gaps = 45/463 (10%)

Query  165  ASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LMHQSAIMGELLHKDAE  223
            A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+H + ++    H D +
Sbjct  46   AAIKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFK  96

Query  224  AFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG--TFKDAHTLTLT  281
            ++G   P    ++ +++ + +  +  L     +  +  KV Y    G  + +   ++ LT
Sbjct  97   SYGIDAPGVKANFPQMMKAKEKAVKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVALT  156

Query  282  NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIFSRPTPPGKTLVVG  336
            +    K  + V  +  +IA G       P  +D     +  S+  +  +  P    +VVG
Sbjct  157  D---NKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTGALVLKRVPE-HLVVVG  212

Query  337  ASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTS  395
            A  + LE     K  G  VTV+  +     G D +        ++++  ++F  G   T+
Sbjct  213  AGVIGLELGSVYKRLGSKVTVVEFQDAACPGMDKECVKEFTKLLKKQG-LDFKFGTKVTA  271

Query  396  IEQLPNGQ-LKVTHTFGEG------IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIA  448
             E   NG  +K+T    +G        DTVL ATGR    +GL L   G+  + K GR+ 
Sbjct  272  SE--VNGDVVKLTTEAAKGGDEASIECDTVLVATGRRAYTAGLGLEQMGIQTD-KLGRVE  328

Query  449  VTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPI  507
            V    +T  P I+A+GDVI G  L   A + G    + +      +  Y  +   ++T  
Sbjct  329  VDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFP  387

Query  508  EYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-ECYCKLIVDRTQNDR  565
            E+   G +E+  ++A G + N+G +     P+  + S  R +A+ +   K++ D+ + D+
Sbjct  388  EFASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTVAEADGLVKVLSDK-KTDK  439

Query  566  VVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
            ++G H +  NAGE+     IA++  AS ED   T   HPT +E
Sbjct  440  MLGVHIIASNAGEMIAEGVIALEYGASSEDIARTCHAHPTLSE  482

>PITG_15359
Length=496

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 138/482 (29%), Positives = 222/482 (46%), Gaps = 43/482 (9%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            ++ D+D+VVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  207  -LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
             L+H + ++    H D +++G   P    ++ +++ S +  +  L        +  KV Y
Sbjct  78   ALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKVTY  136

Query  266  ENFLGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISS  319
                G       +++  N  KG   + V  +  +IA G       P  +D     + I S
Sbjct  137  IKGHGKISAQGEISVALNDNKGN--ETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDS  193

Query  320  DDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTY  378
                     P   +VVGA  + LE     K  G  VTV+        G D + A +  T 
Sbjct  194  TGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGSDKE-AVKEFTK  252

Query  379  MEEEAKINFIKGAVPTSIEQLPNGQ-LKVTHTFGEG------IYDTVLNATGRYPDVSGL  431
            + ++  ++F      T+ E   NG  +K+T    +G        DTVL ATGR    SGL
Sbjct  253  LLKKQGLDFQFNTKVTASE--VNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSGL  310

Query  432  NLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
             L   G+  + K GRI V    +T  P I+A+GDVI G  L   A + G    + +    
Sbjct  311  GLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH  369

Query  491  ATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALA  549
              +  Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A
Sbjct  370  GHV-NYGAIPGVIYTFPEFASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTIA  421

Query  550  K-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
            + +   K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E
Sbjct  422  EADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSE  480

Query  609  IF  610
             F
Sbjct  481  AF  482

>PHALS_12028
Length=579

 Score = 103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 129/504 (26%), Positives = 216/504 (43%), Gaps = 53/504 (11%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + ++AK+G+ V ++D            LGG CV+ G IP K
Sbjct  32   ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTIPSK  83

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
               ++A+        A   G   P+  F    ++  V+          R  L    V+  
Sbjct  84   TFREAALHLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDITRHQLLRNGVQLI  143

Query  267  NFLGTF--KDAHTL-TLTNP-------AKGKPPKDVTFR-----RALIAVGGRP-KSLDC  310
            N    F     H +  L+N        A+     D+  R     + L+ VG RP +  D 
Sbjct  144  NGTARFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRADI  203

Query  311  P-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVM-VRSILLR  365
            P   +    SD +      + P + +VVGA  + +E A  +    G DVTV+  R  +L 
Sbjct  204  PFDGETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEILN  263

Query  366  GFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGR  424
              D +++  +   M +     F+ G V  S+E+   G++ V    G+ +  D +L   GR
Sbjct  264  MADNEVSEALCFSMAQTGT-RFLTGEVIKSVEKSAMGEVFVHLESGKTVVGDGLLYTVGR  322

Query  425  YPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRL--  481
              +V GLNL A G+ +  K G+I V +  QT+ PHIYA GD+I  P L   +++ GRL  
Sbjct  323  QGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  381

Query  482  --------LSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQ  533
                    L+ +   +   +   D+V T + +  E    G+     +  +G +   +  +
Sbjct  382  VHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  440

Query  534  SFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIA  586
               P E  ++    LAK         + K+I       +V+G H +G  A E+     + 
Sbjct  441  G-VPYEVGVARYEELAKGQMLGGVPGFLKIIFC-PDTLKVLGVHAIGEGATEIIHIGQVL  498

Query  587  IKLNASYEDFVSTVGIHPTTAEIF  610
            +  + + E F + V  +PT AE +
Sbjct  499  MSTDGTLEYFRNAVFNYPTLAEAY  522

>H257_01186
Length=496

 Score = 102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 114/472 (24%), Positives = 200/472 (42%), Gaps = 29/472 (6%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DL+VIG G  GL  + E+AK G+ V ++D         +  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            ++ +     +     +G +        + ++  V   +       R  L+   V+     
Sbjct  80   EAVLHLSGFNHHG-FYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGK  138

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD--LAISSDDIF--SR  325
              F++A+ +++ N    +       ++ LIA G  P        D  + + SD I   S+
Sbjct  139  ARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGILEASK  198

Query  326  PTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEA  383
               P   +VVGA  + +E A  L    G  VTV+  R  +L   D ++ + +   M  + 
Sbjct  199  GELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKMEMRHKG  258

Query  384  KINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP  442
               F+ G    S+ ++  G ++V    G+  + + +L   GR  +   LNL   G+  N 
Sbjct  259  A-RFLLGETIQSVTRVAKG-VRVDFASGKSSFAEALLYCVGRQANTDALNLEGVGLAKN-  315

Query  443  KTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF---DNSATLMAYDK  498
            K G + V  + QTS PHIYA GD I  P L   +++ GRL +  ++   D   + +    
Sbjct  316  KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQPTSQLDSGN  375

Query  499  VCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIV  558
                ++T  E    G +E    +     N  V    ++ L   +    A  ++   K++ 
Sbjct  376  YPYGIYTIPEISMVGKTEQQLTKE--GRNYAVGMAKYSELAKGM---MAGGQKGALKILF  430

Query  559  DRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            D      V+G H +G  A E+     +A+ +N     F   V  +PT AE +
Sbjct  431  D-PDTQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFNYPTLAEAY  481

>PHYCA_555180
Length=521

 Score = 100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 125/491 (25%), Positives = 198/491 (40%), Gaps = 49/491 (10%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+AK G++V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  211  SAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG  270
             A++    ++    +G +    T     ++  VQ  +       R  L+  +V       
Sbjct  83   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  141

Query  271  TFKDAHTLTLTNP-------------AKGKPPKDVTFRRA-----LIAVGGRP--KSLDC  310
             F++ H +++                A G      +  R      LIA G RP    L  
Sbjct  142  RFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAHNPLVP  201

Query  311  PGADLAISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRG  366
                + I SD I SR     P   +V+GA  + +E A  +    G  VTV+  R  +L  
Sbjct  202  IDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  261

Query  367  FDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRY  425
             D ++ + + TY  +     F+ G     +E     ++KV    G+ +  D +L   GR 
Sbjct  262  CDREIISNL-TYEMQSNGARFLLGETVKKVE--VTDRVKVFFDSGKVLSADALLYTVGRQ  318

Query  426  PDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSK  484
                GLNL A G+  N + G I V    QT  PHIYA GD I  P L   +++ GRL S 
Sbjct  319  AATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASC  377

Query  485  RLFDNSATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLE  539
             +++    L    ++        ++T  E    G +E    +A     +GV   S    E
Sbjct  378  HMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKACINYEIGVAKYS----E  433

Query  540  WSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVST  599
             +             K++ D     +V G H +G  A E+     +A+ ++ S   F   
Sbjct  434  LAKGQMMGAMAGGTLKILFD-PDTLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDA  492

Query  600  VGIHPTTAEIF  610
            V  +PT AE +
Sbjct  493  VFNYPTLAEAY  503

>H310_00561
Length=497

 Score = 100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 207/479 (43%), Gaps = 43/479 (9%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DL+VIG G  GL  + E+AK G+ V ++D         +  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFK-------YRVDLRDKK  262
            ++ +   L   +   F          +++   +++D +H +N          R  L+   
Sbjct  81   EAVL--HLSGFNHHGFYGK------SYSRERITLRDILHRVNVVVSSEMDVIRAQLKAAH  132

Query  263  VKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD--LAISSD  320
            V+       F++A+ +++     G        ++ LIA G  P        D  + + SD
Sbjct  133  VQIIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSD  192

Query  321  DIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIG  376
             I   S+   P   +VVGA  + +E A  L    G  VTV+  R  +L   D ++ + + 
Sbjct  193  GILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALK  252

Query  377  TYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSA  435
              M  +    F+ G    S++++  G ++V    G+  + + +L   GR  +   LNL  
Sbjct  253  MEMRHKGA-RFLLGETIQSVKRVRKG-VRVDFASGKSSFAEALLYCVGRQANTDTLNLEG  310

Query  436  AGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLF---DNSA  491
             G+  N K G ++V  + QT+ PHI+A GD I  P L   +++ GRL +  ++   D   
Sbjct  311  VGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHEDQPT  369

Query  492  TLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKE  551
            + +        ++T  E    G +E    +     N  V    ++ L   +    A  ++
Sbjct  370  SQLDSGNYPYGIYTIPEISMVGKTEQQLTKE--GRNYAVGVAKYSELAKGM---MAGGQK  424

Query  552  CYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
               KL+ D   +  V+G H +G  A E+     +A+ +N     F   V  +PT AE +
Sbjct  425  GALKLLFD-PDSHSVLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFNYPTLAEAY  482

>PYIR_14132
Length=513

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 125/506 (25%), Positives = 210/506 (42%), Gaps = 57/506 (11%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + + AK+G+ V V+D            LGG C++ G +P K
Sbjct  7    ASEHFDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSK  58

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
               ++ +        +   G + P   F    ++  V+   H      R  L    ++  
Sbjct  59   TFREATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELI  118

Query  267  N----FLGTFKDAHTLTLTNP-------AKGKPPKDVTFR-----RALIAVGGRP-KSLD  309
            N    FL          L+N        AK     D+  R     + LIAVG RP +  D
Sbjct  119  NGTARFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPD  178

Query  310  CP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILL  364
             P        SD +      + P + +VVGA  + +E A  +    G +VT++  R  +L
Sbjct  179  IPFDGQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEIL  238

Query  365  RGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATG  423
               D +++  +   M +     F++  +  S+E+  NG++ V    G+ +  D +L   G
Sbjct  239  DMADREVSEALCYSMRQTGARFFVEETI-KSVEKADNGEVIVHLNSGKTLVGDGLLYTLG  297

Query  424  RYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLL  482
            R  +  GLNL+A G+  + K G I V  + QT  PHIYA GD I  P L   +++ GRL 
Sbjct  298  RQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLA  356

Query  483  SKRLF-----------DNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVY  531
            S  +            +  +T   Y +          +G   + E   +  +G +   + 
Sbjct  357  SVHMRTSKPTNKKGESETESTDPQYMRTRMRSGEVFPFGIYTVPE---ISMVGKNEQQLT  413

Query  532  HQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVG  584
             Q+  P E  ++    LAK         + K+I    +  +V+G H +G  A E+     
Sbjct  414  SQNI-PYEVGVARYEELAKGQMLGGVPGFLKIIFC-PKTLQVLGVHAIGEGATEIIHIGQ  471

Query  585  IAIKLNASYEDFVSTVGIHPTTAEIF  610
            + +    + E F + V  +PT AE +
Sbjct  472  VVMSTGGTIEYFRNAVFNYPTLAEAY  497

>PYU1_G005699
Length=550

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 138/543 (25%), Positives = 227/543 (42%), Gaps = 62/543 (11%)

Query  117  TLAFFRSRTQSAAAPSAP-ARNVHANDVDDG-----------ATYDWDLVVIGGGSGGLA  164
            TLA  R + + A A +A  A +  A     G           A+  +DL+VIG G  G  
Sbjct  4    TLALLRQQQRKALAMTARRALSSSATTTSGGKPLSDMLRELKASEHFDLIVIGSGPAGQK  63

Query  165  ASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEA  224
             + ++AK+G+ V ++D             GG CV+ G +P K   ++ +        +  
Sbjct  64   CAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFREATLHLTAYRHRSFY  115

Query  225  FGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTF-KDAH-------  276
             G + P   F    ++  V+   H      R  L    V+  N    F  DA+       
Sbjct  116  DGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELINGTARFLPDANKNMIAVL  175

Query  277  ---TLTLTNPAKGKPPKDVTFR-----RALIAVGGRP-KSLDCPGADLAI-SSDDIF--S  324
               + T    AK     D+  R     + LIAVG RP +  D P    A+  SD +    
Sbjct  176  SNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIPFDGQAVFDSDQLLWGG  235

Query  325  RPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEE  382
              T P + +VVGA  + +E A  +    G +VT++  R  +L   D +++  +   M + 
Sbjct  236  VKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMADREVSEALCYSMRQT  295

Query  383  AKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLN  441
                F++  +  S+E++ NG++ V    G+ +  D +L   GR  +  GLNL A G+  +
Sbjct  296  GARFFVEETI-KSVEKV-NGEVIVHLNSGKTLVGDGLLYTLGRQGNTDGLNLPAVGLEAD  353

Query  442  PKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVC  500
             K G I V    QT+ PHIYA GD I  P L   +++ GRL S  +     T    D   
Sbjct  354  -KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTEKPTNKTGDSES  412

Query  501  TA---VFTPIEYGCC---GLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK----  550
            T    + T +  G     G+     +  +G +   +  ++  P E  L+    LAK    
Sbjct  413  TDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQLTKEN-VPYEVGLARYEELAKGQML  471

Query  551  ---ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
                 + K+I    +  +++G H +G  A E+     + +    + E F + V  +PT A
Sbjct  472  GGVPGFLKIIFC-PKTLQLLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLA  530

Query  608  EIF  610
            E +
Sbjct  531  EAY  533

>SPRG_09825
Length=492

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 128/477 (27%), Positives = 201/477 (42%), Gaps = 39/477 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            D+DLVV+GGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALL  76

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
             +         D +  G  V     D+ KL+ S    +  L        +  KV Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYIKGF  136

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIFS  324
            G     + +++     G   K V+ +  LIA G       P  +D     + I S    S
Sbjct  137  GKIVAKNQVSVALNEGGN--KTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALS  193

Query  325  RPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRS-ILLRGFDTDMAARIGTYMEEEA  383
                P   +V+G   + LE        G  +TV+  +  +    D +        ++++ 
Sbjct  194  LKRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVVEYADKICPTMDFETGREFQKLLKKQG  253

Query  384  KINFIKGAVPTSIEQLPNGQLKVTHTF-----GEGIY---DTVLNATGRYPDVSGLNLSA  435
             +NF  G   T+ +   +   KVT T      GE      DTVL ATGR P   GL L  
Sbjct  254  -MNFQLGQKVTASKVEGD---KVTLTVEPAAGGEATTIECDTVLVATGRRPFTKGLGLEE  309

Query  436  AGVGLNPKTGRIAV--THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATL  493
             G+  + K GRI V  ++ +T+  +I+A+GD I+G  L   A + G    + +      +
Sbjct  310  MGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAGGHGHV  368

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECY  553
              Y+ +   V+T  E    G +E+    A  A N+G +         ++       K   
Sbjct  369  -NYNAIPGVVYTFPEVASVGKTEEELKAANVAYNVGKFPMMANSRARTVGETDGFVK---  424

Query  554  CKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
               I+    +D+++G H +  NAGE+     + ++  AS ED   T   HPT +E F
Sbjct  425  ---ILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  478

>PHYSO_489418
Length=471

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 119/459 (26%), Positives = 194/459 (42%), Gaps = 47/459 (10%)

Query  193  LGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNF  252
            +GG CV+ G +P K   ++A+        A   G A P+  F    ++  V+        
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  253  KYRVDLRDKKVKYENFLGTF---KDAHTLTLTNP-------AKGKPPKDVTFR-----RA  297
              R  L    V+  N    F    +     L+N        AK     D+  R     + 
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  298  LIAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QG  352
            L+ VG RP +  D P   +    SD +      T P + +VVGA  V +E A  +    G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPG  181

Query  353  FDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG  411
             DVTV+  R  +L   D +++  +  Y   +    F+ G    S+E+ P G++ V    G
Sbjct  182  TDVTVIDGRQEILNMADKEVSEAL-CYSMAQTGTRFLVGETIKSVEKTPKGEVFVHLESG  240

Query  412  EGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTSTPHIYAVGDVIDG  468
            + +  D +L   GR  +V GLNL A  VGL P K GRI V +  QT+ PHIYA GD+I  
Sbjct  241  KTVVGDGLLYTVGRQGNVEGLNLEA--VGLVPDKRGRIKVDNNFQTAVPHIYAAGDIIGF  298

Query  469  PELTPVAIQAGRL----------LSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDA  518
            P L   +++ GRL          L+ +   +   +   D+V T + +  E    G+    
Sbjct  299  PGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVP  357

Query  519  AVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHY  571
             +  +G +   +  +   P E  ++    LA+         + K+I    +  +++G H 
Sbjct  358  EISMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFC-PETLKILGVHA  415

Query  572  LGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            +G  A E+     + +    + E F + V  +PT AE +
Sbjct  416  IGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>SDRG_06945
Length=492

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 127/477 (27%), Positives = 201/477 (42%), Gaps = 39/477 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            D+DLVV+GGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALL  76

Query  210  QSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
             +         D +  G  V     D+ KL+ S    +  L        +  K+ Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYIKGF  136

Query  270  GTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIFS  324
            G     + +++     G   K V+ +  LIA G       P  +D     + I S    S
Sbjct  137  GKIVAKNQVSVALNDGGN--KTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALS  193

Query  325  RPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRS-ILLRGFDTDMAARIGTYMEEEA  383
                P   +V+G   + LE        G  +TV+  +  +    D +        ++++ 
Sbjct  194  LKRIPEHLVVIGGGVIGLEMGSVYGRLGAKITVVEYADKICPTMDFETGREFQKLLKKQG  253

Query  384  KINFIKGAVPTSIEQLPNGQLKVTHTF-----GEGIY---DTVLNATGRYPDVSGLNLSA  435
             +NF  G   T+ +   +   KVT T      GE      DTVL ATGR P   GL L  
Sbjct  254  -MNFQLGQKVTASKVEGD---KVTLTVEPAAGGEATTIECDTVLVATGRRPFTKGLGLEE  309

Query  436  AGVGLNPKTGRIAV--THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATL  493
             G+  + K GRI V  ++ +T+  +I+A+GD I+G  L   A + G    + +      +
Sbjct  310  MGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAGGHGHV  368

Query  494  MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECY  553
              Y+ +   V+T  E    G +E+    A  A N+G +         ++       K   
Sbjct  369  -NYNAIPGVVYTFPEVASVGKTEEELKAAGVAYNVGKFPMMANSRARTVGETDGFVK---  424

Query  554  CKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
               I+    +D+++G H +  NAGE+     + ++  AS ED   T   HPT +E F
Sbjct  425  ---ILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  478

>PYU1_G001737
Length=133

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 3/95 (3%)

Query  28   YHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFATQFVG  87
            YH+ GW+ C ++++A +V  +MQ L+P  ++ T+HE A + +F  WL+ S+  FAT F  
Sbjct  38   YHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGA  97

Query  88   DARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFR  122
             + A  H +SPF +   G   +FVGGCD  LA  R
Sbjct  98   TSPALTHTSSPFVWSNAG---EFVGGCDALLATIR  129

>H310_02523
Length=494

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 116/443 (26%), Positives = 189/443 (43%), Gaps = 49/443 (11%)

Query  193  LGGTCVNVGCIPKK-LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLN  251
            LGGTC+NVGCIP K L+H + +     H D ++ G  V N + D+ +L+ S +  +  L 
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSVGIKVDNVSIDFNQLMKSKEKTVKILT  120

Query  252  FKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PK  306
                   +  KV Y    G       L++     G   + +  +  LIA G       P 
Sbjct  121  GGIEGLFKKNKVDYVKGFGKIVAKGQLSVA--LNGGGNQTLHTKNILIATGSEVTPLPPV  178

Query  307  SLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRG  366
             +D  G  + + S    S    P   +VVG   + LE        G  +TV+        
Sbjct  179  PVDNEGGKI-VDSTGALSLKRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV--------  229

Query  367  FDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-----------  415
               + A +I   M+ E    F K      +      ++  +   G+ +            
Sbjct  230  ---EYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAGGDA  286

Query  416  -----DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV--THEQTSTPHIYAVGDVIDG  468
                 D VL ATGR P  +GL L   G+  + + GRI V  ++ QT+   IYA+GDVI+G
Sbjct  287  TTIEADCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYAIGDVIEG  345

Query  469  PELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNL  528
              L   A + G  + + +      +  YD +   ++T  E    G +E+    A  A N+
Sbjct  346  AMLAHKAEEEGIAVVETIAGKHGHV-NYDAIPGVIYTFPEVASVGKTEEELKAANVAYNV  404

Query  529  GVYHQSFTPLEWSLSHDRALAK-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAI  587
            G +     P+  + S  RA+ + + + K++  +  +D+++G H +  NAGE+     + I
Sbjct  405  GKF-----PM-MANSRARAVGETDGFVKVLAAK-DDDKILGIHIIASNAGEMISEGVLGI  457

Query  588  KLNASYEDFVSTVGIHPTTAEIF  610
            +  AS ED   T   HPT +E F
Sbjct  458  EYGASAEDIGRTCHAHPTLSEAF  480

>PHALS_09942
Length=496

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 122/464 (26%), Positives = 203/464 (44%), Gaps = 43/464 (9%)

Query  165  ASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LMHQSAIMGELLHKDAE  223
            A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+H + ++    H + +
Sbjct  44   AAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-EFK  94

Query  224  AFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLT-N  282
             +G   P  T ++ +++ +    +  L        +  KV Y    G       +++  +
Sbjct  95   NYGIDAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEVSVALH  154

Query  283  PAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIFSRPTPPGKTLVVGA  337
              KG   + V  +  +IA G       P  +D     + + S         P   +VVGA
Sbjct  155  DHKGN--ETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-VDSTGALELKRIPDHLVVVGA  211

Query  338  SYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSI  396
              + LE     K  G  VTV+        G D          ++++  + F  G   T+ 
Sbjct  212  GVIGLELGSVYKRLGAKVTVVEYLDDACTGMDKGSVKDFIKLLKKQG-LEFKFGTKVTAS  270

Query  397  EQLPNGQ-LKVTHTFGEG------IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV  449
            E   NG  +K+T    +G        DTVL ATGR    +GL L   G+  + K GRI V
Sbjct  271  E--INGDVVKLTTEPSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQTD-KFGRIEV  327

Query  450  THE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIE  508
                +T  P I+A+GDVI G  L   A + G +    +       + Y  +   ++T  E
Sbjct  328  DEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACAEIIAGKHGHVNYGAIPGVIYTFPE  386

Query  509  YGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-ECYCKLIVDRTQNDRV  566
            +   G +E+  ++A G + N+G +     P+  + S  R + + +   K++ D+ + D++
Sbjct  387  FASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTVGESDGMVKVLADK-KTDKL  438

Query  567  VGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            +G H +  NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  439  LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAHPTLSEAF  482

>PHYKE_2864
Length=486

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 118/485 (24%), Positives = 189/485 (39%), Gaps = 75/485 (15%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+AK G++V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  211  SAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG  270
             A++    ++    +G +    T     ++  VQ  +       R  L+  +V       
Sbjct  86   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFA  144

Query  271  TFKDAHTLTLTNPAKGKPP-------------KDVTFRRALIAVGGRP--KSLDCPGADL  315
             F++ H +++      K                 V   + LIA G RP    L      +
Sbjct  145  RFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPIDGKV  204

Query  316  AISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARI  375
             I SD I SR                            D+  + RS+++ G     A  I
Sbjct  205  IIDSDQILSR----------------------------DMHQLPRSLIVVG-----AGVI  231

Query  376  GTYMEEEAKINFIKGAVPTSIEQLPN---GQLKVTHTFGEGIY-DTVLNATGRYPDVSGL  431
            G  ME  + +N + G   T ++  P+    ++KV    G+ +  D +L   GR     GL
Sbjct  232  G--MEYASMVNVVPGHSVTVVDGRPDTTDKRVKVFFNSGKVLSADALLYTVGRQASTDGL  289

Query  432  NLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNS  490
            NL A G+  N + G I V    QT  PHIYA GD I  P L   +++ GRL S  +++  
Sbjct  290  NLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPD  348

Query  491  ATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD  545
              L A  ++ +      ++T  E    G +E    +      +G+   S    E +    
Sbjct  349  EELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKDCVNYEIGIAKYS----ELAKGQM  404

Query  546  RALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPT  605
                     K++ D     +V G H +G  A E+     +A+ +  S   F   V  +PT
Sbjct  405  MGAMAGGTLKILFD-PDTLKVFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPT  463

Query  606  TAEIF  610
             AE +
Sbjct  464  LAEAY  468

>H310_07641
Length=548

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 129/519 (25%), Positives = 214/519 (41%), Gaps = 81/519 (16%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DLVVIG G  G   + ++AK+G+KV ++D             GG CV+ G IP K
Sbjct  37   ASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSK  88

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
               + A++    H+    +G A   +T      +  + D +  +  +   DL   ++   
Sbjct  89   TFRE-AVLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVE-EAETDLTRNQLTRN  146

Query  267  ---------NFLGTFKDAHTLTLTNPAKGKP------------PKDVTFRRALIAVGGRP  305
                      FL T        L+N +  +              + +T  + LIAVG RP
Sbjct  147  GIILINGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRP  206

Query  306  K---SLDCPGADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV  359
                 L+  G  L   SD +        P + +VVGA  + +E A  +    G  VTV+ 
Sbjct  207  ARHPDLEYDGR-LIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVID  265

Query  360  -RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DT  417
             R  +L   D +++  +  YM +     F+       +E   + ++ V  T G+ I  D 
Sbjct  266  GRKEILDMADKEVSDALCYYMRQRGS-RFLTEESILKVETKDDSEVVVHLTSGKVIMGDA  324

Query  418  VLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAI  476
            +L   GR  +V+GL+L A G+  N K G + V +  QT+ PHIYA GD I  P L   ++
Sbjct  325  LLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALASTSM  383

Query  477  QAGRLLSKRLFDNSAT------------------LMAYDKVCTAVFTPIEYGCCGLSEDA  518
            + GRL S  +  +  T                  + + +     ++T  E    G SE  
Sbjct  384  EQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSE--  441

Query  519  AVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHY  571
              + +  +N+        P E  ++    LAK         + KLI   T   +++G H 
Sbjct  442  --QQLSKENI--------PYEVGIARYEELAKGQMLGGMPGFLKLIFCPT-TLKLLGVHA  490

Query  572  LGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            +G  A E+     + +    + E F + V  +PT AE +
Sbjct  491  IGEGATEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PYAP_19280
Length=512

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 116/483 (24%), Positives = 199/483 (41%), Gaps = 42/483 (9%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + E+A++G++V V+D      +GS+  +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE  81

Query  211  SAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFL  269
            + + +    H       +++   T D   ++  V+  +       +  L+  +V Y    
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKTVTID--DILYRVKRVVDSEVDVIKAQLKAARVDYIPGF  139

Query  270  GTFKDAHTLTLTNPAK---------GKPPKDVTFRRALIAVGGRPKSLDCPGAD--LAIS  318
              F++ H +++               +    +   + LIA G RP        D  +   
Sbjct  140  ARFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKVVFD  199

Query  319  SDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAAR  374
            SD I S      P   +VVGA  + +E A  L    G  VTV+  R  +L   D ++ + 
Sbjct  200  SDQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEVVSM  259

Query  375  IGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLS  434
            +   M  +    F+ G     +E+   G   + ++      D +L   GR  +  GLN+ 
Sbjct  260  LQHEMRVKGA-RFLLGESIQKVEKTAKGVKVLLNSGKVTSADALLYTVGRQANTDGLNIE  318

Query  435  AAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATL  493
            A G+  N + G + V    QT   HIYAVGD I  P L   +++ GRL +  ++D +  +
Sbjct  319  AVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDGNCDI  377

Query  494  ----MAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGV--YHQSFTPLEWSLSHDRA  547
                +        ++T  E    G +E           +G+  Y +         SH+  
Sbjct  378  ATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEKVNYEIGIAKYSELAKGQMGGGSHNGI  437

Query  548  LAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
            L      K++ D     ++ G H +G  A E+     +AI +  S   F   V  +PT A
Sbjct  438  L------KILFD-PDTLKLHGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVFNYPTLA  490

Query  608  EIF  610
            E +
Sbjct  491  EAY  493

>PYIW_24688
Length=259

 Score = 90.1 bits (222),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 117/260 (45%), Gaps = 49/260 (19%)

Query  163  LAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDA  222
            +A+++ AA +G KVLV   V+   +    GLGGTCV+ GC+PKK+M  +A   E L++ A
Sbjct  19   MASARRAATFGAKVLV---VERGRKYGGAGLGGTCVHYGCVPKKIMFNAATHVEHLNRAA  75

Query  223  EAFGWAVPN--------ATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKD  274
            +   +++            FDW  + T    YI  LN  Y  +L + +V     +     
Sbjct  76   D---YSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVDLVEGVAKL--  130

Query  275  AHTLTLTNPAKGKPPKD---VTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGK  331
                     AK +   D    T +  L+AVGG+P              D  F     P K
Sbjct  131  --------VAKNQVEVDGVVYTGKHILVAVGGKP--------------DGFFKLEAQPKK  168

Query  332  TLVVGASYVALECAGFLKGQGFDVTVMVR-SILLRGFD---TDMAARIGTYMEEEAKINF  387
              VVGA Y+A+E AG       D ++  R   +LR FD    D+    G    E+A INF
Sbjct  169  VAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEG----EKAGINF  224

Query  388  IKGAVPTSIEQLPNGQLKVT  407
            ++ +    IE+  +G L +T
Sbjct  225  VRNSRIERIEKQADGSLTIT  244

>SPRG_04114
Length=376

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 96/333 (29%), Positives = 155/333 (47%), Gaps = 24/333 (7%)

Query  289  PKDVTFRRALIAVGGRPKS---LDCPGADLAISSDDIFSRPTP--PGKTLVVGASYVALE  343
            P  +  ++ L+A G RP     + C G  + + SD I +  T   P   +VVGA  + +E
Sbjct  37   PTRLRGKKFLVACGTRPAHSPLVPCDG-KIILDSDQILNHDTTKLPKSWIVVGAGVIGME  95

Query  344  CAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPN  401
             A  L    G +VTV+  R+ +L   D ++ + +   M  +    F+ G    S+E   N
Sbjct  96   YASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMRHKGA-RFLLGESIKSVEHFKN  154

Query  402  GQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHI  459
            G +KV    G+ ++ + +L   GR  +  GLNL A G+  N + G I V  + QTS PHI
Sbjct  155  G-VKVEFNSGKAMFAEALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHI  212

Query  460  YAVGDVIDGPELTPVAIQAGRLLSKRLF---DNSATLMAYDKVCTAVFTPIEYGCCGLSE  516
            YA GD I  P L   +++ GRL +  ++   D + + +        ++T  E    G +E
Sbjct  213  YAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTE  272

Query  517  DAAVEAIGADNLGVYHQSFTPL-EWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPN  575
                +  GA N  V    F+ L +  +S D     E   KL+ D   + +++G H +G  
Sbjct  273  QQLTKE-GA-NYAVGLAKFSELAKGQMSGD----IEGILKLLFDPV-SLQLLGVHAIGHG  325

Query  576  AGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAE  608
            A E+     +A+ +N     F   V  +PT AE
Sbjct  326  ATEIIHIGQVAMAMNCKITYFRDAVFNYPTLAE  358

>H257_16541
Length=494

 Score = 92.8 bits (229),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 122/466 (26%), Positives = 205/466 (44%), Gaps = 47/466 (10%)

Query  165  ASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LMHQSAIMGELLHKDAE  223
            A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+H + +     H + +
Sbjct  42   AAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALLHGTHLYHSAQH-NFK  92

Query  224  AFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNP  283
            + G  V N + D+ +L+ S    +  L        +  KV Y    G       +++   
Sbjct  93   SVGIKVDNVSIDFDQLMKSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALN  152

Query  284  AKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIFSRPTPPGKTLVVGAS  338
            A G   + V  +  LIA G       P  +D  G  + I S    +    P   +VVG  
Sbjct  153  AGGN--QTVNTKNILIATGSEVTPLPPVPVDNEGGKI-IDSTGALALKRVPKHLVVVGGG  209

Query  339  YVALECAGFLKGQGFDVTVM---------VRSILLRGFDTDMAARIGTY-MEEEAKINFI  388
             + LE        G  +TV+         +   + + F   +  +  T+ + ++   + +
Sbjct  210  VIGLEMGSVYGRLGSKITVVEYADKICPTMDHEVTKEFQKLLTKQGMTFKLGQKVTASKV  269

Query  389  KGAVPT-SIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRI  447
             G V T ++E    G+            D VL ATGR P  +GL L   G+  + K GRI
Sbjct  270  DGDVVTLTVEPAAGGEATTIEA------DCVLVATGRRPFTAGLGLEEMGIQTD-KFGRI  322

Query  448  AV--THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFT  505
             V  ++ QT+   I+A+GDVI+G  L   A + G  + + +      +  YD +   ++T
Sbjct  323  KVNLSNFQTNVDGIFAIGDVIEGAMLAHKAEEEGIAVVETIAGKHGHV-NYDAIPGVIYT  381

Query  506  PIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK-ECYCKLIVDRTQND  564
              E    G +E+    A  A N+G +     P+  + S  RA+ + + + K++  +  +D
Sbjct  382  FPEVASVGKTEEELKTANVAYNVGKF-----PM-MANSRARAVGETDGFVKVLAAK-DDD  434

Query  565  RVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            +++G H +  NAGE+     + I+  AS ED   T   HPT +E F
Sbjct  435  KILGIHIIASNAGEMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>PYIW_20257
Length=503

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 118/487 (24%), Positives = 199/487 (41%), Gaps = 68/487 (14%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + + AK+G+ V V+D            LGG C++ G +P K
Sbjct  46   ASEHFDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSK  97

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
               ++ +        +   G + P   F    ++  V+                      
Sbjct  98   TFREATLHLTAYRHRSFYEGQSTPAKRFGIEDILQRVKK---------------------  136

Query  267  NFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGRP-KSLDCP-GADLAISSDDIF-  323
                   D H        +  P +    +  LIAVG RP +  D P   +    SD +  
Sbjct  137  -----LHDRH-------GRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQLLW  184

Query  324  -SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYME  380
                + P + +VVGA  + +E A  +    G +VT++  R  +L   D +++  +   M 
Sbjct  185  GGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADREVSEALCYSMR  244

Query  381  EEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVG  439
            +     F++  +  S+E+  NG++ V    G+ +  D +L   GR  +  GLNL A G+ 
Sbjct  245  QTGARFFVEETI-KSVEKADNGEVIVHLNSGKTLVGDGLLYTLGRQGNTEGLNLEAIGLK  303

Query  440  LNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDK  498
             + K G I V  + QT+ PHIYA GD I  P L   +++ GRL S  +     T    D 
Sbjct  304  AD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAKPTNKKGDS  362

Query  499  VCTA-----VFTPIEYGCC---GLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAK  550
               +     + T +  G     G+     +  +G +   +  Q   P E  ++    LAK
Sbjct  363  ETESTDPAFMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTSQCI-PYEVGVARYEELAK  421

Query  551  -------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIH  603
                     + K+I   T   +V+G H +G  A E+     + +    + E F + V  +
Sbjct  422  GQMLGGVPGFLKIIFCPT-TLQVLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNY  480

Query  604  PTTAEIF  610
            PT AE +
Sbjct  481  PTLAEAY  487

>CCA14030
Length=560

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 122/514 (24%), Positives = 208/514 (40%), Gaps = 69/514 (13%)

Query  144  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  203
            D  A+  +DL+V+G G  G   + ++AK+G+ V ++D  +          GG CV+ G +
Sbjct  48   DLKASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTV  99

Query  204  PKKLMHQSAIMGELLHKDAEAF-GWAVPNATFDWTKLITSVQ-------DYIHGLNFKYR  255
            P K   + AI+    H+    + G + P   F    ++T V+       D       +  
Sbjct  100  PSKTFRE-AILHLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNN  158

Query  256  VDLRDKKVKY-----ENFLGTFKDAHTLTLTNPAK----GKPPKDVTFRRALIAVGGRPK  306
            V+L +   ++     +N +    ++   T T+  +        + +T  + LIAVG RP 
Sbjct  159  VELINGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPA  218

Query  307  SLDCPGAD--LAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-R  360
              D    D  +   SD I      + P + +VVGA  + +E A  +    G  VTV+  R
Sbjct  219  RRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGR  278

Query  361  SILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTH------TFGEGI  414
              +L   D ++   +   M +     +++  +     +L N    +TH        G+G+
Sbjct  279  KEILEMADREVVEALTYAMRQTGSRFYMEETIKCV--ELSNKDEVITHLNSGKTVVGDGL  336

Query  415  YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTP  473
              TV    GR  +  GL+LSA G+  + K G I V    QTS PHIYA GD    P L  
Sbjct  337  LYTV----GRQGNTEGLDLSAIGLETD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALAS  391

Query  474  VAIQAGRLLSKRLFDNSAT-----------------LMAYDKVCTAVFTPIEYGCCGLSE  516
             +++ GRL S  +  +  T                 + + D     ++T  E    G +E
Sbjct  392  TSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVGKNE  451

Query  517  DAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNA  576
                +   A  +GV           L       K  +C   ++      ++G H +G  A
Sbjct  452  HQLTKEGIAYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN------ILGVHAIGEGA  505

Query  577  GEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             E+     + +    + E F + V  +PT AE +
Sbjct  506  TEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>SDRG_05060
Length=559

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 131/520 (25%), Positives = 219/520 (42%), Gaps = 83/520 (16%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DLVVIG G  G   + ++AK+G+KV ++D             GG CV+ G IP K
Sbjct  46   ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSK  97

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDL-RDKKVKY  265
               + A++    H+    +G A  +AT      I  + D +  +     +DL R++ ++ 
Sbjct  98   TFRE-AVLHLTAHRHKGFYGNAY-SATSGKRMSIQDILDRVQKVE-SAEMDLTRNQLLRN  154

Query  266  ENFL--GTFK---DAHTLTL--------TNPAKGKPPKD-------VTFRRALIAVGGRP  305
              +L  GT +   DA   T+        T    G+   D       +T  + LI+VG RP
Sbjct  155  GIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRP  214

Query  306  K---SLDCPGADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV  359
                ++D  G +L   SD +   +    P + +VVGA  + +E A  +    G  VTV+ 
Sbjct  215  ARHPNMDFDG-ELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVID  273

Query  360  -RSILLRGFDTDMAARI-------GTYMEEEAKINFIKGAVPTS--IEQLPNGQLKVTHT  409
             R  +L   D +++  +       GT    E  I+F++  +     +  L +G++ V   
Sbjct  274  GRKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--  331

Query  410  FGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDG  468
                  D +L   GR  +V+GL+L A G+  N + G + V +  QTS PHIYA GD I  
Sbjct  332  ------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGY  384

Query  469  PELTPVAIQAGRLLSKRLFDNSAT------------------LMAYDKVCTAVFTPIEYG  510
            P L  V+++ GRL S  +  +  T                  + + +     ++T  E  
Sbjct  385  PALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEIS  444

Query  511  CCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFH  570
              G SE    +      +GV           L       K  +C   +      +++G H
Sbjct  445  MVGKSEQQLTKENVPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTL------KLLGVH  498

Query  571  YLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             +G  A E+     + +    + E F + V  +PT AE +
Sbjct  499  AIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_12054
Length=558

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 131/520 (25%), Positives = 219/520 (42%), Gaps = 83/520 (16%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DLVVIG G  G   + ++AK+G+KV ++D             GG CV+ G IP K
Sbjct  45   ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSK  96

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDL-RDKKVKY  265
               + A++    H+    +G A  +AT      I  + D +  +     +DL R++ ++ 
Sbjct  97   TFRE-AVLHLTAHRHKGFYGNAY-SATSGKRMSIQDILDRVQKVE-SAEMDLTRNQLLRN  153

Query  266  ENFL--GTFK---DAHTLTL--------TNPAKGKPPKD-------VTFRRALIAVGGRP  305
              +L  GT +   DA   T+        T    G+   D       +T  + LI+VG RP
Sbjct  154  GIYLINGTARFLPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRP  213

Query  306  K---SLDCPGADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV  359
                ++D  G +L   SD +   +    P + +VVGA  + +E A  +    G  VTV+ 
Sbjct  214  ARHPNMDFDG-ELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVID  272

Query  360  -RSILLRGFDTDMAARI-------GTYMEEEAKINFIKGAVPTS--IEQLPNGQLKVTHT  409
             R  +L   D +++  +       GT    E  I+F++  +     +  L +G++ V   
Sbjct  273  GRKEILEMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--  330

Query  410  FGEGIYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDG  468
                  D +L   GR  +V+GL+L A G+  N + G + V +  QTS PHIYA GD I  
Sbjct  331  ------DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGY  383

Query  469  PELTPVAIQAGRLLSKRLFDNSAT------------------LMAYDKVCTAVFTPIEYG  510
            P L  V+++ GRL S  +  +  T                  + + +     ++T  E  
Sbjct  384  PALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEIS  443

Query  511  CCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFH  570
              G SE    +      +GV           L       K  +C   +      +++G H
Sbjct  444  MVGKSEQQLTKENVPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTL------KLLGVH  497

Query  571  YLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             +G  A E+     + +    + E F + V  +PT AE +
Sbjct  498  AIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>PYAP_19148
Length=535

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 128/517 (25%), Positives = 210/517 (41%), Gaps = 69/517 (13%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + + AK+G+ V ++D             GG CV+ G +P K
Sbjct  7    ASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSK  58

Query  207  LMHQSAIMGELLHKDAEAF-GWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
               + AI+    H+    + G + P   F    ++  V+   +      R  L    ++ 
Sbjct  59   TFRE-AILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIEL  117

Query  266  EN----FLGTFKDAHTLTLTNPA-------KGKPPKDVTFR----------------RAL  298
             N    FL          L+N +       K     D+  R                + L
Sbjct  118  INGTARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKFL  177

Query  299  IAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGF  353
            +AVG RP +  D P        SD I        P + +VVGA  + +E A  +    G 
Sbjct  178  VAVGTRPARRADIPFDGKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGS  237

Query  354  DVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGE  412
            +VTV+  R  +L   D ++A  +  Y   +    F       ++E+  NG++ V    G+
Sbjct  238  EVTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNSGK  296

Query  413  GIY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPE  470
             I  D +L   GR  +  GLNL+A G+  + K G + V    +TS PHIYA GD I  P 
Sbjct  297  TIVGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCIGYPA  355

Query  471  LTPVAIQAGRLLS----------KRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAV  520
            L   +++ GRL S          K+  DN  +  +Y +          +G   + E   +
Sbjct  356  LASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE---I  412

Query  521  EAIGADNLGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLG  573
              +G     +  ++  P E  ++    LAK         + K IV   ++ +V+G H +G
Sbjct  413  SMVGKSEQQLTRENI-PYEVGVARYEELAKGQMLGGVPGFLK-IVFCPKSLQVLGVHAIG  470

Query  574  PNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
              A E+     + +    + E F + V  +PT AE +
Sbjct  471  EGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>PITG_18935
Length=480

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 128/483 (27%), Positives = 214/483 (44%), Gaps = 61/483 (13%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            ++ D+D+VVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K
Sbjct  26   SSSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSK  77

Query  207  -LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
             L+H + ++    H D +++G   P    ++ +++ S +  +  L     +  +  KV Y
Sbjct  78   ALLHSTHLLHTAQH-DFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIELLFKKNKVTY  136

Query  266  ENFLGTFKDAHTLTLT-NPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISS  319
                G       +++  N  KG   + V  +  +IA G       P  +D     +  S+
Sbjct  137  IKGHGKISAQGEISVALNDNKGN--ETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDST  194

Query  320  DDIFSRPTPP----GKTLVVGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARI  375
              +  +  P         V    ++   C G  K    + T +++    +G D     ++
Sbjct  195  GALELKRVPEHLVVVGAGVTVVEFLDAACPGSDKEAVKEFTKLLKK---QGLDFQFNTKV  251

Query  376  GTYMEEEAKINFI-----KGAVPTSIEQLPNGQLKVTHTFGEGIYDTVLNATGRYPDVSG  430
             T  E    +  +     KG   +SIE                  DTVL ATGR    SG
Sbjct  252  -TASEVNGDVVKLTTEPSKGGDASSIE-----------------CDTVLVATGRRAFTSG  293

Query  431  LNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDN  489
            L L   G+  + K GRI V    +T  P I+A+GDVI G  L   A + G    + +   
Sbjct  294  LGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGK  352

Query  490  SATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRAL  548
               +  Y  +   ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +
Sbjct  353  HGHV-NYGAIPGVIYTFPEFASVGKTEE-ELKAEGIEYNVGKF-----PM-MANSRARTI  404

Query  549  AK-ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTA  607
            A+ +   K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +
Sbjct  405  AEADGLVKVLADK-KTDKLLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLS  463

Query  608  EIF  610
            E F
Sbjct  464  EAF  466

>HYAP_04149
Length=564

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 136/551 (25%), Positives = 230/551 (42%), Gaps = 71/551 (13%)

Query  117  TLAFFRSRTQSAAAPSAPARNVHANDV-------DDGATYDWDLVVIGGGSGGLAASKEA  169
            +LA  R+ +++ A+  + + N+ AN         +  A+  +DL+VIG G  G   + ++
Sbjct  12   SLAPARALSRAVASSRSNSPNLEANKQLLTETLRELRASEHFDLIVIGSGPAGQKCAIDS  71

Query  170  AKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAV  229
            AK+G  V ++D            LGG CV+ G +P K   ++A+        A   G A 
Sbjct  72   AKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFREAALHLTGYRHRAFYNGQAG  123

Query  230  PNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFK--DAHTL-TLTNP---  283
            P+       ++  V           R  L    V+       F   ++H +  L+N    
Sbjct  124  PSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLITGTARFMPGNSHMIAVLSNESYE  183

Query  284  ----AKGKPPKDVTFR-----RALIAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPG  330
                AK     ++  R       L+ VG RP +  D P   +    SD +        P 
Sbjct  184  TATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIPFDGETIFDSDQLLWGKVKAVPR  243

Query  331  KTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFI  388
            + +VVGA  V +E A  +    G DVTV+  R  +L   D +++  +  Y   +    F+
Sbjct  244  RLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEMADKEVSEAL-CYSMAQTGTRFL  302

Query  389  KGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP-KTGR  446
               V  S+E+   G++ V    G+ +  D +L   GR  +V GLNL A  VGL P K GR
Sbjct  303  VDEVIKSVEKSAKGEVGVHLESGKTVVGDGLLYTVGRQGNVEGLNLEA--VGLAPDKRGR  360

Query  447  IAVTHE-QTSTPHIYA---------VGDVIDGPELTPVAIQAGRLLSKRL----------  486
            I V +  QT+ PH+YA          GD+I  P L   +++ GRL S  +          
Sbjct  361  IIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPALASTSMEQGRLASVHMRTSKSFYTKE  420

Query  487  FDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDR  546
              +   +   D+V T + +  E    G+     +  +G +   +  +   P E  ++   
Sbjct  421  ISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTREQ-VPYEVGIARYE  478

Query  547  ALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVST  599
             LAK         + K+I    +  +++G H +G  A E+     + +  + + E F + 
Sbjct  479  ELAKGQMLGGVPGFLKIIFC-PKTLKLLGVHAIGEGATEIIHIGQVVMSTDGTLEYFRNA  537

Query  600  VGIHPTTAEIF  610
            V  +PT AE +
Sbjct  538  VFNYPTLAEAY  548

>PITG_01778
Length=470

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 116/463 (25%), Positives = 188/463 (41%), Gaps = 55/463 (12%)

Query  193  LGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQ-------D  245
            LGG CV+ G +P K   ++A+        A   G A P+  F    ++  V+       D
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  246  YIHGLNFKYRVDLRDKKVKY----ENFLGTFKDAHTLTLTNPAKGKPPKDVTFR-----R  296
                   +  V L +   ++    +N +    +    T T+ AK     D+  R     +
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATD-AKRHTSADICKRVLTADK  120

Query  297  ALIAVGGRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-Q  351
             L+ VG RP +  D P   +    SD +   +  + P + ++VGA  V +E A  +    
Sbjct  121  FLVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIP  180

Query  352  GFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTF  410
            G DVTV+  R  +L   D  ++  +  Y   +    F+ G    S+E+ P G++      
Sbjct  181  GTDVTVIDGRQEILNMADKQVSEAL-CYSMAQTGTRFLTGETIKSVEKSPKGEVFAHLES  239

Query  411  GEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTSTPHIYAVGDVID  467
            G+ +  D +L   GR  +V GLNL A  VGL P K GRI V +  QT+ PHIYA GD+I 
Sbjct  240  GKTVVGDGLLYTVGRQGNVEGLNLEA--VGLAPDKRGRIKVDNNFQTAVPHIYAAGDIIG  297

Query  468  GPELTPVAIQAGRLLSKRL----------FDNSATLMAYDKVCT----------AVFTPI  507
             P L   +++ GRL S  +            +   +   D+V T           ++T  
Sbjct  298  FPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVP  357

Query  508  EYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVV  567
            E    G +E    +      +GV           L       K  +C   +      ++ 
Sbjct  358  EISMVGKNEQQLTKEQVPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTL------KIF  411

Query  568  GFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            G H +G  A E+     + +    + E F + V  +PT AE +
Sbjct  412  GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>H257_07450
Length=567

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 159/367 (43%), Gaps = 43/367 (12%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DLVVIG G  G   + ++AK+G+KV ++D             GG CV+ G IP K
Sbjct  35   ASEHFDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSK  86

Query  207  LMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYE  266
               + A++    H+    +G A   +T      +  + D +  +      DL   ++   
Sbjct  87   TFRE-AVLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVE-DAETDLTRNQLTRN  144

Query  267  ---------NFLGTFKDAHTLTLTNPAKGKP------------PKDVTFRRALIAVGGRP  305
                      FL T        L+N +  +              + +T  + LIAVG RP
Sbjct  145  GIILINGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRP  204

Query  306  K---SLDCPGADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV  359
                 LD  G  L   SD +        P + +VVGA  + +E A  +    G  VTV+ 
Sbjct  205  ARRPDLDYDGR-LIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVID  263

Query  360  -RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DT  417
             R  +L   D +++  +  YM +     F+       +E   N ++ V  T G+ I  D 
Sbjct  264  GRKEILDMADKEVSDALCYYMRKRGS-RFLTEESIVKVETKDNSEVLVYLTSGKVIVGDA  322

Query  418  VLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAI  476
            +L   GR  +V+GL+L A G+  N K G + V +  QT  PHIYA GD I  P L   ++
Sbjct  323  LLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTSM  381

Query  477  QAGRLLS  483
            + GRL S
Sbjct  382  EQGRLAS  388

>CCI39993
Length=550

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 125/516 (24%), Positives = 200/516 (39%), Gaps = 73/516 (14%)

Query  144  DDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCI  203
            D  A+  +DL+VIG G  G   + ++AK+G+ V ++D  +          GG CV+ G +
Sbjct  38   DLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH--------GGVCVHTGTV  89

Query  204  PKKLMHQSAIMGELLHKDAEAF-GWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKK  262
            P K   + AI+    H+    + G + P   F    ++T V+   +      R  L    
Sbjct  90   PSKTFRE-AILHLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNN  148

Query  263  VKYENFLGTFKDAHTLTLTNPAKGK-----------------------PPKDVTFRRALI  299
            V+  N    F       L +P+K                           K +T  + LI
Sbjct  149  VELINGTARF-------LPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLI  201

Query  300  AVGGRPKSLDCPGAD--LAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFD  354
            AVG RP   D    D  +   SD I      + P + +VVGA  + +E A  +    G  
Sbjct  202  AVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQ  261

Query  355  VTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG  413
            VTV+  R  +L   D ++   + TY   +    F        +E     ++ +    G+ 
Sbjct  262  VTVIDGRKEILEMADREVVEAL-TYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNSGKT  320

Query  414  IY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPEL  471
            I  D +L   GR  +  GL+LSA G+  + K G I V    QTS PHIYA GD    P L
Sbjct  321  IVGDGLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQTSVPHIYAAGDCTGFPAL  379

Query  472  TPVAIQAGRLLSKRLFDNSAT-----------------LMAYDKVCTAVFTPIEYGCCGL  514
               +++ GRL S  +  +  T                 + + D     ++T  E    G 
Sbjct  380  ASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVGK  439

Query  515  SEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGP  574
            +E    +   A  +GV           L       K  +C   ++      ++G H +G 
Sbjct  440  NEYQLTKEGIAYEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN------ILGVHAIGE  493

Query  575  NAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             A E+     + +    + E F + V  +PT AE +
Sbjct  494  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>PYVX_23499
Length=519

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 126/513 (25%), Positives = 213/513 (42%), Gaps = 69/513 (13%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+V+G G  G   + ++AK+G+ V ++D            LGG CV+ G +P K
Sbjct  11   ASEHFDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSK  62

Query  207  LMHQSAI-MGELLHK----------------DAEAFGWAVPNATFDWTK--LITSVQDYI  247
               ++ + +    H+                D       V  A  D T+  L+ +  + I
Sbjct  63   TFREATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELI  122

Query  248  HGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFR-----RALIAVG  302
            HG   ++   L D+K    N +    +A   T T+ AK     D+  R     + LI VG
Sbjct  123  HG-TARF---LPDEK---RNMVAVLSNAKYDTPTD-AKRHTSADICKRVLTADKFLICVG  174

Query  303  GRP-KSLDCP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTV  357
             RP +  D P        SD +        P + +VVGA  + +E A  +    G +VTV
Sbjct  175  TRPARREDIPFDGKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTV  234

Query  358  MV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-  415
            +  R  +L   D +++  +   M +     + + ++   +E+  NG++      G+ I  
Sbjct  235  IDGRKEILDMADKEVSESLCYSMRQTGTRFYTEESIK-KVEKRENGEVVAHLNSGKVIVG  293

Query  416  DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPV  474
            D +L   GR  +  GLNL A G+  + K G + V  + QT  PHIYA GD I  P L   
Sbjct  294  DGLLYTLGRQGNTDGLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDCIGYPALAST  352

Query  475  AIQAGRLLSKRLFDNSATLMAYDKVCTAV----------FTPIEYGCCGLSEDAAVEAIG  524
            +++ GRL S  +   S T    ++    +              E    G+     +  +G
Sbjct  353  SMEQGRLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVG  412

Query  525  ADNLGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAG  577
             +   +  ++  P E  L+    LAK         + K+I       +V+G H +G  A 
Sbjct  413  KNEQQLTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFC-PDTLKVLGVHAIGEGAT  470

Query  578  EVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            E+     + +    + E F + V  +PT AE +
Sbjct  471  EIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>PYAR_16664
Length=577

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 106/408 (26%), Positives = 168/408 (41%), Gaps = 62/408 (15%)

Query  127  SAAAPSAPARNVHANDVDD-GATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPS  185
            S AA SA  R   +  + D  A+  +DL+VIG G  G   + + AK+G+ V ++D     
Sbjct  39   SPAADSAATRKPLSELLQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID-----  93

Query  186  PQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAF-GWAVPNATFDWTKLITSVQ  244
                   +GG C++ G +P K   + AI+    H+    + G + P   F    ++  V+
Sbjct  94   ---KRDMVGGVCIHTGTVPSKTFRE-AILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVR  149

Query  245  -------DYIHGLNFKYRVDLRDKKVKYE----------------------NFLGTFKDA  275
                   D       +  ++L +   ++                        FL      
Sbjct  150  KVESAETDITRHQLLRNGIELINGTARFXXXXCDRALILLRNGIELINGTARFLPDPSMK  209

Query  276  HTLTLTNPAKGKP------------PKDVTFRRALIAVGGRP-KSLDCP-GADLAISSDD  321
                L+N +   P             + +T  + LIAVG RP +  D P        SD 
Sbjct  210  MVAVLSNDSYDTPTDTKRHTSADICKRVLTADKFLIAVGTRPARREDIPFDGKTIFDSDQ  269

Query  322  IF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGT  377
            I        P + +VVGA  + +E A  +    G +VTV+  R  +L   D ++A  +  
Sbjct  270  ILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-K  328

Query  378  YMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAA  436
            Y   ++   F       S+E+  NG++ V    G+ I  D +L   GR     GLNL+A 
Sbjct  329  YAMRQSGTRFYTDETIKSVEKAANGEVIVKLNSGKTIIGDGLLYTVGRQGSTDGLNLAAV  388

Query  437  GVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLS  483
            G+  + K G + V    +TS PHIYA GD I  P L   +++ GRL S
Sbjct  389  GLETD-KRGLLQVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRLAS  435

>PYIR_21896
Length=518

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 127/505 (25%), Positives = 195/505 (39%), Gaps = 86/505 (17%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMH  209
            ++DLVVIG G      + E+AK G++V V+D         T+ +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVDK-------KTF-VGGVCVHTGTIPSKTFR  88

Query  210  QSAI-MGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            ++ + +    H       +++   T D               +  YRV    + V  E  
Sbjct  89   EAVLHLSGYRHHGFYGKSYSMKTVTID---------------DILYRVK---RVVNSEVD  130

Query  269  LGTFKDAHTLTLTNPAKGKPPKD--------VTFRRA---LIAVGGRPKSLDCPGAD--L  315
            +   +D      T  A G    D        V+  RA   LIA G RP        D  +
Sbjct  131  ISIVRD------TPDAAGGDAGDSDHDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKV  184

Query  316  AISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDM  371
               SD I S      P   +VVGA  + +E A  +    G  VTV+  RS +L   D ++
Sbjct  185  IFDSDQILSGDIRELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEI  244

Query  372  AARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY---DTVLNATGRYPDV  428
             + + TY        F+ G     +E+  +G   VT  F  G     D +L   GR    
Sbjct  245  ISNL-TYEMRSKGARFLLGETIKHVEKTESG---VTVHFNSGKITSADALLYTVGRQAAT  300

Query  429  SGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHI------------------YAVGDVIDGP  469
             GLNL A  +  NP+ G + V    QT+ PH+                  YA GD I  P
Sbjct  301  DGLNLEAVDLSRNPR-GLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAP  359

Query  470  ELTPVAIQAGRLLSKRLFDNSATLMAYD----KVCTAVFTPIEYGCCGLSEDAAVEAIGA  525
             L   +++ GRL +  ++D    L+            ++T  E    G +E    +    
Sbjct  360  SLASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQLTKEGLN  419

Query  526  DNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGI  585
              +G+   S    E +             K++ D T   ++ G H +G  A E+     +
Sbjct  420  FEIGIAKYS----ELAKGQMSGSTAGGMLKILFDPT-TLKLFGVHAIGEGATEIIHIGQV  474

Query  586  AIKLNASYEDFVSTVGIHPTTAEIF  610
            A+ +  S   F   V  +PT AE +
Sbjct  475  AMAMGCSITYFRDAVFNYPTLAEAY  499

>PITG_19065
Length=416

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 100/401 (25%), Positives = 165/401 (41%), Gaps = 27/401 (7%)

Query  229  VPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF--LGTFKDAHTLTLTNPAKG  286
            + +  +   ++++S +D +       RVD+     ++EN   +   +D       +   G
Sbjct  6    IEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFARFENEHEISIVRDEDDKKKNSSVTG  65

Query  287  KPPKDVTFR----RALIAVGGRP--KSLDCPGADLAISSDDIFSRPTP--PGKTLVVGAS  338
            +   D   R    + LIA G RP    L      + I SD I SR     P   +V+GA 
Sbjct  66   RSNVDSLSRIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAG  125

Query  339  YVALECAGFLKG-QGFDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSI  396
             + +E A  +    G  VTV+  R  +L   D ++ + + TY  +     F+ G     +
Sbjct  126  VIGMEYASMVNVVPGHTVTVVDGRPDILSFCDREIISNL-TYEMQSNGARFLLGETVKKV  184

Query  397  EQLPNGQLKVTHTFGEGIY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QT  454
            E   + ++KV    G+ +  D +L   GR     GLNL A G+  N + G I V    QT
Sbjct  185  ET-TDKRVKVFFNSGKALSADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQT  242

Query  455  STPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCT-----AVFTPIEY  509
              PHIYA GD I  P L   +++ GRL S  +++    L A  ++        ++T  E 
Sbjct  243  DQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPEI  302

Query  510  GCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGF  569
               G +E    +      +G+   S    E +             K++ D     +V G 
Sbjct  303  SMVGQTEQQLTKDCVNYEIGIAKYS----ELAKGQMMGAMAGGTLKILFD-PDTLKVFGV  357

Query  570  HYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            H +G  A E+     +A+ +  S   F   V  +PT AE +
Sbjct  358  HAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>PHYKE_9807
Length=557

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 125/510 (25%), Positives = 207/510 (41%), Gaps = 66/510 (13%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK  206
            A+  +DL+VIG G  G   + ++AK+G+ V ++D            LGG CV+ G   ++
Sbjct  52   ASEHFDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTTFRE  103

Query  207  L-MHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKY  265
              MH +       +      G    +       ++  V+          R  L+   V+ 
Sbjct  104  AAMHLTGYRHRAFYN-----GHGGISKRIGVEDILQRVKKVEAAETDITRHQLQRNGVQL  158

Query  266  ENFLGTF--KDAHTL-TLTNP-------AKGKPPKDVTFR-----RALIAVGGRP-KSLD  309
             +    F   D+H L  L+N        AK     D+  R     + L+ VG RP +  D
Sbjct  159  ISGTARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPARHPD  218

Query  310  CP-GADLAISSDDIF--SRPTPPGKTLVVGASYVALECAGFLKG-QGFDVTVMV-RSILL  364
             P   +    SD +        P + ++VG   V +E A  +    G DVTV+  R  +L
Sbjct  219  IPFDGETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEIL  278

Query  365  RGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEGIY-DTVLNATG  423
               D +++  +  Y   +    F+ G     +E+   G++ V    G+ +  D +L   G
Sbjct  279  NMADKEVSEAL-CYSMAQTGTRFLVGETIKKVEKNSKGEVLVRLDSGKTVVGDGLLYTVG  337

Query  424  RYPDVSGLNLSAAGVGLNP-KTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRL  481
            R  +V GL+L +  VG++P K GRI V +  QT  PHIYA GD+I  P L   +++ GRL
Sbjct  338  RQGNVEGLHLES--VGIHPDKRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSMEQGRL  395

Query  482  L--------------SKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADN  527
                           SK L D+   LM             E    G+     +  +G + 
Sbjct  396  ASVHMRTASPVATKPSKELPDDK--LMDDPDRMRTRMRSGEVFPFGIYTVPEISMVGKNE  453

Query  528  LGVYHQSFTPLEWSLSHDRALAK-------ECYCKLIVDRTQNDRVVGFHYLGPNAGEVT  580
              +  Q   P E  ++    LA+         + K+I       +++G H +G  A E+ 
Sbjct  454  QQLT-QEQVPYEVGMARYEELARGQMLGGVPGFLKIIFC-PNTLQILGVHAIGEGATEII  511

Query  581  QAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
                + +    + E F + V  +PT AE +
Sbjct  512  HIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>HYAP_08069
Length=255

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 100/215 (47%), Gaps = 17/215 (8%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKK-LM  208
            D+DLVVIGGG GG  A+ +AA+ G K   ++        S   LGGTC+NVGCIP K L+
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  209  HQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENF  268
            H + ++    H + +++G   PN T ++ +++ + +  +  L           KV Y   
Sbjct  86   HSTHLLHTAQH-EFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  269  LGTFKDAHTLTLTNPAKGKPPKDVTFRRALIAVGGR-----PKSLDCPGADLAISSDDIF  323
            +G       +++T  A  +    +T +  ++A G       P  +D     + + S    
Sbjct  145  VGKLAAKGQVSVTL-ADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGAL  202

Query  324  SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVM  358
            +    P   +VVGA  + LE     K  G  VTV+
Sbjct  203  ALTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PPTG_13000
Length=387

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 139/293 (47%), Gaps = 24/293 (8%)

Query  329  PGKTLVVGASYVALECAGFLKGQGFDVTVM-VRSILLRGFDTDMAARIGTYMEEEAKINF  387
            P   +VVGA  + LE     K  G  VTV+        G D + A +  T + ++  ++F
Sbjct  94   PEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKE-AVKEFTKLLKKQGLDF  152

Query  388  IKGAVPTSIEQLPNGQL-KVTHTFGEG------IYDTVLNATGRYPDVSGLNLSAAGVGL  440
              G   TS E   NG + K+T    +G        DTVL ATGR    +GL L   G+  
Sbjct  153  KFGTKVTSSEV--NGDVVKLTTEPSKGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQT  210

Query  441  NPKTGRIAVTHE-QTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKV  499
            + K GRI V    +T  P I+A+GDVI G  L   A + G    + +      +  Y  V
Sbjct  211  D-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAV  268

Query  500  CTAVFTPIEYGCCGLSEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-ECYCKLI  557
               ++T  E+   G +E+  ++A G + N+G +     P+  + S  R +A+ +   K++
Sbjct  269  PGVIYTFPEFASVGKTEEE-LKAEGIEYNVGKF-----PM-MANSRARTVAESDGLVKVL  321

Query  558  VDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  322  ADK-KTDKLLGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYSO_562795
Length=415

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 88/326 (27%), Positives = 136/326 (42%), Gaps = 21/326 (6%)

Query  298  LIAVGGRP--KSLDCPGADLAISSDDIFSRPTP--PGKTLVVGASYVALECAGFLKG-QG  352
            LIA G RP    L      + I SD I SR     P   +V+GA  + +E A  +    G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  353  FDVTVMV-RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFG  411
              VTV+  R  +L   D ++ + + TY  +     F+ G     +E   N ++KV    G
Sbjct  140  HSVTVVDGRPDILSFCDREIISNL-TYEMQSNGARFLLGETVKKVETTEN-RVKVFFDSG  197

Query  412  EGIY-DTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHE-QTSTPHIYAVGDVIDGP  469
            + +  D +L   GR     GLNL A G+  N + G I V    QT  PHIYA GD I  P
Sbjct  198  KVLSADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDCIGAP  256

Query  470  ELTPVAIQAGRLLSKRLFDNSATLMAYDKVCT-----AVFTPIEYGCCGLSEDAAVEAIG  524
             L   +++ GRL S  +++    L    ++        ++T  E    G +E    +   
Sbjct  257  ALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTEQQLTKDCV  316

Query  525  ADNLGVYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVG  584
               +G+   S    E +             K++ D     ++ G H +G  A E+     
Sbjct  317  NYEVGIAKYS----ELAKGQMMGAMAGGTLKILFD-PDTLKLFGVHAIGEGATEIIHIGQ  371

Query  585  IAIKLNASYEDFVSTVGIHPTTAEIF  610
            +A+ +  S   F   V  +PT AE +
Sbjct  372  VAMAMGCSLTYFRDAVFNYPTLAEAY  397

>PPTG_24712
Length=67

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 3/62 (5%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +D +VIGGGSGG+A+++ AA +G KVLV   V+   +    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFN  63

Query  211  SA  212
            +A
Sbjct  64   TA  65

>HYAP_13613
Length=423

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/226 (25%), Positives = 90/226 (40%), Gaps = 27/226 (12%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQ  210
            +DLVVIG G      + ++AK G++V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  211  SAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLG  270
             A++    ++    +G +    T     ++  VQ  +       R  L+  +V       
Sbjct  85   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  143

Query  271  TFKDAHTLTLTNPAKGKPPKD-------------VTFRRALIAVGGRP--KSLDCPGADL  315
             F+ AH +++      K   +             V   + L+A G RP    L      +
Sbjct  144  RFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKI  203

Query  316  AISSDDIFSRPTP--PGKTLVVGASYVALECAGFLK-GQGFDVTVM  358
             I SD I  R     P   +VVGA  + +E A  +    G  VTV+
Sbjct  204  VIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMINVVPGHSVTVV  249

>PITG_19802
Length=185

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 45/158 (28%), Positives = 79/158 (50%), Gaps = 11/158 (7%)

Query  455  STPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGL  514
            S P I+A+GDVI G  L   A + G    + +      +  Y  +   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGK  81

Query  515  SEDAAVEAIGAD-NLGVYHQSFTPLEWSLSHDRALAK-ECYCKLIVDRTQNDRVVGFHYL  572
            +E+  ++A G + N+G +     P+  + S  R +A+ +   K++ D+ + D+++G H +
Sbjct  82   TEEE-LKAEGIEYNVGKF-----PM-MANSRARTIAEADGLVKVLADK-KTDKLLGVHII  133

Query  573  GPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
              NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  134  AGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>SPRG_04231
Length=90

 Score = 44.7 bits (104),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  562  QNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTL  613
            ++  VVG H  G  A E+ Q  G+A+K+ A   DF + V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>HYAP_08068
Length=100

 Score = 41.2 bits (95),  Expect = 0.002, Method: Composition-based stats.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 1/56 (2%)

Query  555  KLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
            K++ D+ + D+++G H +  NAGE+     I I+  A+ ED   T   HPT +E F
Sbjct  17   KVLADK-KTDKLLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  71

>PYIW_27568
Length=128

 Score = 42.0 bits (97),  Expect = 0.002, Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 12/118 (10%)

Query  496  YDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALA---KEC  552
            Y+ +   ++T  E    G +E+   E   A N+G +     P+   +++ RA A    + 
Sbjct  6    YNAIPGVIYTFPEVASVGKTEEQLKEEGVAYNVGKF-----PM---MANSRARAVGEADG  57

Query  553  YCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
              K+I D+   D+++G H +  NAGE+     + ++  A+ ED   T   HPT +E F
Sbjct  58   LVKVIADKA-TDKILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>SPRG_17626
Length=148

 Score = 39.7 bits (91),  Expect = 0.013, Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 49/115 (43%), Gaps = 6/115 (5%)

Query  496  YDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHDRALAKECYCK  555
            Y+ +   V+T  E    G +E+    A  A N+G +         ++       K     
Sbjct  26   YNAIPGVVYTFPEVASVGKTEEELKAANVAYNVGKFPMMANSRARTVGETDGFVK-----  80

Query  556  LIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIF  610
             I+    +D+++G H +  NAGE+     + ++  AS ED   T   HPT +E F
Sbjct  81   -ILAAKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>HYAP_03065
Length=701

 Score = 37.4 bits (85),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 59/139 (42%), Gaps = 24/139 (17%)

Query  218  LHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLN-FKYRVDLRDKKVKYENFLGTFKDAH  276
            L   A+A G       F+  K++   +++   L  F+ ++ LR   VK    LG   +A 
Sbjct  400  LFDQADAIG-----GQFNMAKIVPGKEEFYETLRYFEKQLKLRGVNVK----LGHRVEAA  450

Query  277  TLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD--LAISSDDIFSRPTPPG-KTL  333
             L               F + +IA G  P+SL  PGAD    +S  D+     P G K  
Sbjct  451  ELM-----------SGAFDKVVIATGVVPRSLTIPGADHPKVLSYIDVLKNEAPVGQKVA  499

Query  334  VVGASYVALECAGFLKGQG  352
            ++GA  +  + A FL  +G
Sbjct  500  IIGAGGIGFDVAEFLTHEG  518

>SDRG_06501
Length=623

 Score = 37.0 bits (84),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  139  HANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            + ND    A  D D+++IGGG+ G A +   AK G+KVLV +
Sbjct  113  YTNDKYTEANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>PYAP_15943
Length=139

 Score = 35.0 bits (79),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD VV+GGG  GL A+   AK G++V VL+
Sbjct  14   WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>SPRG_11641
Length=623

 Score = 37.0 bits (84),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  139  HANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            + ND    A  D D+++IGGG+ G A +   AK G+KVLV +
Sbjct  113  YTNDKYTEANRDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>SPRG_18643
Length=85

 Score = 33.9 bits (76),  Expect = 0.49, Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            A+  +DLVVIG G  G   + ++AK+G+KV ++D
Sbjct  45   ASEHFDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>CCI40989
Length=552

 Score = 36.6 bits (83),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query  143  VDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGC  202
            +D      WD V+IGGG  GL A+   AK G++V VL+            +GG  V    
Sbjct  6    IDHIIRKKWDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEI  57

Query  203  IPKKLMHQSAIMGELLHKD  221
             P  L  +++ +  L   D
Sbjct  58   FPGFLFSRASYVFSLFRPD  76

>PITG_02760
Length=165

 Score = 34.7 bits (78),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>PPTG_03449
Length=350

 Score = 35.4 bits (80),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (43%), Gaps = 5/117 (4%)

Query  105  GAGTKFVGGCDDTLAFFRSR---TQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSG  161
            GA T      D+ L F + +     +      P     AN   +G   D  +V+  GGSG
Sbjct  189  GATTIITSSSDEKLQFVKEKFGFEYTFNYRKTPEWAAEANRFTNGRGVD--IVIETGGSG  246

Query  162  GLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELL  218
             +A S EA K G ++ V+ ++  + Q     + G  +N GC  + +   S  + E L
Sbjct  247  TIAQSMEAIKPGGQIAVIGFLFRAKQEEMPDVAGMVLNKGCTVRGVQIGSKQLTEEL  303

>SDRG_05159
Length=551

 Score = 35.8 bits (81),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIP  204
            T  WD V++GGG  GL A+   AK G+ V VL+            LGG  V    IP
Sbjct  12   TRQWDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIP  60

>H310_06296
Length=590

 Score = 35.0 bits (79),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            D D++VIG G GGL  +   AK G++VLVL+
Sbjct  62   DLDVIVIGSGMGGLTVAAALAKEGKRVLVLE  92

>PHYKE_5677
Length=211

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>PYVX_18330
Length=558

 Score = 35.0 bits (79),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G++V VL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PYU1_G004385
Length=562

 Score = 35.0 bits (79),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G++V VL+
Sbjct  13   WDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PHYCA_118996
Length=703

 Score = 34.7 bits (78),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 69/165 (42%), Gaps = 27/165 (16%)

Query  218  LHKDAEAFGWAVPNATFDWTKLITSVQDYIHGLN-FKYRVDLRDKKVKYENFLGTFKDAH  276
            L   AEA G       F+  K I   +++   L  F+ ++ L+   VK    LG  + A 
Sbjct  402  LFDQAEAIG-----GQFNMAKTIPGKEEFYETLRYFEKQLKLKGVNVK----LG--QRAE  450

Query  277  TLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGAD--LAISSDDIFSRPTPPGKTL-  333
               L N A         F + +IA G  P+SL   GAD    +S  D+     P GK + 
Sbjct  451  VEDLANGA---------FDKVVIATGVLPRSLKIQGADHPKVLSYVDVLKNKAPVGKRVA  501

Query  334  VVGASYVALECAGFLKGQGFDVTVMVRSILLR--GFDTDMAARIG  376
            ++GA  +  + A FL   G + T     +  R  G DT  + R G
Sbjct  502  IIGAGGIGFDVAEFLAHVG-EATSSSVDVFAREWGIDTSNSVRGG  545

>PPTG_05518
Length=554

 Score = 34.3 bits (77),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>SPRG_08354
Length=550

 Score = 34.3 bits (77),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 8/55 (15%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPK  205
            WD V++GGG  GL A+   AK G+ V VL+            LGG  V    IP 
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPN  61

>H310_07705
Length=546

 Score = 33.9 bits (76),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            WD +V+GGG  GL A+   AK G+ V VL+
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE  41

>SDRG_02305
Length=387

 Score = 33.5 bits (75),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSP-QGSTWG  192
            T D+D++V+G G+ G +A    AK GQ+VL L+   P+  +GS+ G
Sbjct  5    TTDYDVIVLGVGAMGSSACYHLAKRGQRVLGLEQFGPAHNRGSSHG  50

>PPTG_00491
Length=1542

 Score = 33.9 bits (76),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 40/91 (44%), Gaps = 14/91 (15%)

Query  294   FRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGF  353
              RR    VGG P S   PGA  AI +    S+  PP   L V   +      GF++    
Sbjct  1206  IRRIDTFVGGVPASSKAPGATGAILTR---SQTAPPSSYLKVKFEF----SHGFMRA---  1255

Query  354   DVTVMVRSILLRGFDTDMAARIGTYMEEEAK  384
                 ++R  LLRG    + AR+  + E++ K
Sbjct  1256  ----VIRDQLLRGQLDKLNARVADFREQQQK  1282

>SPRG_05072
Length=387

 Score = 33.5 bits (75),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query  148  TYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSP-QGSTWG  192
            T D+D++V+G G+ G +A    AK GQ+VL L+   P+  +GS+ G
Sbjct  5    TTDYDVIVLGVGAMGSSACYHLAKRGQRVLGLEQFGPAHCRGSSHG  50

>SPRG_14085
Length=340

 Score = 33.1 bits (74),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query  188  GSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKLITSVQDYI  247
            G+TW    T +++ C+  + M    +   L  +DA         A+F W+  IT +Q  +
Sbjct  136  GATWN---TPMDLQCV-MEYMDAGDLRDHLSRQDA---------ASFPWSAKITCLQAVV  182

Query  248  HGLNFKYRVDLRDKKVKYENFLGTFKDAHTL  278
            HGL + + + +  + +K  N L   K  + L
Sbjct  183  HGLGYLHSLSIIHRDLKSRNVLLDTKKGYKL  213

>PYIW_14781
Length=339

 Score = 32.7 bits (73),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGG  195
            D D+++ G GS GL A+ E +KY    + L     +P G  W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>PHYRA_75618
Length=400

 Score = 32.7 bits (73),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 0/34 (0%)

Query  147  ATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            AT  +D+VV+G G  G AA+  AAK G++VL+L+
Sbjct  2    ATPVYDVVVVGAGLMGSAAAYYAAKEGKRVLLLE  35

>PYU1_G009988
Length=284

 Score = 32.7 bits (73),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGG  195
            D D+++ G GS GL A+ E +KY    + L     +P G  W LGG
Sbjct  28   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  72

>PYIR_13610
Length=339

 Score = 32.7 bits (73),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  150  DWDLVVIGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGG  195
            D D+++ G GS GL A+ E +KY    + L     +P G  W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>PPTG_16294
Length=406

 Score = 32.7 bits (73),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            +D+V++G G  G AA+  AAK G++VLVL+
Sbjct  6    YDVVIVGAGLMGSAAAYYAAKQGKRVLVLE  35

>PHYSO_261176
Length=541

 Score = 32.3 bits (72),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  151  WDLVVIGGGSGGLAASKEAAKYGQKVLVLD  180
            W+ +V+GGG  GL A+   AK G+ V VL+
Sbjct  12   WNAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>CCA23237
Length=2179

 Score = 32.7 bits (73),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 23/77 (30%), Positives = 34/77 (44%), Gaps = 9/77 (12%)

Query  305  PKSLDCPGADLAISSDDIF-----SRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMV  359
            P  ++C  +DL I    +      S  T P   L V   + +++   FL GQG D    V
Sbjct  596  PLLMECIRSDLLIGVRALLGEGFESNSTDPESPLCVAVQHASMDLVRFLVGQGAD----V  651

Query  360  RSILLRGFDTDMAARIG  376
            R+  L G    +A R+G
Sbjct  652  RACSLSGTPLHIAVRLG  668

Lambda      K        H        a         alpha
   0.318    0.134    0.409    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 48871604694

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40