Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_13678841541518920.0
SPRG_08854841241115080.0
H257_0615281501233524e-39
H257_191041475292141393462e-37
H257_076411414641871393424e-37
H310_025611483322561123397e-36
H310_152921516152301223324e-35
H310_05293148919143983244e-35
H310_083391495022301113272e-34
H310_128321475292581413258e-34
H310_046841487961081003066e-33
H310_128941507262571223187e-33
H310_090711496731121003058e-33
H310_117551279882591223116e-32
H257_152351452591781203031e-31
H310_152911516142341123071e-31
H310_131061507792131903052e-31
H310_093731497191091002911e-30
SPRG_11320127988274992971e-29
H310_069331492172591382952e-29
H310_133066810231992913e-29
H310_141461510531091002734e-28
H310_09765149867115992734e-28
SPRG_085731264412651062793e-27
H257_0943468102571122774e-27
SDRG_174061264412641062784e-27
SDRG_173901384462641062784e-27
H310_147381512712551202774e-27
SPRG_059291250402651062768e-27
H257_152221279882541142652e-25
H310_04120148668138992562e-25
H310_078491493931921072551e-24
SPRG_06030125093196902551e-24
PHYCA_504729440671831042215e-20
PITG_0001081841072181e-19
H310_14154151059178752102e-18
PHYCA_7065639241113892042e-18
PHYCA_559326453551821042092e-18
PPTG_14663229201461162021e-17
PHYCA_112118416261341101948e-17
PHYCA_120807423971341021922e-16
PHYCA_49721384681031001874e-16
PHYCA_13159382541871959e-16
PPTG_079328289961906e-15
H310_04124148672811001758e-15
H310_127141506653771091911e-14
H257_166701460131361141791e-14
H310_15369151671209531822e-14
H310_116081503392211221771e-13
H310_14898151339140731693e-13
PITG_0907275282611141763e-13
SDRG_1516315173292981756e-13
PYAP_15403984871141011647e-13
SPRG_00310122252254521711e-12
H257_06253151732371101701e-12
SPRG_18045132786215611672e-12
H310_14414151141169951642e-12
SPRG_1416015173319981703e-12
H310_04318148723179601634e-12
PPTG_0333875282601141631e-11
PHYSO_38364868103191011623e-11
PHALS_0885768103521011624e-11
PITG_0817268103201511597e-11
PHYRA_7865668103471011608e-11
H257_13889144500138851491e-10
PPTG_1426468103351011572e-10
SDRG_1729413838568541403e-10
HYAP_1401068103031011534e-10
H310_1058115173241951505e-10
H257_19201147615102831425e-10
H257_18551147094221851496e-10
H310_10257150011309531501e-09
PHYRA_7808875282611211481e-09
PPTG_02416186271251161411e-09
H257_190191474622291021462e-09
CCA1434668103251881482e-09
PHYSO_29581948124193921432e-09
H257_09254142226141991393e-09
SDRG_06597124701317931455e-09
PHYCA_51041568103371011455e-09
PYVX_1371968103171071447e-09
SPRG_05316124701325931447e-09
SPRG_18521133223291921437e-09
H257_18379146985155991378e-09
PHYSO_36201775282731221428e-09
H257_09852142494165871378e-09
PYU1_G004359940552371511419e-09
PHYCA_53024375282691211411e-08
PHYKE_158868103331511421e-08
PHYCA_10416540824231921382e-08
PYAP_24609101386405961412e-08
H257_077551415151811021343e-08
H257_01994139112222921354e-08
H257_02519139347268891374e-08
H257_17235146326186981334e-08
H257_07871141565201841335e-08
H310_0346314854952871235e-08
H257_194361478181991011335e-08
H310_13824150948169511308e-08
PHYCA_9638540009135921289e-08
H257_1948814786256551219e-08
PPTG_0906321014273791331e-07
PPTG_15787233481261261242e-07
PHYCA_132727435852611121293e-07
H257_047781402451471031234e-07
PHYCA_11835042180156921235e-07
PPTG_1128321750260791268e-07
PPTG_0460119419260791268e-07
H310_0385114862897761178e-07
H310_14954151362149891219e-07
H310_13843150953118531181e-06
H310_135691387692051441221e-06
H257_151501452021451171191e-06
H310_0847614954446411122e-06
H257_09054142124151931192e-06
PHYKE_61627528201611212e-06
PHYCA_125686427852901131242e-06
PPTG_0379119179108441162e-06
H257_139784945172851183e-06
H257_18023146763128921153e-06
SDRG_08699136439168381174e-06
H310_15319141984227891186e-06
H257_02095139158198571176e-06
SDRG_12398126788264921189e-06
SPRG_09172126788265921189e-06
PYIW_25568165102126601121e-05
H257_12325143695191861151e-05
H257_140131445542171391161e-05
PPTG_0584319760169661131e-05
H310_033851485332231351132e-05
PPTG_1136821782130951093e-05
H310_15068151450108831064e-05
PPTG_1696423739104811054e-05
PPTG_2167826348104741055e-05
H257_056481406691721181086e-05
H257_17402130747149851076e-05
H257_12998144050141991067e-05
H257_03945139940230831098e-05
H257_00377138602223911099e-05
PHYCA_1247124370202581089e-05
PYIW_256581651681481011051e-04
PHYSO_5364564370212611081e-04
H257_148891450601571011051e-04
PYIW_15058163014131611032e-04
PPTG_0411819262274811082e-04
PITG_1909815173295881082e-04
PHYCA_3898337995217881062e-04
H257_141501446051191071012e-04
PITG_1268610320223881062e-04
PHYSO_38959779261881271052e-04
H257_080321267882511121053e-04
PHYSO_5480724947362991055e-04
H257_13434144330236851035e-04
PITG_051314370200791025e-04
PHYCA_482815173295881045e-04
PHYCA_9897140275295881045e-04
H257_07657141475212861035e-04
PHYCA_14089370601991361025e-04
PHYCA_5038334947313921045e-04
PHYRA_86617731402411031036e-04
PPTG_248541513291781038e-04
H257_06895141114202731018e-04
PPTG_1114421711251781028e-04
PPTG_0635119972225661018e-04
H310_04215126788257891029e-04
H257_13170144141198851009e-04
PHYCA_627513908811693960.001
PPTG_0379719183210781000.001
PHYSO_3892685437810760950.001
PHYKE_40014947496921020.001
CCI474956810285971000.002
H257_18543147089323881010.002
PYIW_23282163818227134990.002
PHYRA_748847926241103980.002
H257_00956138769202145970.002
PPTG_197792488231979990.002
PHYSO_34030752668479921000.003
SDRG_0465312770024368980.003
PHYSO_4539765596213886940.003
H257_0883714198422591970.003
H310_151461515067657900.003
H257_1815215041920992960.003
H310_083831495107157890.004
H310_0392114864510444910.004
SDRG_1549913785727885970.004
HYAP_00630494543296980.004
PYU1_G01069696215297101970.004
SDRG_1726613836027885960.005
PPTG_066332005729278960.005
H257_0960514239823588960.005
H310_0422614405023687960.005
H257_0535614052022496950.005
PHYSO_516255494541297970.006
H257_0320813963010548890.006
PYAR_2470010589115491920.007
H310_119511504298154870.007
H310_1516015151420094930.007
H257_0527214048513380900.008
PPTG_160832345724175940.008
PHYSO_3762805399013896900.008
PHYSO_3174884970941197950.009
PHYSO_3805055415613884900.010
H310_0346214309624385930.011
H257_0475114022911974880.011
PHYSO_3736135388313088890.012
PHYSO_4703815643814586890.012
PHYRA_9367812693217106910.015
PHYSO_25418146288154102890.017
H310_04474148763210100910.018
H257_1298614403938580920.019
PPTG_067232008814975880.022
PPTG_143662282728393910.023
H257_1194214347223279900.025
PHYSO_3257635052815786870.028
PPTG_002704970924995890.031
PPTG_00272494743697910.032
HYAP_0677812693224103890.034
H310_1407513860221789880.039
H310_151811515299350820.044
H310_1058015010319989870.048
PHYCA_1292304312114139850.049
H257_0494814033424785870.053
H257_0615114084213971840.055
PHALS_0640912693227102870.060
SPRG_108361277008243800.065
PPTG_00266494543791880.069
H310_1186815041711787820.071
H257_1099914304524430860.073
PHYRA_787617075118479850.076
H257_16845146121209115850.082
H257_1321214418115379830.094
SPRG_04833792621983850.099
PPTG_085002082528578860.10
PITG_1573812693227102850.10
PHYCA_5041341269320596840.13
PPTG_1829612693248102840.13
H257_1449914480717091820.14
PHYSO_3546991269320696830.14
H257_1341614431723276840.15
H257_0866914191521285830.16
H257_0466614019620674830.17
H257_1070714290821396830.18
PYIW_2636316568514483800.19
H257_15530145393237127820.24
PHYSO_44811255854115108780.26
PHYSO_34079052729270104820.30
PYAP_2397210104459854830.31
H257_1475914495919886800.32
PYVX_1780812693230106810.33
PPTG_20418210521994800.35
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_13678

Length=415
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_13678                                                            733        0.0  
SPRG_08854                                                            585        0.0  
H257_06152                                                            140        4e-39
H257_19104                                                            137        2e-37
H257_07641                                                            136        4e-37
H310_02561                                                            135        7e-36
H310_15292                                                            132        4e-35
H310_05293                                                            129        4e-35
H310_08339                                                            130        2e-34
H310_12832                                                            129        8e-34
H310_04684                                                            122        6e-33
H310_12894                                                            127        7e-33
H310_09071                                                            122        8e-33
H310_11755                                                            124        6e-32
H257_15235                                                            121        1e-31
H310_15291                                                            122        1e-31
H310_13106                                                            122        2e-31
H310_09373                                                            116        1e-30
SPRG_11320                                                            119        1e-29
H310_06933                                                            118        2e-29
H310_13306                                                            116        3e-29
H310_14146                                                            109        4e-28
H310_09765                                                            109        4e-28
SPRG_08573                                                            112        3e-27
H257_09434                                                            111        4e-27
SDRG_17406                                                            111        4e-27
SDRG_17390                                                            111        4e-27
H310_14738                                                            111        4e-27
SPRG_05929                                                            110        8e-27
H257_15222                                                            106        2e-25
H310_04120                                                            103        2e-25
H310_07849                                                            102        1e-24
SPRG_06030                                                            102        1e-24
PHYCA_504729                                                          89.7       5e-20
PITG_00010                                                            88.6       1e-19
H310_14154                                                            85.5       2e-18
PHYCA_70656                                                           83.2       2e-18
PHYCA_559326                                                          85.1       2e-18
PPTG_14663                                                            82.4       1e-17
PHYCA_112118                                                          79.3       8e-17
PHYCA_120807                                                          78.6       2e-16
PHYCA_49721                                                           76.6       4e-16
PHYCA_131593                                                          79.7       9e-16
PPTG_07932                                                            77.8       6e-15
H310_04124                                                            72.0       8e-15
H310_12714                                                            78.2       1e-14
H257_16670                                                            73.6       1e-14
H310_15369                                                            74.7       2e-14
H310_11608                                                            72.8       1e-13
H310_14898                                                            69.7       3e-13
PITG_09072                                                            72.4       3e-13
SDRG_15163                                                            72.0       6e-13
PYAP_15403                                                            67.8       7e-13
SPRG_00310                                                            70.5       1e-12
H257_06253                                                            70.1       1e-12
SPRG_18045                                                            68.9       2e-12
H310_14414                                                            67.8       2e-12
SPRG_14160                                                            70.1       3e-12
H310_04318                                                            67.4       4e-12
PPTG_03338                                                            67.4       1e-11
PHYSO_383648                                                          67.0       3e-11
PHALS_08857                                                           67.0       4e-11
PITG_08172                                                            65.9       7e-11
PHYRA_78656                                                           66.2       8e-11
H257_13889                                                            62.0       1e-10
PPTG_14264                                                            65.1       2e-10
SDRG_17294                                                            58.5       3e-10
HYAP_14010                                                            63.5       4e-10
H310_10581                                                            62.4       5e-10
H257_19201                                                            59.3       5e-10
H257_18551                                                            62.0       6e-10
H310_10257                                                            62.4       1e-09
PHYRA_78088                                                           61.6       1e-09
PPTG_02416                                                            58.9       1e-09
H257_19019                                                            60.8       2e-09
CCA14346                                                              61.6       2e-09
PHYSO_295819                                                          59.7       2e-09
H257_09254                                                            58.2       3e-09
SDRG_06597                                                            60.5       5e-09
PHYCA_510415                                                          60.5       5e-09
PYVX_13719                                                            60.1       7e-09
SPRG_05316                                                            60.1       7e-09
SPRG_18521                                                            59.7       7e-09
H257_18379                                                            57.4       8e-09
PHYSO_362017                                                          59.3       8e-09
H257_09852                                                            57.4       8e-09
PYU1_G004359                                                          58.9       9e-09
PHYCA_530243                                                          58.9       1e-08
PHYKE_1588                                                            59.3       1e-08
PHYCA_104165                                                          57.8       2e-08
PYAP_24609                                                            58.9       2e-08
H257_07755                                                            56.2       3e-08
H257_01994                                                            56.6       4e-08
H257_02519                                                            57.4       4e-08
H257_17235                                                            55.8       4e-08
H257_07871                                                            55.8       5e-08
H310_03463                                                            52.0       5e-08
H257_19436                                                            55.8       5e-08
H310_13824                                                            54.7       8e-08
PHYCA_96385                                                           53.9       9e-08
H257_19488                                                            51.2       9e-08
PPTG_09063                                                            55.8       1e-07
PPTG_15787                                                            52.4       2e-07
PHYCA_132727                                                          54.3       3e-07
H257_04778                                                            52.0       4e-07
PHYCA_118350                                                          52.0       5e-07
PPTG_11283                                                            53.1       8e-07
PPTG_04601                                                            53.1       8e-07
H310_03851                                                            49.7       8e-07
H310_14954                                                            51.2       9e-07
H310_13843                                                            50.1       1e-06
H310_13569                                                            51.6       1e-06
H257_15150                                                            50.4       1e-06
H310_08476                                                            47.8       2e-06
H257_09054                                                            50.4       2e-06
PHYKE_6162                                                            51.2       2e-06
PHYCA_125686                                                          52.4       2e-06
PPTG_03791                                                            49.3       2e-06
H257_13978                                                            50.1       3e-06
H257_18023                                                            48.9       3e-06
SDRG_08699                                                            49.7       4e-06
H310_15319                                                            50.1       6e-06
H257_02095                                                            49.7       6e-06
SDRG_12398                                                            50.1       9e-06
SPRG_09172                                                            50.1       9e-06
PYIW_25568                                                            47.8       1e-05
H257_12325                                                            48.9       1e-05
H257_14013                                                            49.3       1e-05
PPTG_05843                                                            48.1       1e-05
H310_03385                                                            48.1       2e-05
PPTG_11368                                                            46.6       3e-05
H310_15068                                                            45.4       4e-05
PPTG_16964                                                            45.1       4e-05
PPTG_21678                                                            45.1       5e-05
H257_05648                                                            46.2       6e-05
H257_17402                                                            45.8       6e-05
H257_12998                                                            45.4       7e-05
H257_03945                                                            46.6       8e-05
H257_00377                                                            46.6       9e-05
PHYCA_124712                                                          46.2       9e-05
PYIW_25658                                                            45.1       1e-04
PHYSO_536456                                                          46.2       1e-04
H257_14889                                                            45.1       1e-04
PYIW_15058                                                            44.3       2e-04
PPTG_04118                                                            46.2       2e-04
PITG_19098                                                            46.2       2e-04
PHYCA_38983                                                           45.4       2e-04
H257_14150                                                            43.5       2e-04
PITG_12686                                                            45.4       2e-04
PHYSO_389597                                                          45.1       2e-04
H257_08032                                                            45.1       3e-04
PHYSO_548072                                                          45.1       5e-04
H257_13434                                                            44.3       5e-04
PITG_05131                                                            43.9       5e-04
PHYCA_4828                                                            44.7       5e-04
PHYCA_98971                                                           44.7       5e-04
H257_07657                                                            44.3       5e-04
PHYCA_14089                                                           43.9       5e-04
PHYCA_503833                                                          44.7       5e-04
PHYRA_86617                                                           44.3       6e-04
PPTG_24854                                                            44.3       8e-04
H257_06895                                                            43.5       8e-04
PPTG_11144                                                            43.9       8e-04
PPTG_06351                                                            43.5       8e-04
H310_04215                                                            43.9       9e-04
H257_13170                                                            43.1       9e-04
PHYCA_62751                                                           41.6       0.001
PPTG_03797                                                            43.1       0.001
PHYSO_389268                                                          41.2       0.001
PHYKE_4001                                                            43.9       0.001
CCI47495                                                              43.1       0.002
H257_18543                                                            43.5       0.002
PYIW_23282                                                            42.7       0.002
PHYRA_74884                                                           42.4       0.002
H257_00956                                                            42.0       0.002
PPTG_19779                                                            42.7       0.002
PHYSO_340307                                                          43.1       0.003
SDRG_04653                                                            42.4       0.003
PHYSO_453976                                                          40.8       0.003
H257_08837                                                            42.0       0.003
H310_15146                                                            39.3       0.003
H257_18152                                                            41.6       0.003
H310_08383                                                            38.9       0.004
H310_03921                                                            39.7       0.004
SDRG_15499                                                            42.0       0.004
HYAP_00630                                                            42.4       0.004
PYU1_G010696                                                          42.0       0.004
SDRG_17266                                                            41.6       0.005
PPTG_06633                                                            41.6       0.005
H257_09605                                                            41.6       0.005
H310_04226                                                            41.6       0.005
H257_05356                                                            41.2       0.005
PHYSO_516255                                                          42.0       0.006
H257_03208                                                            38.9       0.006
PYAR_24700                                                            40.0       0.007
H310_11951                                                            38.1       0.007
H310_15160                                                            40.4       0.007
H257_05272                                                            39.3       0.008
PPTG_16083                                                            40.8       0.008
PHYSO_376280                                                          39.3       0.008
PHYSO_317488                                                          41.2       0.009
PHYSO_380505                                                          39.3       0.010
H310_03462                                                            40.4       0.011
H257_04751                                                            38.5       0.011
PHYSO_373613                                                          38.9       0.012
PHYSO_470381                                                          38.9       0.012
PHYRA_93678                                                           39.7       0.015
PHYSO_254181                                                          38.9       0.017
H310_04474                                                            39.7       0.018
H257_12986                                                            40.0       0.019
PPTG_06723                                                            38.5       0.022
PPTG_14366                                                            39.7       0.023
H257_11942                                                            39.3       0.025
PHYSO_325763                                                          38.1       0.028
PPTG_00270                                                            38.9       0.031
PPTG_00272                                                            39.7       0.032
HYAP_06778                                                            38.9       0.034
H310_14075                                                            38.5       0.039
H310_15181                                                            36.2       0.044
H310_10580                                                            38.1       0.048
PHYCA_129230                                                          37.4       0.049
H257_04948                                                            38.1       0.053
H257_06151                                                            37.0       0.055
PHALS_06409                                                           38.1       0.060
SPRG_10836                                                            35.4       0.065
PPTG_00266                                                            38.5       0.069
H310_11868                                                            36.2       0.071
H257_10999                                                            37.7       0.073
PHYRA_78761                                                           37.4       0.076
H257_16845                                                            37.4       0.082
H257_13212                                                            36.6       0.094
SPRG_04833                                                            37.4       0.099
PPTG_08500                                                            37.7       0.10 
PITG_15738                                                            37.4       0.10 
PHYCA_504134                                                          37.0       0.13 
PPTG_18296                                                            37.0       0.13 
H257_14499                                                            36.2       0.14 
PHYSO_354699                                                          36.6       0.14 
H257_13416                                                            37.0       0.15 
H257_08669                                                            36.6       0.16 
H257_04666                                                            36.6       0.17 
H257_10707                                                            36.6       0.18 
PYIW_26363                                                            35.4       0.19 
H257_15530                                                            36.2       0.24 
PHYSO_448112                                                          34.7       0.26 
PHYSO_340790                                                          36.2       0.30 
PYAP_23972                                                            36.6       0.31 
H257_14759                                                            35.4       0.32 
PYVX_17808                                                            35.8       0.33 
PPTG_20418                                                            35.4       0.35 
PYAR_22001                                                            34.7       0.36 
PPTG_15516                                                            35.8       0.43 
H310_15108                                                            35.0       0.44 
PHYKE_6913                                                            36.2       0.47 
H257_00966                                                            33.1       0.49 
H257_07182                                                            35.0       0.50 
PITG_05827                                                            35.4       0.54 
CCI48126                                                              35.4       0.64 
H257_19278                                                            32.7       0.70 
H257_00300                                                            35.0       0.76 
H257_05753                                                            35.0       0.78 
PHYSO_492787                                                          33.5       0.87 
PYIW_24031                                                            34.7       0.93 
SPRG_20431                                                            35.0       1.0  
PYU1_G013607                                                          34.7       1.1  
PHYSO_474101                                                          33.5       1.1  
PPTG_06289                                                            34.3       1.2  
PYU1_G008728                                                          33.9       1.3  
PHYSO_435001                                                          33.1       1.3  
PYVX_23885                                                            34.3       1.3  
H310_02842                                                            31.6       1.4  
PYIW_22501                                                            33.9       1.4  
PITG_08385                                                            33.5       1.5  
H310_14152                                                            32.0       1.5  
PHYSO_377140                                                          32.3       1.6  
PPTG_24941                                                            33.9       1.6  
PHYCA_14293                                                           33.1       1.6  
PYIW_27222                                                            31.6       1.7  
H310_02086                                                            31.6       1.8  
PYAP_22042                                                            33.9       1.9  
H257_00165                                                            33.9       2.0  
PHYSO_378731                                                          32.3       2.0  
PPTG_10963                                                            33.9       2.1  
H257_08839                                                            32.3       2.5  
PHYCA_117021                                                          33.1       2.7  
PYAP_17700                                                            33.1       2.8  
PPTG_09125                                                            33.5       3.1  
H257_16195                                                            32.3       3.5  
PYIW_15637                                                            32.7       3.6  
SDRG_15492                                                            32.3       3.7  
PITG_00212                                                            33.1       3.7  
SDRG_08046                                                            32.7       5.2  
PHYSO_560624                                                          32.3       5.2  
CCA26416                                                              32.3       5.3  
PHYSO_330097                                                          32.0       5.6  
H310_05657                                                            30.4       6.1  
PYU1_G003801                                                          32.0       6.1  
PHYCA_100220                                                          32.0       6.3  
H310_11831                                                            32.3       6.5  
H257_18654                                                            31.2       6.5  
H257_01792                                                            31.2       6.5  
H257_13222                                                            31.6       6.6  
PHYRA_84895                                                           31.2       7.2  
PYAP_22661                                                            31.6       7.3  
PYIW_25163                                                            30.4       7.4  
PYU1_G009131                                                          32.0       7.9  
H310_04308                                                            30.8       8.0  
PITG_09590                                                            31.2       9.2  
PHYCA_19191                                                           31.6       9.6  
H257_18804                                                            31.2       9.8  

>SDRG_13678
Length=415

 Score = 733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/415 (100%), Positives = 415/415 (100%), Gaps = 0/415 (0%)

Query  1    YSLAFGTTMMTGNVADGSSSSPTEGNSTVAETPAVVEssssgaaasasadsQKRKTAFRF  60
            YSLAFGTTMMTGNVADGSSSSPTEGNSTVAETPAVVESSSSGAAASASADSQKRKTAFRF
Sbjct  1    YSLAFGTTMMTGNVADGSSSSPTEGNSTVAETPAVVESSSSGAAASASADSQKRKTAFRF  60

Query  61   RCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAF  120
            RCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAF
Sbjct  61   RCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAF  120

Query  121  KQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPK  180
            KQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPK
Sbjct  121  KQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPK  180

Query  181  TSLLKRKLPETQPPPSTIDYFRTAQQNLVDMNQAMSARSGHNRLSIDRRVPSLHASSGFA  240
            TSLLKRKLPETQPPPSTIDYFRTAQQNLVDMNQAMSARSGHNRLSIDRRVPSLHASSGFA
Sbjct  181  TSLLKRKLPETQPPPSTIDYFRTAQQNLVDMNQAMSARSGHNRLSIDRRVPSLHASSGFA  240

Query  241  SSAYANGAFPGNGAVIDHSVGQVTEAQVDNPARSNGTESLNEREAPVAAGRDTQDRAANG  300
            SSAYANGAFPGNGAVIDHSVGQVTEAQVDNPARSNGTESLNEREAPVAAGRDTQDRAANG
Sbjct  241  SSAYANGAFPGNGAVIDHSVGQVTEAQVDNPARSNGTESLNEREAPVAAGRDTQDRAANG  300

Query  301  PRVESNDEPPVinindddedeapapKARRTESDDLLVIVANAASKLIDVFAKANEIKAGE  360
            PRVESNDEPPVININDDDEDEAPAPKARRTESDDLLVIVANAASKLIDVFAKANEIKAGE
Sbjct  301  PRVESNDEPPVININDDDEDEAPAPKARRTESDDLLVIVANAASKLIDVFAKANEIKAGE  360

Query  361  VQValrkveleearlalerserearFVLERREREMHIEFMKGTLEILKVFASKNS  415
            VQVALRKVELEEARLALERSEREARFVLERREREMHIEFMKGTLEILKVFASKNS
Sbjct  361  VQVALRKVELEEARLALERSEREARFVLERREREMHIEFMKGTLEILKVFASKNS  415

>SPRG_08854
Length=412

 Score = 585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/411 (86%), Positives = 375/411 (91%), Gaps = 4/411 (1%)

Query  9    MMTGNVADGSSSSPTEGNSTVAET-PAVVEssssgaaasasadsQKRKTAFRFRCASDID  67
            MM G+V DGSSSSP EG+STVAET  A   SS++GAAASASADSQKRKTAFRFRCASDID
Sbjct  2    MMPGSVPDGSSSSPAEGSSTVAETISAAESSSANGAAASASADSQKRKTAFRFRCASDID  61

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLST  127
            LLREVVYIQPFAAPHGQTTDRWTKVAT VA+IHGSGITPNNVRKRFDDLMSAFKQDSLST
Sbjct  62   LLREVVYIQPFAAPHGQTTDRWTKVATQVAQIHGSGITPNNVRKRFDDLMSAFKQDSLST  121

Query  128  LRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPKTSLLKRK  187
            LRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPKTSLLKRK
Sbjct  122  LRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPKTSLLKRK  181

Query  188  LPETQPPPSTIDYFRTAQQNLVDMNQAMSAR--SGHNRLSIDRRVPSLHASSGFASSAYA  245
            LPETQPPPSTIDYFRTAQQNLVDMNQ MSAR  S H+RLSIDRRVPSLHAS+G+ASS Y 
Sbjct  182  LPETQPPPSTIDYFRTAQQNLVDMNQTMSARMASSHSRLSIDRRVPSLHASAGYASSTYT  241

Query  246  NGAFPGNGAVIDHSVGQVTEAQVDNPARSNGTESLNEREAPVAAGRD-TQDRAANGPRVE  304
            NGAFPGNGA +DHS    T+A +   ARSN TESLNEREAP A  R  TQDRA NGPRVE
Sbjct  242  NGAFPGNGAAMDHSANAFTDAPLATKARSNDTESLNEREAPAADSRGATQDRAVNGPRVE  301

Query  305  SNDEPPVinindddedeapapKARRTESDDLLVIVANAASKLIDVFAKANEIKAGEVQVa  364
             +D+PPVIN++DDD+D+APAPKARRTESD LLVI ANAASKLIDVFA+ANEIKA EVQVA
Sbjct  302  KSDDPPVINVDDDDDDKAPAPKARRTESDSLLVIAANAASKLIDVFARANEIKAREVQVA  361

Query  365  lrkveleearlalerserearFVLERREREMHIEFMKGTLEILKVFASKNS  415
            LRKVELEEARLALERSERE+RFVLERREREMH+EFMKGTLEILKVFASK S
Sbjct  362  LRKVELEEARLALERSERESRFVLERREREMHMEFMKGTLEILKVFASKTS  412

>H257_06152
Length=150

 Score = 140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 90/123 (73%), Gaps = 0/123 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            Q+ KT FRF+  +D++LL+E+++++P+ APHG+    WT+V  H+ R+ G GIT N  RK
Sbjct  13   QRHKTEFRFKGCTDVELLKEIIHVRPYEAPHGEVHKGWTEVTEHLQRLCGDGITVNATRK  72

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171
            RFDDLM+AF  D+++ LRASG++EEY+ER  LLQDIHD +  ++ RK+  KEE    +ER
Sbjct  73   RFDDLMTAFHADTMAALRASGTDEEYEEREQLLQDIHDLVDAASIRKQTDKEEKAKQNER  132

Query  172  PDS  174
             ++
Sbjct  133  RET  135

>H257_19104
Length=214

 Score = 137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 97/139 (70%), Gaps = 3/139 (2%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            Q+RKTAFRF+  +D++LL+EV+++QP+ APHG+   RWT+V  H+ R++G GIT N  RK
Sbjct  13   QRRKTAFRFKGCTDVELLKEVIHVQPYEAPHGEVRKRWTEVTEHLQRLYGDGITVNATRK  72

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171
            R DDL++AF  ++++ L ASG++EEY+ER  LLQDIH  +  +  +K+  KEE    +ER
Sbjct  73   RSDDLITAFHANTMAALCASGTDEEYEEREQLLQDIHGLVDAAFIQKQTDKEEKAKQNER  132

Query  172  PDSFLEPPK---TSLLKRK  187
             ++  E  +    S +KRK
Sbjct  133  RETNGEKIRDAAMSTMKRK  151

>H257_07641
Length=187

 Score = 136 bits (342),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 94/139 (68%), Gaps = 12/139 (9%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            Q+ KTAFRF+  +D++LL+EV++++P+  PHG+   RWT+V  H+ R++G GIT N  RK
Sbjct  13   QRCKTAFRFKGCTDVELLKEVIHVRPYEGPHGEVRKRWTEVTEHLQRLYGDGITVNATRK  72

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171
            RFDDLM+AF  ++++ LRASG+E++Y+ER  LLQDIHD            KEE    +ER
Sbjct  73   RFDDLMTAFHANTMAALRASGTEQDYEEREQLLQDIHDLTD---------KEEKAKHNER  123

Query  172  PDSFLEPPK---TSLLKRK  187
             ++  E  +    S++KRK
Sbjct  124  RETNGEKIRDAAMSIMKRK  142

>H310_02561
Length=256

 Score = 135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 84/112 (75%), Gaps = 0/112 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +++KTAFR+  ++DIDLL+EVV + P+ AP+GQT+ RW ++  H+ ++HG  +T  + RK
Sbjct  9    KRKKTAFRYSVSADIDLLKEVVMVAPYDAPYGQTSARWEEICDHMRQLHGDSLTTASCRK  68

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKE  163
            RFDDL+SAFK+ +L  LRASG+EEEY ER  L+QDI D M V+  RK+  K+
Sbjct  69   RFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMMDVALLRKKAAKQ  120

>H310_15292
Length=230

 Score = 132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 0/122 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK AF F+ ASD DLL+ V++IQPF AP+     RW +VA ++   HG  +T  + RKR
Sbjct  6    KRKVAFLFKPASDFDLLKVVIHIQPFDAPYEADKTRWEEVAANMCITHGDTLTAVSCRKR  65

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
            FDDL+ AFK D L++LRASG+EEEY ER  L+QDI D M  S  RKR VKEE     E+ 
Sbjct  66   FDDLIVAFKDDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDRKRSVKEEKTAKFEKR  125

Query  173  DS  174
            +S
Sbjct  126  ES  127

>H310_05293
Length=143

 Score = 129 bits (324),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 77/98 (79%), Gaps = 0/98 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK AFRF+ ASD+DLL+EV++IQP+ AP+G    RW +VA ++   +G G+T  + RKR
Sbjct  6    KRKAAFRFKSASDVDLLKEVIHIQPYDAPYGAVKSRWDEVAANMCMTYGDGLTSVSCRKR  65

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  150
            FDDL+ AFK++++S+LRASG+EEEY ER  LLQDI D+
Sbjct  66   FDDLLDAFKRNTISSLRASGTEEEYNEREQLLQDIVDY  103

>H310_08339
Length=230

 Score = 130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (73%), Gaps = 0/111 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +++KTAFRF  ++DIDLL+EVV + PF A +GQT+ RW +V  H+ ++HG+ +T    RK
Sbjct  9    RRKKTAFRFSVSADIDLLKEVVMVVPFDAAYGQTSARWDEVCEHMRQLHGNAMTSVCCRK  68

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
            RFDDL+ AFK+ SL  LRASG+EEEY ER  L+QDI D M ++  RK+  K
Sbjct  69   RFDDLLPAFKKSSLKALRASGTEEEYLERDQLMQDISDMMDIALLRKKAAK  119

>H310_12832
Length=258

 Score = 129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 102/141 (72%), Gaps = 3/141 (2%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            +R TAFRF+  +D++LL+EV +++PF AP+G+   RWT+V+ H+ RI+G+GIT N  RKR
Sbjct  14   RRNTAFRFKGCTDVELLKEVNHVRPFEAPYGEVRKRWTEVSEHLQRIYGTGITVNATRKR  73

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
            FDDLM+AF++++++ LRASG+EEEY+ER  LLQD HD +  ++ +K+  K+E    +ER 
Sbjct  74   FDDLMTAFQEETMAALRASGTEEEYEEREQLLQDNHDLVDTASVKKQACKDEKARQNERR  133

Query  173  DS---FLEPPKTSLLKRKLPE  190
            +S    +     + +KRKL E
Sbjct  134  ESDGERIRDAAMTTIKRKLCE  154

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 58/81 (72%), Gaps = 7/81 (9%)

Query  340  ANAASKLIDVFAKANEIKAGEVQVa-------lrkveleearlalerserearFVLERRE  392
            A   + L+++ AKANE+KA EV+V         +K+ELEE R  L+++EREARF LERRE
Sbjct  177  AAVVASLVEMVAKANEVKANEVRVQRDNNLLTQQKLELEEKRYELDKAEREARFSLERRE  236

Query  393  REMHIEFMKGTLEILKVFASK  413
            RE  +EFM+GTLE+LK F +K
Sbjct  237  REAQLEFMQGTLEVLKSFLNK  257

>H310_04684
Length=108

 Score = 122 bits (306),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 76/100 (76%), Gaps = 0/100 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +++KTAFR+  ++DIDLL+EVV + P+ A +GQT+ RW ++  H+ ++HG  +T  + RK
Sbjct  9    KRKKTAFRYSVSADIDLLKEVVMVAPYDARYGQTSARWEEICDHMRQLHGDSLTTASCRK  68

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            RFDDL+SAFK+ +L  LRASG+EEEY ER  L+QDI D +
Sbjct  69   RFDDLLSAFKKSTLKALRASGTEEEYVERDQLMQDISDMV  108

>H310_12894
Length=257

 Score = 127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 85/122 (70%), Gaps = 0/122 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRKTA+RF    DIDLL+E +++ P  AP+GQ + RW ++A H+ ++HG  +T    RKR
Sbjct  8    KRKTAYRFTTQVDIDLLKEAMFVCPHDAPYGQASARWEEIAEHMRQLHGPDLTTAGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
             DDL++AFK+D++ +LRASG+EEEY ER  LLQD+ D M  +   K+ +K+E +   ++ 
Sbjct  68   LDDLIAAFKKDTVKSLRASGTEEEYNERDQLLQDLADMMENAVRAKKALKDEKIKKQDKR  127

Query  173  DS  174
            +S
Sbjct  128  ES  129

>H310_09071
Length=112

 Score = 122 bits (305),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 79/100 (79%), Gaps = 0/100 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            Q+RKTAFRF+  +D+DLL+EV +++PF AP G+   RWT+V  H+ RI G GIT N  RK
Sbjct  13   QRRKTAFRFKGCTDVDLLKEVKHVRPFEAPRGEVRKRWTEVTEHLQRIIGDGITVNVTRK  72

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            RFDDLM+AF +D+++ LRASG+EEEY+ER  LLQDIHD +
Sbjct  73   RFDDLMTAFHEDTMAALRASGTEEEYEEREQLLQDIHDLV  112

>H310_11755
Length=259

 Score = 124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 84/122 (69%), Gaps = 0/122 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK A+RF    DIDLL+EV++  P  AP+GQT+ RW +V  H+  +HG  ++    RKR
Sbjct  8    KRKAAYRFSIPVDIDLLKEVMFACPHDAPYGQTSSRWQEVGEHMRALHGPELSAGGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
             DDLM+AFK++++ ++RASG+EEEY ER  LLQD+ D +  +N +++ +KEE     +R 
Sbjct  68   HDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIESANDKRKSIKEEKDKKADRR  127

Query  173  DS  174
            +S
Sbjct  128  ES  129

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVFASK  413
            F  E+ ER+   EFM+GT+E+L+  A K
Sbjct  231  FAAEQVERQTQFEFMQGTVELLRALAQK  258

>H257_15235
Length=178

 Score = 121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 78/120 (65%), Gaps = 12/120 (10%)

Query  71   EVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLSTLRA  130
            EV++++P+ APHG+   RWTKV  H+ R+HG GIT N  RKRFDDLM+AF  DS++ LR 
Sbjct  9    EVIHVRPYEAPHGEVRKRWTKVTEHLQRLHGVGITVNATRKRFDDLMTAFHADSMAALRV  68

Query  131  SGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPK---TSLLKRK  187
            SG++EEY+ERA LLQDIHD            KEE    +ER ++  E  +    S +KRK
Sbjct  69   SGTDEEYEERAQLLQDIHDLTD---------KEEKAKQNERHETNGEKIRDAAMSTMKRK  119

>H310_15291
Length=234

 Score = 122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 77/112 (69%), Gaps = 0/112 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRKTA+RF    DIDLL+EV+ ++P  AP+GQT  RW +V  H+  + G  +T    RKR
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVRPHDAPYGQTLARWEEVVEHMREMRGPDLTTAGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEE  164
             DDLM+AFK+D++ +LRA+G+EEEY ER  L+QD+ D M  +   K  +KEE
Sbjct  68   LDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMDTAYKTKTTLKEE  119

>H310_13106
Length=213

 Score = 122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 107/190 (56%), Gaps = 17/190 (9%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRKTA+RF    DIDLL+EV+ + P  AP+GQ   RW +V  H+  +HG  +     RK 
Sbjct  8    KRKTAYRFTTQVDIDLLKEVMAVCPHEAPYGQILARWEEVVEHIREMHGPDLITAGCRKS  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEE-SVVPDER  171
             DDLM+AFK+D++ +LRA+G+EEEY ER  L+QD+ D M  +   K+ +KEE S   D+R
Sbjct  68   LDDLMAAFKKDTVKSLRATGTEEEYNEREQLIQDLSDMMDSAYKTKKALKEEKSKKIDKR  127

Query  172  PDSFLEPPKTSL--LKRK---LPE---------TQPPPSTIDYFRTAQQNLVDMNQAMSA  217
                L   + +L  +KRK   L E          +P PS++   + A   +VD+   + A
Sbjct  128  EKEGLMLREAALMTMKRKSDALEEEEEVSPSKVKEPRPSSV--LKDAASAVVDILSMIDA  185

Query  218  RSGHNRLSID  227
             +   R  I+
Sbjct  186  SNEFKRAEIE  195

>H310_09373
Length=109

 Score = 116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 69/100 (69%), Gaps = 0/100 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +++KTAFRF   +DIDLL+EVV I PF A  GQT  RW +   H    HG  +T  + RK
Sbjct  9    RRKKTAFRFSVVADIDLLKEVVIIAPFEAASGQTGARWEEFCEHKRVSHGDTLTTASCRK  68

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            R DDL+SAFK+ +L  LRASG+EEEYQER  LLQDI D +
Sbjct  69   RVDDLLSAFKKATLKALRASGTEEEYQERDQLLQDISDMV  108

>SPRG_11320
Length=274

 Score = 119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 68/99 (69%), Gaps = 0/99 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            K K  FRF  ASD+DLL+EV+ + P+ AP GQT  RW +V  H+  IHG  +T    RKR
Sbjct  8    KTKKTFRFSVASDVDLLKEVINVAPYDAPFGQTIARWEEVTEHMRGIHGEHVTFTGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            FDDLM+AFK+D+L  +RASG+  E  ER LLL+DI D M
Sbjct  68   FDDLMAAFKKDALKAMRASGTAAEVCERDLLLEDISDLM  106

>H310_06933
Length=259

 Score = 118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 89/138 (64%), Gaps = 3/138 (2%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK A+RF    DID+L+EV++  P  AP+GQT+ RW +V  H+  + G  ++    RKR
Sbjct  8    KRKAAYRFSIPVDIDMLKEVMFACPHDAPYGQTSSRWQEVGEHMRALLGPELSAGGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
             DDLM+AFK++++ ++RASG+EEEY ER  LLQD+ D +  +N +++ ++EE     +R 
Sbjct  68   HDDLMAAFKKETVKSMRASGTEEEYLEREQLLQDLSDMIESANDKRKSIQEEKDKKADRR  127

Query  173  DS---FLEPPKTSLLKRK  187
            +S    +     + LKRK
Sbjct  128  ESDGHLIREAALAGLKRK  145

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVFASK  413
            F  E+ ER+   EFM+GT+E+L+  A K
Sbjct  231  FAAEQVERQTQFEFMQGTVELLRALAQK  258

>H310_13306
Length=231

 Score = 116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK A+RF   +D+DLL EVV + PF A +GQTT RW ++  ++  IHG  IT    R+R
Sbjct  9    KRKPAYRFTNTADVDLLNEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAITAICCRRR  68

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            FDDL++AFK+ +L  LR+SG+EEEY ER  LLQDI D +
Sbjct  69   FDDLLAAFKKATLKALRSSGTEEEYNERDQLLQDIVDLI  107

>H310_14146
Length=109

 Score = 109 bits (273),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/100 (55%), Positives = 70/100 (70%), Gaps = 0/100 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +++KTAFRF  ++DIDLL+EVV I PF A +GQT   W  +  H+   HG  +T  + RK
Sbjct  9    RRKKTAFRFSVSADIDLLKEVVMIAPFEAAYGQTGAGWEGICEHMRVSHGDTLTTASCRK  68

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            RFDDL SAFK+ +L  LRASG+EEEYQER  LLQ I D +
Sbjct  69   RFDDLYSAFKKATLKALRASGTEEEYQERDQLLQGISDMV  108

>H310_09765
Length=115

 Score = 109 bits (273),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 51/99 (52%), Positives = 72/99 (73%), Gaps = 0/99 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK A+RF  A+D+DLL+EVV + PF A +GQTT RW ++  ++  IHG  +T    R+R
Sbjct  9    KRKPAYRFTIAADVDLLKEVVLVAPFDAGYGQTTARWDEIGDNMRSIHGEAVTAICCRRR  68

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            FD+L++AFK+ +L  LR+SG+EEEY +R  LLQDI D +
Sbjct  69   FDELLAAFKKATLKALRSSGTEEEYNDRDQLLQDIVDLV  107

>SPRG_08573
Length=265

 Score = 112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 73/106 (69%), Gaps = 0/106 (0%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRF  113
            +K  +RF   +DIDLL EV+ + P  AP+GQTT RW +V  ++  +HG  +T    RKRF
Sbjct  9    KKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRALHGEHLTVAGCRKRF  68

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            DDLM+AFK DS++ LRASG+EEE  +R +LL+++ D +  +  RK+
Sbjct  69   DDLMAAFKTDSVNGLRASGTEEEMSQRFVLLEEMSDLLEAAADRKK  114

 Score = 32.0 bits (71),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 0/24 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKV  409
            F LE+ ERE H+EFM+ T+E+++ 
Sbjct  236  FELEKVEREAHLEFMRRTIEMMQT  259

>H257_09434
Length=257

 Score = 111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 75/112 (67%), Gaps = 0/112 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK A RF    D+DLL+EV+ I P  AP+GQT+ RW +V   +  IHG  ++    RKR
Sbjct  9    KRKPAHRFTIPQDVDLLKEVLTICPHDAPYGQTSGRWAEVGDRMRTIHGDSLSATGCRKR  68

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEE  164
             DDL++AF +DSL++LRASG++E++ ER  LLQD+   +   + +KR  KE+
Sbjct  69   CDDLLAAFHKDSLASLRASGTDEQHHEREQLLQDLKALIDAISDKKRASKED  120

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVFASK  413
              LE++ER+M IEFM+ TL++++    K
Sbjct  229  LALEQQERQMQIEFMRSTLDMMRAITKK  256

>SDRG_17406
Length=264

 Score = 111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (68%), Gaps = 0/106 (0%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRF  113
            +K  +RF   +DIDLL EV+ + P  AP+GQTT RW  V +++  +HG  +T    RKRF
Sbjct  9    KKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVAGCRKRF  68

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            DDLM+AFK D++  LRASG+EEE  +R +LL+++ D +  +  RK+
Sbjct  69   DDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLEAAADRKK  114

>SDRG_17390
Length=264

 Score = 111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (68%), Gaps = 0/106 (0%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRF  113
            +K  +RF   +DIDLL EV+ + P  AP+GQTT RW  V +++  +HG  +T    RKRF
Sbjct  9    KKPTYRFSVHTDIDLLEEVINVAPHDAPYGQTTARWEDVTSYMRTLHGEHLTVAGCRKRF  68

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            DDLM+AFK D++  LRASG+EEE  +R +LL+++ D +  +  RK+
Sbjct  69   DDLMAAFKTDTVKGLRASGTEEEMSQRYVLLEEMSDLLEAAADRKK  114

>H310_14738
Length=255

 Score = 111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 76/120 (63%), Gaps = 1/120 (1%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            K K A RF    DIDLL+EV+ ++P  AP+GQT  RW +V  H+  IHG   T  + RKR
Sbjct  8    KLKPAHRFTVQEDIDLLKEVILVRPHDAPYGQTAGRWEEVGDHMRAIHGMTTTTVDCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREV-KEESVVPDER  171
             DDLM AFKQD++ +LRASG+E++  E+  LLQD+         RKR + +EE  + D+R
Sbjct  68   HDDLMVAFKQDTIKSLRASGTEKQNSEQEQLLQDLLGMTNAETDRKRALMEEEEAIGDKR  127

>SPRG_05929
Length=265

 Score = 110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 73/106 (69%), Gaps = 0/106 (0%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRF  113
            +K  +RF   +DIDLL EV+ + P  AP+GQTT RW +V  ++  +HG  +T    RKRF
Sbjct  9    KKPTYRFTVHTDIDLLEEVINVAPHDAPYGQTTARWEEVTNYMRTLHGEHLTVAGCRKRF  68

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            DDLM+AFK D+++ LRASG+EEE  +R +LL+++ D +  +  RK+
Sbjct  69   DDLMAAFKTDNVNGLRASGTEEEMSQRYVLLEEMSDLLEAAVDRKK  114

>H257_15222
Length=254

 Score = 106 bits (265),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 75/114 (66%), Gaps = 0/114 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            K+K A  F    D+DL++EV+ I P  AP+GQT+ RW +V  H+  IH   ++    RKR
Sbjct  12   KKKPAHGFTTPQDVDLIKEVMSICPHDAPYGQTSARWAEVGEHMRTIHVDSLSATGCRKR  71

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESV  166
             DDL+ AF++  L++LRASG++EEY ER  LLQD+ D + + +++K+  KE+  
Sbjct  72   CDDLLVAFQKAMLASLRASGTDEEYDEREQLLQDLSDMIDMISNKKKATKEDKC  125

>H310_04120
Length=138

 Score = 103 bits (256),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 67/99 (68%), Gaps = 0/99 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KR+TA+RF    DID L+EV+ + P  AP+GQT  RW     H+  +HG  +T    RKR
Sbjct  8    KRRTAYRFITQVDIDFLKEVMAVCPHDAPYGQTLARWEDFVEHMREMHGPDLTTAGCRKR  67

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
             DDLM+A+K++++ +LRASG+EEEY ER  L+QD  D M
Sbjct  68   LDDLMAAYKKNTVQSLRASGTEEEYNEREQLIQDQSDMM  106

>H310_07849
Length=192

 Score = 102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 0/107 (0%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            K+K A RF    D+DL++EV+ + P  AP+GQ + RW +V  ++  I+ S +T +  +KR
Sbjct  5    KKKPAHRFTLQQDVDLIKEVISVSPHDAPYGQLSTRWAEVGQNMQAIYASNLTASGCQKR  64

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
             D+L+ AF +D++++LRASG+EE Y ER  LLQD+ D +     +KR
Sbjct  65   CDELLVAFHKDNIASLRASGTEENYNEREQLLQDLSDMIDSIADKKR  111

>SPRG_06030
Length=196

 Score = 102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 62/90 (69%), Gaps = 0/90 (0%)

Query  64   SDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQD  123
            SD+DLL+E   + P   PHGQT  RW +VA H+  IHG  ++    R+RFDDL++AFK D
Sbjct  37   SDVDLLKEAKLVSPHDCPHGQTAKRWEEVAEHMRAIHGDLVSIVGCRRRFDDLLTAFKND  96

Query  124  SLSTLRASGSEEEYQERALLLQDIHDFMTV  153
            +++ LRASG+EE+ ++R  LL DI D M V
Sbjct  97   TVNALRASGTEEDVKKRDELLHDIADLMDV  126

>PHYCA_504729
Length=183

 Score = 89.7 bits (221),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 66/104 (63%), Gaps = 4/104 (4%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVRK  111
            KRK AFRF  +SDI LL+EV+  +P+AA HG+T   WT VAT + A +          R+
Sbjct  22   KRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADGKACRR  81

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSN  155
            RF+ L+  F++D L +LRASGS E+Y+ER  LL D    MT+ N
Sbjct  82   RFNTLLEVFRRDELESLRASGSAEDYEEREQLLTDC---MTLYN  122

>PITG_00010
Length=184

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 1/107 (1%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVR  110
            +KRK AFRF  +SD+ LL+EV+   P+AA HG+T   W KVA+ + A +          R
Sbjct  46   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHGKTEAAWGKVASGIKAALPLCTADGKACR  105

Query  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            +RF  LM  FK++ L +LRASG+ E+Y+ER  LL D  +  T+S  R
Sbjct  106  RRFYTLMEVFKREELESLRASGTTEDYEEREQLLTDCFELQTISQLR  152

>H310_14154
Length=178

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 51/75 (68%), Gaps = 0/75 (0%)

Query  100  HGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            HG  +T  + RKRFDD + AFK+D L++LRASG+EEEY ER  L+QDI D M  S  RKR
Sbjct  5    HGDTLTAVSCRKRFDDFIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMNTSQDRKR  64

Query  160  EVKEESVVPDERPDS  174
             VKEE     E+ +S
Sbjct  65   SVKEEKTAKFEKRES  79

>PHYCA_70656
Length=113

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 1/89 (1%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVRK  111
            KRK AFRF  +SDI LL+EV+  +P+AA HG+T   WT VAT + A +          R+
Sbjct  23   KRKKAFRFVPSSDIMLLKEVLKHRPWAASHGETLAAWTSVATGLKAALTSCTADGKACRR  82

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQER  140
            RF+ L+  F++D L +LRASGS E+Y+ER
Sbjct  83   RFNTLLEVFRRDELESLRASGSAEDYEER  111

>PHYCA_559326
Length=182

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 4/104 (4%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVRK  111
            KRK AF F  +SDI L +EV+  +P+AA HG+T   WT  AT + A +       N  R+
Sbjct  22   KRKKAFNFGPSSDIMLFKEVLKRRPWAASHGETLAAWTSFATRLKAALTSCTADGNACRR  81

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSN  155
            RF+ L+  F +D L +LRASGS E+Y+ER  LL D    MT+ N
Sbjct  82   RFNTLLGVFCRDELESLRASGSAEDYEEREQLLTDC---MTLYN  122

>PPTG_14663
Length=146

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 68/116 (59%), Gaps = 2/116 (2%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR-IHGSGITPNNVRKR  112
            RK AFRF  +SD+ LL+EV    P+AA HG+T   WT VA  +   I  S       R+R
Sbjct  30   RKKAFRFLPSSDVLLLKEVTAHTPWAAAHGETNTAWTTVANELKNAISASTADDKACRRR  89

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVP  168
            F  L+  F+++ + +LR SG+ EEY+ER  LL D  + +  +N +KR+ ++  + P
Sbjct  90   FTALLDTFRREEMKSLRVSGTAEEYREREQLLTDCLE-LEKANKKKRKQRDAKLRP  144

>PHYCA_112118
Length=134

 Score = 79.3 bits (194),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 11/110 (10%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVA----THVARIHGSGITPNN  108
            KRK AFRF  +SDI LL+E V  +P+AA HG+    W+ VA    T +    G G     
Sbjct  27   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGEAQVSWSSVAIGLKTTLPSCTGDG---KA  83

Query  109  VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQD----IHDFMTVS  154
             R+RF+ L+  F++D L +LRASGS E+++ER  LL D    +  FM +S
Sbjct  84   CRRRFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALVRIFMDIS  133

>PHYCA_120807
Length=134

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 61/102 (60%), Gaps = 1/102 (1%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN-VRK  111
            KRK AFRF  +SDI LL+E V  +P+AA HG+T   W+ VA  +     S        R+
Sbjct  27   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETEVSWSSVAIGLKTALPSCTADGKACRR  86

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTV  153
            RF+ L+  F++D L +LRASGS E+++ER  LL D    + +
Sbjct  87   RFNALLDVFRRDELESLRASGSAEDFEEREQLLTDCMALVRI  128

>PHYCA_49721
Length=103

 Score = 76.6 bits (187),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 61/100 (61%), Gaps = 1/100 (1%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNV-R  110
            QKRK AFRF  +SD+ LL+EVV   P++A HG+T   W KVA+ +     + I      R
Sbjct  4    QKRKKAFRFLQSSDVVLLKEVVKHTPWSAGHGETQVAWEKVASGIKEALPACIADGKACR  63

Query  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  150
            +RF  L  AF+++ + +LRA G+ EEY ER  LL D+ + 
Sbjct  64   RRFGALYDAFRREEMESLRALGTSEEYTEREQLLTDLTEL  103

>PHYCA_131593
Length=254

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 94/187 (50%), Gaps = 10/187 (5%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIHGSGITPNNVR  110
            +KRK AFRF  +SD+ LL+EV+   P+AA H +T   W +VA+ + A +          R
Sbjct  36   KKRKKAFRFLPSSDVILLKEVIKHTPWAAGHRKTEATWGRVASGMKASLPLCTADGKACR  95

Query  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDE  170
            +RF  LM  FK++ L +LRASG+ E Y+ER  LL D  +    +   KR+ +       +
Sbjct  96   RRFYTLMEVFKREELESLRASGTTEAYEEREQLLTDCFELADKTEKEKRDAERREATSAD  155

Query  171  RPDSFLEPPKTSLLKRKLP---ETQPPPSTIDYFRTAQQNLVDMNQAMSARSGHNRLSID  227
               S ++  +    KR L    E   PPST    R++   L+   +   A S +NR S+ 
Sbjct  156  IVRSAMQGMRN---KRALSTDTELATPPSTKKKKRSSTDALLGFLED-RASSRNNRHSLK  211

Query  228  RRVPSLH  234
             R   LH
Sbjct  212  ER--QLH  216

>PPTG_07932
Length=289

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN-VRK  111
            KRK AFRF  +SDI LL+E V  +P+AA HG+T   W+ VA  +     S        R+
Sbjct  59   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSWSSVAIGLKTALPSCTADGKACRR  118

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            RF+ L+  F++D L +LRASG+ E+++ER  LL D 
Sbjct  119  RFNALLDVFRRDELESLRASGTAEDFEEREQLLTDC  154

>H310_04124
Length=81

 Score = 72.0 bits (175),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 51/100 (51%), Gaps = 40/100 (40%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK AFRF+ ASD+DLL+E                                        R
Sbjct  6    KRKVAFRFKSASDVDLLKE----------------------------------------R  25

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMT  152
            FDDL+ AFK+D L++LRASG+EEEY ER  L+QDI D M+
Sbjct  26   FDDLIVAFKEDKLNSLRASGTEEEYNEREQLMQDIVDLMS  65

>H310_12714
Length=377

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 17/109 (16%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            ++KTAFRF  ++D DLL+EVV I PF A +GQT  R  ++  H+ +          +R R
Sbjct  10   RKKTAFRFSVSADSDLLKEVVMIAPFEAAYGQTGARGEEICEHMRK---------TIR-R  59

Query  113  FDDLMSAFK-QDSLST-LRASGSEEEYQERALLLQDIHDFMTVSNHRKR  159
            F     AF  Q+S S  LR SG+EEEYQER  LLQDI D M ++  +K+
Sbjct  60   F-----AFSVQESHSKGLRTSGTEEEYQERNQLLQDISDMMDLAQLKKK  103

>H257_16670
Length=136

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 60/114 (53%), Gaps = 30/114 (26%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            K+K A RF    D+DLL+EV+ I P  AP+GQT+ RW + AT                  
Sbjct  12   KKKPAHRFTTPQDVDLLKEVMSICPHDAPYGQTSARWAEKAT------------------  53

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESV  166
                        L++LRASG++EEY ER  LLQD+ D + + +++K+  KE+  
Sbjct  54   ------------LASLRASGTDEEYDEREQLLQDLSDMIDMISNKKKATKEDKC  95

>H310_15369
Length=209

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)

Query  99   IHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            IHG  IT ++ RKRFDDL+SAFK+ +L  LRASG+EEEY ER  LLQDI D +
Sbjct  4    IHGDTITASSCRKRFDDLLSAFKKATLKALRASGTEEEYNERDQLLQDIVDMI  56

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVF  410
            F +E+ ERE  IEFM+ T+E+++  
Sbjct  183  FAVEKMEREAQIEFMRSTIELMRTL  207

>H310_11608
Length=221

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 64/122 (52%), Gaps = 35/122 (29%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK AFRF+ ASDIDLL+E    Q F     ++TD                         
Sbjct  6    KRKAAFRFKSASDIDLLKERFVPQAF----RRSTD-------------------------  36

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERP  172
                  AFK++++S+LRASG+EEEY ER   LQDI D +  S+ RKR +KEE +   E+ 
Sbjct  37   ------AFKRNTISSLRASGTEEEYSEREQFLQDIVDLIDQSHSRKRMLKEEKLAKVEKR  90

Query  173  DS  174
            +S
Sbjct  91   ES  92

>H310_14898
Length=140

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)

Query  99   IHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRK  158
            IHG  I+    RKR DDL SAF+QDS+++LRAS ++E+Y ER  LLQD+ D +     ++
Sbjct  4    IHGESISAKGCRKRCDDLHSAFQQDSVASLRASRTDEQYAERDQLLQDLADMIEAEQCKR  63

Query  159  REVKEESVVPDER  171
            R  K++    ++R
Sbjct  64   RANKDDKSKKEDR  76

>PITG_09072
Length=261

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 59/114 (52%), Gaps = 2/114 (2%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARI-HGSGITPNNVRK  111
            KR  AFRF   +DI LLREV+  +P+A  HG     W  VAT   RI   S       ++
Sbjct  30   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWEVVATAFKRIVPWSTNDGRACKR  89

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEES  165
            R+  LM A+  + L  LR +G+     ERA LL      MT  +HRKR+  +ES
Sbjct  90   RYLALMEAYGSEKLQKLRGAGTPAMNAERAKLLMQCQ-IMTDEDHRKRKAVKES  142

>SDRG_15163
Length=292

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query  57   AFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN---VRKRF  113
            A +F C  DI +LR V  ++P+AA HG     W  +A  +A     G+       ++ RF
Sbjct  29   ASKFACKHDIVMLRSVGLLEPWAAAHGAVMSTWEAIAESLADASDFGLKNKKGPALKTRF  88

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            + +M+ FK+    +LR SG+ EEY+ER  LL DI   M
Sbjct  89   ESIMNKFKKSEFQSLRKSGTVEEYEEREQLLTDIKARM  126

>PYAP_15403
Length=114

 Score = 67.8 bits (164),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 58/101 (57%), Gaps = 7/101 (7%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVA------THVARIHGSGITPN  107
            R+T FRF+ + D+ LLRE+  ++P+AA HG+T   W  +         V R +G  I   
Sbjct  12   RRT-FRFKPSHDVLLLREIARLKPWAALHGETMSSWEAIGQAFNTQLAVVRPNGPEIDAR  70

Query  108  NVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIH  148
              ++R+  L+ +F    L++LR+SGS EE  ER  L+ ++H
Sbjct  71   ACQRRYKALIDSFLSGDLASLRSSGSAEEINEREELIAEVH  111

>SPRG_00310
Length=254

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 39/52 (75%), Gaps = 0/52 (0%)

Query  99   IHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  150
            IHG  +T    RKRFDDLM+AF++D++  +RASG+EEE  ER +LLQDI D 
Sbjct  4    IHGEHVTFTGCRKRFDDLMAAFEKDAVKAMRASGTEEEVSERDMLLQDISDL  55

>H257_06253
Length=237

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 6/110 (5%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT--PNNVRKRFDDL  116
            +F C  DI LL++V   +P+ A +G+    W +V   V RI G  I   P  ++ RFD L
Sbjct  23   KFDCFHDIQLLKQVNLSKPWEAGYGKVMAAWVEVCREVIRIPGFKINKKPEGLKTRFDLL  82

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIH----DFMTVSNHRKREVK  162
            +    +  ++++R SG+ E+Y ER LLL DI     DF   +  RK  VK
Sbjct  83   IKTHCEGEMASMRKSGTSEDYTERDLLLTDIKARMDDFDETAAARKDSVK  132

>SPRG_18045
Length=215

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)

Query  99   IHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRK  158
            +HG  +T    RKRFDDLM+AFK D+++ LRASG+EEE +ER +LL+++ D +  +  RK
Sbjct  4    LHGEHLTVAGCRKRFDDLMAAFKTDNVNGLRASGTEEEMRERYVLLEEMSDLLEAAADRK  63

Query  159  R  159
            +
Sbjct  64   K  64

>H310_14414
Length=169

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 2/95 (2%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDL  116
            +F C  DI LL ++ +  P  A HG+    W+ +A  + +    G+      ++ RFD L
Sbjct  24   KFACHHDIKLLLQIAFASPCEADHGKQLQAWSAIADALGQSVTFGLKKKGPAMKARFDVL  83

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            MS F +   ++LR SG+ EEY+ER  LLQDI   M
Sbjct  84   MSRFVRGESASLRKSGTAEEYKEREQLLQDIKTRM  118

>SPRG_14160
Length=319

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query  57   AFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN---VRKRF  113
            A +F C  DI +LR V  ++P+AA HG     W  +A  +A     G+       ++ RF
Sbjct  22   ASKFACKHDIAMLRTVNLLEPWAAAHGAVMSTWDAIAESLADASDFGLKNKKGPALKTRF  81

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            + +M+ FK+    +LR SG+ EEY+ER  LL DI   M
Sbjct  82   EIIMNRFKKSEFQSLRKSGTVEEYEEREQLLTDIKARM  119

>H310_04318
Length=179

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)

Query  99   IHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRK  158
            IHG  IT    R+RFDDL++AFKQ +L  LR+SG+EEEY +R  LLQ I D +  +  +K
Sbjct  4    IHGEAITAICCRRRFDDLLAAFKQATLKALRSSGTEEEYNKRDQLLQGIVDLIDAAATKK  63

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 20/25 (80%), Gaps = 0/25 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVF  410
            F LE++ERE+ +EFM+ T+E+++  
Sbjct  153  FALEKKEREVQMEFMRSTIEMMRAL  177

>PPTG_03338
Length=260

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 59/114 (52%), Gaps = 2/114 (2%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARI-HGSGITPNNVRK  111
            KR  AFRF   +DI LLREV+  +P+A+ HG     W  VA    RI   S       ++
Sbjct  29   KRAKAFRFTTVTDIALLREVIDHKPWASSHGDMAKTWEVVAAAFKRIVPWSTNDGRACKR  88

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEES  165
            R+  L+ A+  + L  LR +G+     ERA LL      MT  +HR+R+  +ES
Sbjct  89   RYLALIEAYGSEKLQKLRGAGTPAMNAERAKLLAQCQ-LMTDEDHRRRKAAKES  141

>PHYSO_383648
Length=319

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATH----------VARIHGSG  103
            ++  FRF+ A D+ L+REV+   P+AA +G+T   W  VAT           VA   GS 
Sbjct  10   KRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVATRVQSTLESMKGVAFTRGSA  69

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ AF+++ ++ LR SG+ EE+  R  LL
Sbjct  70   LDHAIVKRRVDMLLEAFRKNEMAGLRGSGTPEEFDMRNKLL  110

>PHALS_08857
Length=352

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 57/101 (56%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR----------IHGSG  103
            ++  FRF+ A D+ L+REV++  P++A +G+T   W  VAT V              GS 
Sbjct  54   KRRLFRFKPAFDVVLVREVIHDFPWSAGYGRTRSAWMAVATRVQSTLEEMKGVTFTRGSA  113

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ AF+++ LS LR SG+ EE+  R  LL
Sbjct  114  LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  154

>PITG_08172
Length=320

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 21/151 (14%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR----------IHGSG  103
            ++  FRF+ A D+ L+REV+   P+AA +G+T   W  VA+ V              GS 
Sbjct  17   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQTALESLKGVVFTRGSA  76

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALL---LQDIHDFMTVSNHRKRE  160
            +    V++R D L+ AF+++ LS LR SG+ EE+  R  L   L  + D  T++    RE
Sbjct  77   LDHAIVKRRIDMLLEAFRKNELSALRGSGTPEEFDMRNKLLAILARVVDEQTLNKGAMRE  136

Query  161  --------VKEESVVPDERPDSFLEPPKTSL  183
                    V +  +   E P     PP   L
Sbjct  137  KRVQSALQVAQHGLAELEGPGGLTLPPSAGL  167

>PHYRA_78656
Length=347

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 55/101 (54%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATH----------VARIHGSG  103
            ++  FRF+ A D+ L+REV+   P+AA +G+T   W  VA            VA   GS 
Sbjct  47   KRRLFRFKPAFDVVLVREVIRCFPWAAGYGRTRSAWMSVALRVQTALESLKGVAFTRGSA  106

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ AF++  +S LR SGS EE+  R  LL
Sbjct  107  LDHAIVKRRVDMLLDAFRKSEMSGLRGSGSPEEFDLRNKLL  147

>H257_13889
Length=138

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 3/85 (4%)

Query  65   DIDL--LREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQ  122
            DI+L  LRE + ++PFAA HG+   RWT VA  VA      +TP   R+    L+  FK 
Sbjct  18   DIELAILREAIRVEPFAADHGELLARWTLVAAAVAE-QEPRVTPRAAREHVYMLLKKFKA  76

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
            D  +   +SG+ EE  E+  LLQDI
Sbjct  77   DDQAQRLSSGTAEEVTEKVQLLQDI  101

>PPTG_14264
Length=335

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR----------IHGSG  103
            ++  FRF+ A D+ L+REV+   P+AA +G+T   W  VA+ V              GS 
Sbjct  33   KRRLFRFKPAFDVVLVREVIRDFPWAAGYGRTRSAWMAVASRVQAALESMKGVVFTRGSA  92

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ AF+++ LS LR SG+ EE+  R  LL
Sbjct  93   LDHAIVKRRVDMLLEAFRKNELSALRGSGTPEEFDMRNKLL  133

>SDRG_17294
Length=68

 Score = 58.5 bits (140),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 0/54 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT  105
            Q  K AFRF  ASD+DLL+EV+++ P+   +GQ   RW +VA H+  I+G  +T
Sbjct  7    QSTKKAFRFTVASDVDLLKEVMFVSPYDCQYGQVAKRWEEVAEHMRVIYGDLVT  60

>HYAP_14010
Length=303

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATH----------VARIHGSG  103
            ++  FRF+ A D+ L REV+   P+AA +G+T   W  VA            VA   GS 
Sbjct  50   KRRLFRFKPAFDVVLAREVIRCFPWAAGYGRTRSAWMNVAARVQSTLESLKGVAFTRGSA  109

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ AF++  +S+LR +G+ EE+  R  LL
Sbjct  110  LDHAIVKRRVDMLLEAFRKHEMSSLRGTGTPEEFDMRNKLL  150

>H310_10581
Length=241

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 51/95 (54%), Gaps = 2/95 (2%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDL  116
            +F C  DI LL ++ +   + A HG+    W+ +A  + +    G+      ++ RFD L
Sbjct  24   KFACHHDIKLLLQITFASRWEADHGKQLQAWSAIADALGQSATFGLKKTGPAIKTRFDVL  83

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            MS F +   ++LR SG+ EEY+E   L+QDI   M
Sbjct  84   MSRFVRGESASLRKSGTAEEYEEGEQLMQDIKTRM  118

>H257_19201
Length=102

 Score = 59.3 bits (142),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 1/83 (1%)

Query  66   IDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQ-DS  124
            + LLREV+ ++P+   +G  T RW  +AT+++    + +   + R  F+ ++ AFK  D 
Sbjct  17   LTLLREVIRVEPYDGEYGTLTSRWKPIATNLSTCFEAPVPHRSARDHFEAMLEAFKSTDK  76

Query  125  LSTLRASGSEEEYQERALLLQDI  147
               L  +GSEEE  E+  LLQD+
Sbjct  77   AQRLWGTGSEEEVTEQVQLLQDL  99

>H257_18551
Length=221

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 3/85 (4%)

Query  65   DIDL--LREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQ  122
            DI+L  LRE + ++PFAA HG+   RWT VA  VA      +TP   R+    L+  FK 
Sbjct  18   DIELAILREAIRVEPFAADHGELLARWTLVAAAVAE-QEPRVTPRAAREHVHMLLKKFKA  76

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
            D  +   +SG+ EE  E+  LLQDI
Sbjct  77   DDQAQRLSSGTAEEVTEKVQLLQDI  101

>H310_10257
Length=309

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)

Query  98   RIHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDF  150
            RI G GIT N  RKRFDDLM+AF + +++ LRASG+EEEY+ER  LLQDIHD 
Sbjct  140  RIVGDGITVNATRKRFDDLMTAFHEITMAALRASGTEEEYEEREQLLQDIHDL  192

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 56/101 (55%), Gaps = 7/101 (7%)

Query  125  LSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSFLEPPKTSLL  184
            +++LRASG++EEY+ER  LLQDIHD +  +N RK+  K+E     ER +S  E  + + +
Sbjct  1    MASLRASGTDEEYEEREQLLQDIHDMVDAANPRKQSSKDEKAKNLERRESNGEQIRDAAM  60

Query  185  KRKLPETQPPPSTIDYFRTAQQNLVDMNQAMSARSGHNRLS  225
                  T     T D+       L++ N+   AR G NR++
Sbjct  61   ------TTMKKRTSDFVDEDDFGLLNPNKK-QARVGSNRMT  94

 Score = 38.5 bits (88),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVFASK  413
            F L+RR RE  +EF +GTLE+LK  A+K
Sbjct  281  FALDRRGREAQLEFFQGTLEVLKSLAAK  308

>PHYRA_78088
Length=261

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 58/121 (48%), Gaps = 5/121 (4%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARI-HGSGITPNNVRK  111
            KR  AFRF   +DI LLREV+  +P+A  HG     W  VAT   RI   S       ++
Sbjct  32   KRAKAFRFTTVTDIALLREVIDHKPWACSHGDMAKTWDVVATAFKRIVPWSTNDGRACKR  91

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171
            R+  L  A+    L  LR SG+ +   +R  LL         +++R++ +KE     D R
Sbjct  92   RYLALAEAYGTQKLHKLRGSGTPQMNAQREKLLAQCKALTEEAHYRRKALKE----ADRR  147

Query  172  P  172
            P
Sbjct  148  P  148

>PPTG_02416
Length=125

 Score = 58.9 bits (141),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 12/116 (10%)

Query  57   AFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDL  116
             FRF    D +LLRE++ ++PFAA  G T   W+ VA  ++   G  +    +R R   L
Sbjct  2    VFRFSNDQDKELLRELIRLKPFAAVRGTTLRVWSDVAASLSSAFGVEVNVKQIRDRLTLL  61

Query  117  MSAFKQDSLSTLRASGSEE---------EYQERALLLQDIHDFMTVSNHRKREVKE  163
              +FK    ++ R SG EE          Y ER  L   + +++ + +H K E K+
Sbjct  62   KQSFKDSEATSARGSGIEESVDAVNVQSHYDEREGL---VREYVALEDHFKSEKKQ  114

>H257_19019
Length=229

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 5/102 (5%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDS  124
            +++LLREV  I+PFAA HG    RW  VA+ ++  H   I     R+  D ++  FKQ+ 
Sbjct  27   EVELLREVSRIEPFAADHGDLLQRWKLVASGLS-AHEPKINYRGAREHVDAMLKQFKQED  85

Query  125  LSTLRASGSEEEYQERALLLQDI---HDFMTVSNHRKREVKE  163
                 +SG++E+  E+  LLQD+    D +  S  RKR VKE
Sbjct  86   KVQQLSSGTDEDVTEKVQLLQDLIMRMDEVASSKKRKR-VKE  126

>CCA14346
Length=325

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 78/188 (41%), Gaps = 46/188 (24%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVA-----------THVARIHG  101
            ++K AFRF+   DI LL  +    P+AA HG   + W   A           T++    G
Sbjct  19   RKKKAFRFKPKHDIVLLNTIKQFMPWAAVHGYVREVWASAADAFSLSMREKFTNLDEYFG  78

Query  102  ----SGITPNN---------------VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERAL  142
                + I+P N                ++RFD L+ A ++  L +LRASGSEEE  ER  
Sbjct  79   EEGNNEISPANGLIGSGSTFHVNHIACKRRFDTLIDAHRRGDLESLRASGSEEECCEREQ  138

Query  143  LLQDI------HDFMTVSNH-RKREVKEESVVPDERPDSFLEPPKTSLLK-------RKL  188
            LL DI      HD    +N  RK      S   D  P  +L     S+L        +K 
Sbjct  139  LLMDIDRLISTHDEWRKNNRTRKNSSNSSSHCDDAFP--YLSGTAESILDSSPLYLTKKS  196

Query  189  PETQPPPS  196
            PE    PS
Sbjct  197  PELTGKPS  204

>PHYSO_295819
Length=193

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 0/92 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            F F   +D+ L +E++ ++P+AA HG    R+ +VA +++      +    V+ R + L+
Sbjct  87   FFFTQEADLALFKEMLSLEPYAAEHGFKKQRYQQVADNLSEHLKVKLLDRTVKDRLELLL  146

Query  118  SAFKQDSLSTLRASGSEEEYQERALLLQDIHD  149
            + FK D  S  + SG  E+Y E   LLQDI D
Sbjct  147  AEFKLDDQSYRKKSGGSEQYTEHKRLLQDISD  178

>H257_09254
Length=141

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 1/99 (1%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK-QD  123
            D+ LLREV+ ++P+   HG    RW +VA  ++     GI   + R  ++ L+ AFK  D
Sbjct  16   DLALLREVLRVEPYDCEHGTLIQRWKEVAASLSLYSNQGIPHRSARDHYEGLIQAFKATD  75

Query  124  SLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
                   +GS+E+  E+  LLQD+ D    ++  K  VK
Sbjct  76   KSQRQWGTGSDEDVPEKVQLLQDLVDRRDAADTLKTAVK  114

>SDRG_06597
Length=317

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 3/93 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            +F C+ D+ +LR V+   P+ A HG     W +VA  VA+       G T   ++ RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWERVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIH  148
            L+  F  + +  LR  G+  E+ ER +LL DI 
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDIR  126

>PHYCA_510415
Length=337

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 10/101 (10%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR----------IHGSG  103
            ++  FRF+ A D+ L REV+   P+AA +G+T   W  VA  V              GS 
Sbjct  33   KRRLFRFKPAFDVVLAREVIRNFPWAAGYGRTRSAWMAVANRVQSTLESMKGVTFTKGSS  92

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLL  144
            +    V++R D L+ A++++ +S LR SG+ EE+  R  LL
Sbjct  93   LDHAIVKRRVDMLLEAYRKNEMSGLRGSGTPEEFDMRNKLL  133

>PYVX_13719
Length=317

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 9/107 (8%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATH---------VARIHGSGI  104
            +++ FRFR   DI LLREV+   P+ A +G T   WT VA           VA   GS +
Sbjct  25   KRSMFRFRPRYDIALLREVIKRFPWGAGYGHTRAAWTAVAADVQTELEAQGVAFEQGSSL  84

Query  105  TPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
                 ++R D L+  F+Q  + +LR +GS  E ++R  L   +   M
Sbjct  85   DHTLAKRRADVLLETFRQGDMESLRGTGSPSEVEKRDKLAAILARLM  131

>SPRG_05316
Length=325

 Score = 60.1 bits (144),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 3/93 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            +F C+ D+ +LR V+   P+ A HG     W +VA  VA+       G T   ++ RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIH  148
            L+  F  + +  LR  G+  E+ ER +LL DI 
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDIR  126

>SPRG_18521
Length=291

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            +F C+ D+ +LR V+   P+ A HG     W +VA  VA+       G T   ++ RF+ 
Sbjct  34   KFACSDDVAMLRHVLRWCPWEAAHGSVMATWDRVAEDVAQSPDFKLKGKTGAALKSRFET  93

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+  F  + +  LR  G+  E+ ER +LL DI
Sbjct  94   LLVKFCANDMQRLRKLGTPAEFAEREVLLTDI  125

>H257_18379
Length=155

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 1/99 (1%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK-QD  123
            D+ LLREV+ ++P+   HG    RW +VA  ++     GI   + R  ++ L+ AFK  D
Sbjct  16   DLALLREVLRVKPYDGEHGTLIQRWKEVAASLSLYSNQGIPHRSARDHYEGLVQAFKATD  75

Query  124  SLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
                   +GS+E+  E+  LLQD+ D    ++  K  VK
Sbjct  76   KSQRQWGTGSDEDVPEQVQLLQDLVDRRDAADTLKTAVK  114

>PHYSO_362017
Length=273

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR-IHGSGITPNNVR  110
            +KR  AFRF   +DI LLREV+  +P+A+ HG     W  VA    R +  S       +
Sbjct  44   EKRAKAFRFTTVTDIALLREVINHKPWASSHGDMAKTWDVVAAAFKRTVPWSTNDGRACK  103

Query  111  KRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDE  170
            +R+  L  A+    L  LR SG+     +R  LL   H  MT  + R+R   +E+   D 
Sbjct  104  RRYLALAEAYGTAKLQKLRGSGTPVMNAQRESLLAQCH-AMTEEDLRRRRAAKEA---DR  159

Query  171  RP  172
            RP
Sbjct  160  RP  161

>H257_09852
Length=165

 Score = 57.4 bits (137),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK-QD  123
            D  LLREVV ++P+   +G    RW  +A  ++    + I  ++ R+R+D ++  FK +D
Sbjct  16   DTALLREVVRVEPYDGEYGTLILRWKAIAGSLSTYFEADIPYHSARERYDGMVDQFKAKD  75

Query  124  SLSTLRASGSEEEYQERALLLQDIHDF  150
                L  +GS+EE  E+  LLQD+ D 
Sbjct  76   KAQRLWRTGSDEEVTEQVQLLQDLIDL  102

>PYU1_G004359
Length=237

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 72/151 (48%), Gaps = 14/151 (9%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++RK  FRF  A D  LL E V + PFAAPHG+   RW +VA ++    G  +     R+
Sbjct  20   KQRKVQFRFSHADDARLLTETVAVNPFAAPHGRVAARWAQVADNM----GVDVDARRCRE  75

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERAL--LLQDIHDFMTVSNHRK-------REVK  162
            R   L+S F++      RA+ S  E +  ++  LL D+    ++    +       +E  
Sbjct  76   RVILLLSQFRERGADDSRATDSANEGEADSMQQLLADVATLESIKAGSRDDALPQTQEDS  135

Query  163  EESVVPDERPDSFLEPPKTSLLKRKLPETQP  193
            E  V+   R  +   P + S L+R +P  +P
Sbjct  136  ERDVIESNRERAPRTPERES-LERTMPTKRP  165

>PHYCA_530243
Length=269

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 5/121 (4%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR-IHGSGITPNNVRK  111
            KR  AFRF   +D  LLREV+  +P++  HG     W  VA    R +  S       ++
Sbjct  40   KRAKAFRFTTVTDTLLLREVLDHKPWSCSHGDMAKTWDVVAVGFKRLVPWSTNDGRACKR  99

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDER  171
            R+  L  A+  + L  LR SG+  +  +R  LL      +T  +HR+R+  +E+   D R
Sbjct  100  RYLALAEAYGTEKLQKLRGSGTPAQNAQRERLLSQCQ-LLTDEDHRRRKAAKEA---DRR  155

Query  172  P  172
            P
Sbjct  156  P  156

>PHYKE_1588
Length=333

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 76/151 (50%), Gaps = 16/151 (11%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV-ARIH---------GSG  103
            ++  FRF+   D+ L+REV+   P+AA +G+T   W  VA  V A +          G+ 
Sbjct  27   KRRLFRFKPRFDVVLVREVICSFPWAAGYGRTRSAWMNVAQRVQAELEDMGSLSFSKGAA  86

Query  104  ITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKE  163
            +    V++R D L+ AF+++ +S LR SG+ E++  R  LL  +   +      K  ++E
Sbjct  87   LDHAIVKRRVDMLLDAFRKNEMSGLRGSGTPEDFDMRNKLLAILLRVVDEQTTNKGAMRE  146

Query  164  ESVVPDERPDSFLEPPKTSLLKRKLPETQPP  194
            + V+        L+  KTSL + +   + PP
Sbjct  147  KRVL------QALDEAKTSLAELEGTGSLPP  171

>PHYCA_104165
Length=231

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN----VRKRFDD  115
            F  A DI LLR V  ++P+ A  G T           A+       P      +R RFD 
Sbjct  28   FTAADDIVLLRSVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+  F++   ++LR+SGS EEY+ER  LLQDI
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQDI  119

>PYAP_24609
Length=405

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 54/96 (56%), Gaps = 0/96 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            Q  K  + F   +D+ LL+E++ I+PF A HG+  +++  V  ++     + +    V++
Sbjct  120  QTSKKKYHFTVKADLALLKEMLNIRPFLAEHGKKGEKYETVTENLNEHLETNLACRTVKE  179

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            RF+ L+  F++   S+ R SG+ E+Y E   LL DI
Sbjct  180  RFNLLVDKFEKAEASSRRKSGAAEDYDEYEQLLTDI  215

>H257_07755
Length=181

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 5/102 (5%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDS  124
            ++ LLREV  I+PFAA + +   RW  VA+         I   + R+  D ++  FK+D 
Sbjct  21   EVALLREVTRIKPFAADNSELLQRWKLVASG----QVPKINYRSAREHVDVMLKDFKKDD  76

Query  125  LSTLRASGSEEEYQERALLLQDIHDFM-TVSNHRKREVKEES  165
             +  R+SG+EE   ER  LLQD+   M  V+  +KR+  +ES
Sbjct  77   DAQKRSSGTEEYVTERVQLLQDLVMRMDEVATSKKRKQNKES  118

>H257_01994
Length=222

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK-QD  123
            D+ LLREV+ ++P+   +G  T RW  +A+ ++      I   + R  F+ ++  FK  D
Sbjct  16   DLALLREVLRVEPYDGEYGTLTVRWKTIASKLSSCFECTIPYRSARDHFEVMLEGFKVTD  75

Query  124  SLSTLRASGSEEEYQERALLLQDIHDFMTVSN  155
                +  +GSEEE  E+  +LQDI D   V +
Sbjct  76   KAQRMFGTGSEEEVTEQVQILQDIVDRRAVKD  107

>H257_02519
Length=268

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query  61   RCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT--PNNVRKRFDDLMS  118
            RC  DI LL++V   +P+   +G     W +VAT + R+ G  +   P  ++ RF+ L++
Sbjct  20   RC-HDIMLLQQVSLSRPWEGEYGTVMTIWAEVATELNRMPGFSMVKKPGALKTRFEYLLA  78

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
              ++   ++LR SG+ EEY ER  LL DI
Sbjct  79   KHEKGESASLRKSGTTEEYSERDQLLTDI  107

>H257_17235
Length=186

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 4/98 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDS  124
            +++LLREV  I+PFAA HG    RW  V + ++  H   +     R+  D ++  FKQ+ 
Sbjct  20   EVELLREVSRIEPFAADHGDLLQRWKLVESGLSD-HEPKLNYRGAREHVDAMLKEFKQED  78

Query  125  LSTLRASGSEEEYQERALLLQDI---HDFMTVSNHRKR  159
                  SG++E+  E+  LLQD+    D +  S  RKR
Sbjct  79   KVQQLLSGTDEDVTEKVQLLQDLVMRMDEVASSKKRKR  116

>H257_07871
Length=201

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 49/84 (58%), Gaps = 2/84 (2%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT--PNNVRKRFDDL  116
            +F C  DI LL++V   +P+   +G+    W ++A  + R+ G  +   P +++ RF+ L
Sbjct  17   KFACCHDITLLKQVSLSRPWEGEYGKVMTIWAEIAAELNRMPGFSMVKKPGSLKTRFEYL  76

Query  117  MSAFKQDSLSTLRASGSEEEYQER  140
            ++  ++   ++LR SG+ EE+Q R
Sbjct  77   LAKHEKGESASLRKSGTTEEHQLR  100

>H310_03463
Length=52

 Score = 52.0 bits (123),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 41/87 (47%), Gaps = 40/87 (46%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            KRK AFRF+ AS++D+L+E                                        R
Sbjct  6    KRKVAFRFKTASNVDVLKE----------------------------------------R  25

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQE  139
            FDDL+ AFK+D L++LRAS +EEEY E
Sbjct  26   FDDLIVAFKEDKLNSLRASSTEEEYNE  52

>H257_19436
Length=199

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 53/101 (52%), Gaps = 6/101 (6%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT--PNNVRKRFDDLMSAFKQDSL  125
            LL++V   +P+ A + +    W +V   V RI G  I   P  ++ RFD L+    +  +
Sbjct  1    LLKQVNLSKPWEAGYDKVMAAWVEVCREVNRIPGYKINKKPEGLKTRFDLLIKTHCEGEV  60

Query  126  STLRASGSEEEYQERALLLQDIH----DFMTVSNHRKREVK  162
            +++R SG+ E+Y E+ LLL DI     DF   +  RK  VK
Sbjct  61   ASMRKSGTSEDYTEKDLLLTDIKARMDDFDETAAARKDNVK  101

>H310_13824
Length=169

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  101  GSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            G  +     R+RFDDL++AFK+ +L  L +SG+EEEY E   LLQDI D +
Sbjct  2    GKQLLAICCRRRFDDLLAAFKKATLKALHSSGTEEEYNELDQLLQDIVDLI  52

>PHYCA_96385
Length=135

 Score = 53.9 bits (128),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN----VRKRFDD  115
            F  A DI L R V  ++P+ A  G T           A+       P      +R RFD 
Sbjct  28   FTAADDIVLQRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDGPALRTRFDR  87

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+  F++   ++LR+SGS EEY+ER  LLQDI
Sbjct  88   LVRTFREAQRASLRSSGSTEEYKERDELLQDI  119

>H257_19488
Length=56

 Score = 51.2 bits (121),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 9/55 (16%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPN  107
            KRKTAFRF+  + ++LL+EV++++PF APHG+          ++ RI+G  IT N
Sbjct  9    KRKTAFRFQGCTVVELLKEVIHVRPFEAPHGE---------VNLQRIYGQAITVN  54

>PPTG_09063
Length=273

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF+   D +L+RE++ ++PF+A  G T   W +VA  V+      +    V  R + L 
Sbjct  3    FRFKLEHDQELMRELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQVQLNVKQVPDRLNLLK  62

Query  118  SAFKQDSLSTLRASGSEEE  136
            + FK D LS+ RA G EE+
Sbjct  63   AKFKADELSSARAIGVEED  81

>PPTG_15787
Length=126

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 57/126 (45%), Gaps = 17/126 (13%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D +LLRE+++++PFAA  G T   W+ +A  ++   G  +    V  R   L 
Sbjct  3    FRFTNDWDKELLRELIHLKPFAAVRGTTLRVWSDIAASLSSAFGVEVNVKQVCDRLTLLK  62

Query  118  SAFKQDSLSTLRASGSEE---------EYQERALLLQDIHDFMTVSNHRKREVKEESVVP  168
               K    +    SG EE          Y ER  L   + +F+ + +H K E K++S   
Sbjct  63   QMLKDSEAAAALGSGIEESVDAVNVQSHYDEREGL---VREFVALEDHFKSEKKKQS---  116

Query  169  DERPDS  174
              RP S
Sbjct  117  --RPKS  120

>PHYCA_132727
Length=261

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 12/112 (11%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D +LLRE++ ++PFAA  G T   W+ VA  ++      +    +R R   L 
Sbjct  3    FRFSNDQDKELLRELIRLKPFAAIRGTTLRVWSDVAASLSSAFSVEVNVKQIRDRLTLLK  62

Query  118  SAFKQDSLSTLRASGSEEE---------YQERALLLQDIHDFMTVSNHRKRE  160
              FK   +++ R SG EE+         Y ER  L   + +++ + +H K E
Sbjct  63   QIFKDSEVASARGSGVEEKADAVNIQSHYDEREEL---VREYVALEDHFKLE  111

>H257_04778
Length=147

 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 49/103 (48%), Gaps = 1/103 (1%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLST  127
            LLREVV + P+   HG+ T  WTK A  +       I+    +   D L+  F QD+  +
Sbjct  19   LLREVVRLGPYEVGHGKVTATWTKAALAMHEF-DPNISARACQTGCDTLLHEFSQDNQRS  77

Query  128  LRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDE  170
            +RASG EE+  +   L QDI D       R R+   E    DE
Sbjct  78   VRASGVEEDDDDIVKLKQDILDRRDAKMRRTRKRDSEHERLDE  120

>PHYCA_118350
Length=156

 Score = 52.0 bits (123),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN----VRKRFDD  115
            F  A DI LLR V  ++P+ A  G T           A+       P      +R RFD 
Sbjct  28   FTAADDIVLLRCVNLVKPWEAAMGTTNGIMKAFEVVAAKCRAVDGFPKKDDPALRTRFDR  87

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+  F++   ++LR+SGS +EY+E   LLQDI
Sbjct  88   LVRTFREAQRASLRSSGSTQEYKEHDELLQDI  119

>PPTG_11283
Length=260

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 2/79 (3%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D+++LRE++  +PFAA  G T + W  VA  +       I    +R R + L 
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKKEIKVKQIRDRLNLLK  62

Query  118  SAFKQ-DSLSTLRASGSEE  135
            + FK+ + LS L ASG EE
Sbjct  63   TRFKEKEQLSAL-ASGVEE  80

>PPTG_04601
Length=260

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 2/79 (3%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D+++LRE++  +PFAA  G T + W  VA  +       I    +R R + L 
Sbjct  3    FRFTTMEDLEMLRELIRQKPFAAKRGSTLEIWDSVAAALGSALKKEIKVKQIRDRLNLLK  62

Query  118  SAFKQ-DSLSTLRASGSEE  135
            + FK+ + LS L ASG EE
Sbjct  63   TRFKEKEQLSAL-ASGVEE  80

>H310_03851
Length=97

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 1/76 (1%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQ-D  123
            D+ LLREVV ++P+   +G  T RW  +A+ ++ +    I   + R  F+ ++  FK  D
Sbjct  16   DLALLREVVRVEPYDGEYGTLTVRWKTIASSLSTLFECDIPYRSARDHFESMVERFKSTD  75

Query  124  SLSTLRASGSEEEYQE  139
                L  +GSEEE  E
Sbjct  76   KAQRLWGTGSEEEVTE  91

>H310_14954
Length=149

 Score = 51.2 bits (121),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG------ITPNNVRKRFDDLMS  118
            DI LLR+V    PF   HGQ  +RW  VA+    + GSG      I       RF  L+ 
Sbjct  15   DIMLLRQVSLEMPFQTRHGQVMERWAAVASA---LQGSGEFTRDDIDAKRACNRFMLLLD  71

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
              ++ +  + RASG  EE  E+ +LL D+
Sbjct  72   GHRRINKESQRASGVSEEVGEKTILLDDL  100

>H310_13843
Length=118

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)

Query  122  QDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDS  174
            ++++S+LRASG+EEEY E   LLQDI D +  S+ RKR +KEE +   E+ +S
Sbjct  12   RNTISSLRASGTEEEYSEHEQLLQDIVDLIDQSHSRKRMLKEEKLAKVEKRES  64

>H310_13569
Length=205

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 62/144 (43%), Gaps = 7/144 (5%)

Query  55   KTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV---ARIHGSGITPNNVRK  111
            K   RF  A D+ L REV    PF A  G     W +VA  V      +  GI       
Sbjct  4    KDKLRFTDAEDVLLPREVNAKLPFKAKRGTVIIVWNEVADAVNSNEEFNRVGIDGKRALN  63

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIH----DFMTVSNHRKREVKEESVV  167
            RF  LM      + ++ RASG EEEY E+  LL ++H    D+ T    R  E   E+  
Sbjct  64   RFTLLMDNNHSSNEASSRASGIEEEYDEKTQLLDELHSEFEDWKTQDKVRLDEAAREAER  123

Query  168  PDERPDSFLEPPKTSLLKRKLPET  191
             +    +  E    SL+KRK  ET
Sbjct  124  IENMGLAIREQALQSLVKRKSTET  147

>H257_15150
Length=145

 Score = 50.4 bits (119),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 52/117 (44%), Gaps = 7/117 (6%)

Query  56   TAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKR  112
            T  RF    DI LLRE+    PF A  GQ   RW+ VA  V    G    G      + R
Sbjct  5    TKSRFTEDEDILLLREINGRLPFMAKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNR  64

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI----HDFMTVSNHRKREVKEES  165
            F  L+   +       RASG++E Y E+  LL D+     D+      R  EV++E+
Sbjct  65   FTLLLEGHRHKDEEGKRASGTDEGYGEKFQLLDDLLSAFDDWKNEEKVRLEEVQQEA  121

>H310_08476
Length=46

 Score = 47.8 bits (112),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 31/41 (76%), Gaps = 0/41 (0%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT  105
            D+D+L++V+ I P+ AP+GQ+  RWT+VA ++  I+G  I+
Sbjct  5    DVDILKDVISIGPYCAPYGQSNRRWTEVAVNMRPIYGESIS  45

>H257_09054
Length=151

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (51%), Gaps = 8/93 (9%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA-----RIHGSGITPNNVRKRFD  114
            F C+ +I LL  V   +P+ A  G     WT +A+ +      ++   G      + RFD
Sbjct  34   FGCSDNITLLIAVNDAKPWTASSGSLMKTWTDIASDLKANRRFKVDKDG---QGCKTRFD  90

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
             L  A+ + +L+ +R SG++EE+ E    L+DI
Sbjct  91   KLTKAYMERTLTAMRGSGTDEEFGECKQPLEDI  123

>PHYKE_6162
Length=201

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 0/61 (0%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +KR+ AFRF+ ASDI LLR+V+   P++ PHG+T   W  VA     +       ++ R+
Sbjct  25   EKRRKAFRFQTASDIVLLRQVMARTPWSCPHGETGPAWDAVAEREQLLARCQFNTDDYRR  84

Query  112  R  112
            R
Sbjct  85   R  85

>PHYCA_125686
Length=290

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 55/113 (49%), Gaps = 8/113 (7%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNV  109
            KRK   +F    D+ LLR+V   QPFA+  G   D WT +A  V  + G     IT  + 
Sbjct  33   KRK---KFSKHDDLVLLRQVNADQPFASVRGSLMDAWTSLANKVKVVEGFSKQEITGKSA  89

Query  110  RKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
            + RF+ L+   ++    +  ASG  E+Y E   LL +I   + V  H + E +
Sbjct  90   QARFNVLVENHREADKKSAAASGVSEDYTESQQLLDEI--VLAVDEHTREEAQ  140

>PPTG_03791
Length=108

 Score = 49.3 bits (116),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)

Query  53  KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV  96
           KRK AFRF  +SDI LL+E +  +P+AA HG+T   WT VAT +
Sbjct  19  KRKKAFRFVPSSDIMLLKEALKHRPWAAIHGETLAAWTSVATGL  62

>H257_13978
Length=172

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 4/85 (5%)

Query  75   IQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLMSAFKQDSLSTLRASG  132
            ++P+ AP GQ  + W  +A  +       +T +    + RF++L+ A   DSL+ +R SG
Sbjct  26   VKPWEAPSGQVMNTWADLAKDLRDNRRFRLTKDGAACKSRFENLIKAHCGDSLAAMRRSG  85

Query  133  SEEEYQERALLLQDIHDFMTVSNHR  157
            ++EE+ E   LL+DI     V +HR
Sbjct  86   TDEEFGECDQLLEDISS--QVEDHR  108

>H257_18023
Length=128

 Score = 48.9 bits (115),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 3/92 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            RF    D+ LLREV    PF    G   D W +VA  +         G        RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRVRRGAVMDAWAEVAAALLSHEDFDRPGFDAKRAHNRFTL  67

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+   + D+  ++RASG +EEY E+  LL ++
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDEL  99

>SDRG_08699
Length=168

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  52  QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRW  89
           Q  + AFRF  ASD+DLL+EV+++ P+   +GQ   RW
Sbjct  20  QTTRKAFRFTVASDVDLLKEVMFVSPYDCQYGQIAKRW  57

 Score = 32.3 bits (72),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 21/28 (75%), Gaps = 0/28 (0%)

Query  386  FVLERREREMHIEFMKGTLEILKVFASK  413
            F LER ERE+ +EF++ T+E+++   +K
Sbjct  140  FQLERSEREVQLEFIRSTIELMRSLGNK  167

>H310_15319
Length=227

 Score = 50.1 bits (118),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 43/89 (48%), Gaps = 9/89 (10%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA------RIHGSGITPNNVRKRFDDLMS  118
            D+ LLR+V Y  PF A HG   D+W  VA  +A      R        NN   RF  L+ 
Sbjct  15   DLMLLRQVAYEMPFLARHGLIMDKWASVAQALAADENFSRPDFDAKKANN---RFAALLD  71

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
            A K+ +    +ASG  EE  E+  LL D+
Sbjct  72   AHKKRNKEAEQASGVSEEVTEKVTLLDDL  100

>H257_02095
Length=198

 Score = 49.7 bits (117),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLREV+ ++P+   HG    RW +VA  ++     GI   +VR  ++ L+ AFK
Sbjct  16   DLALLREVLRVEPYDGEHGTLIQRWKEVAASLSLYSNQGIPHRSVRDHYEGLVEAFK  72

>SDRG_12398
Length=264

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLM  117
            F    D+ L R V   +P+ AP G+    W ++A  + R  G G+  +    + RF+ ++
Sbjct  41   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  100

Query  118  SAFKQDSLSTLRASGSEEEYQERALLLQDIHD  149
                      LR +G+++EY ER  LL+++++
Sbjct  101  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYE  132

>SPRG_09172
Length=265

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLM  117
            F    D+ L R V   +P+ AP G+    W ++A  + R  G G+  +    + RF+ ++
Sbjct  42   FNAWDDVLLCRAVNARKPWTAPSGEIMLYWAEIADTLMRTRGFGVKKDGPACKTRFEKIL  101

Query  118  SAFKQDSLSTLRASGSEEEYQERALLLQDIHD  149
                      LR +G+++EY ER  LL+++++
Sbjct  102  RMTIGGEKEMLRKTGTDDEYDERERLLRNMYE  133

>PYIW_25568
Length=126

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 39/60 (65%), Gaps = 4/60 (7%)

Query  109  VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIH----DFMTVSNHRKREVKEE  164
            ++ RF+ +M  F    L++LR SG++EEYQER LLL DI     DF+ +++ ++   KE+
Sbjct  45   LKTRFEKIMKLFMSQDLASLRKSGTQEEYQERELLLGDIRQRTTDFVELADFQRAREKEK  104

>H257_12325
Length=191

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHV---ARIHGSGITPNNVRKRFDDLMSAFK  121
            DI LLR+V     F A  G   +RW  VA  +        S I    +  RF  L+ A++
Sbjct  15   DIMLLRQVSLEMQFQARRGLVMERWNSVAASLRTSEDFSRSDIDAKRLCNRFMLLLDAYR  74

Query  122  QDSLSTLRASGSEEEYQERALLLQDI  147
            +    + RASG +EE+ E+++LL D+
Sbjct  75   KSDKQSERASGIDEEFTEKSMLLDDL  100

>H257_14013
Length=217

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 61/139 (44%), Gaps = 7/139 (5%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            RF    D+ LLREV    PF A  G   D W +VA  +        S         RF  
Sbjct  8    RFTEEEDVMLLREVNARMPFRARRGAVMDAWAEVAAALLSHEDFDRSVFDAKRAHNRFTL  67

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDSF  175
            L+   + D+  ++RASG +EEY E+  LL ++      +   KR   EE+    +R +S 
Sbjct  68   LLEGHRGDNRESMRASGVDEEYSEKMQLLDELLSTYDDNKAEKRGRLEEAQREADRIESL  127

Query  176  ----LEPPKTSLLKRKLPE  190
                 E    SL KR+L +
Sbjct  128  GKTVREEALQSLGKRRLAQ  146

>PPTG_05843
Length=169

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 37/66 (56%), Gaps = 0/66 (0%)

Query  71   EVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLSTLRA  130
            E++ ++PF+A  G T   W +VA  V+      +    VR R + L + FK D LS+ RA
Sbjct  3    ELIRLKPFSAKRGTTGHVWEEVAKGVSSAIQVQLNVKQVRDRLNLLKAKFKADELSSARA  62

Query  131  SGSEEE  136
            SG EE+
Sbjct  63   SGVEED  68

>H310_03385
Length=223

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 8/135 (6%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK---RFDDL  116
            F    D+ LLR+V    PF A HG   D+WT VA  +A     G    + +K   RF  L
Sbjct  10   FSKEEDVLLLRQVASEMPFLARHGLIMDKWTAVAHALASSDEFGRPDFDGKKASNRFSAL  69

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI---HDFMTVSNHRKREVKEESVVPDERPD  173
            + A K+      RASG  E+  E+  L+ D+   +D       R  E K +++  +E   
Sbjct  70   IEAHKKKKNEFARASGVAEDMTEKDALMDDLIAAYDDAKEEARRAIESK-QALEQNESMG  128

Query  174  SFL-EPPKTSLLKRK  187
            +F+ E   TSL KRK
Sbjct  129  AFVREEAMTSLGKRK  143

>PPTG_11368
Length=130

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 48/95 (51%), Gaps = 7/95 (7%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGS----GITPNNV--RKR  112
            +F    D+ LLR V   +P+ AP G   +   KV   +A   G+    G+    V  R R
Sbjct  31   KFAAVDDVVLLRAVNAFRPWRAPVG-IFNGIMKVFEDIAFQCGADPDFGVDKPGVALRTR  89

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            F  LM  FK+D   ++R SG+ E+Y+ER  L  DI
Sbjct  90   FGTLMKEFKRDQCRSMRKSGTVEQYEERDRLSVDI  124

>H310_15068
Length=108

 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 3/83 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK---RFDDLMSAFK  121
            D+ LLR+V    PF A  G   D+W + A  +A     G    + +K   RF+ L+ A +
Sbjct  15   DLLLLRQVSADMPFLARRGFVMDKWAQTAQALAGCEEFGRPDFDAKKANNRFNALIEAHR  74

Query  122  QDSLSTLRASGSEEEYQERALLL  144
            + +  + RASG  EE  E+ +LL
Sbjct  75   KSNQESSRASGISEEVTEKVMLL  97

>PPTG_16964
Length=104

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 3/81 (4%)

Query  57   AFRFRCASDIDLLREVVYIQPFAAP-HGQTTDRWTKVATHVARIHGSGITPNNVRKRFDD  115
             FRF    D+++L E++  +PFAA   G T + W  V   +       I    +R RF+ 
Sbjct  2    VFRFTTMEDLEMLWELIRQKPFAAKKRGSTLEMWDSVVAALGSALKKEINVKQIRDRFNL  61

Query  116  LMSAFKQ-DSLSTLRASGSEE  135
            L + FK+ + LS L ASG EE
Sbjct  62   LKARFKEKEQLSAL-ASGVEE  81

>PPTG_21678
Length=104

 Score = 45.1 bits (105),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN-VRK  111
            KRK AFRF  +SDI LL+E V  +P+AA HG+T    +  A  +     S        R+
Sbjct  27   KRKKAFRFVPSSDILLLKEAVKHRPWAAGHGETQVSLSSFAIGLKTALPSCTADGKACRR  86

Query  112  RFDDLMSAFKQDSL  125
            RF+  +  F++D L
Sbjct  87   RFNAPLDVFRRDEL  100

>H257_05648
Length=172

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 51/118 (43%), Gaps = 6/118 (5%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDD  115
            RF  A DI +LREV    PF A  G     W  VA  V+  H     G        RF  
Sbjct  8    RFSDAEDILILREVNARLPFTAKRGSVMLAWNTVADAVSTKHDFARPGFDGKRALNRFTL  67

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPD  173
            LM   + ++  + RASG +E++ E+  LL   H+ + V    K + K   V   +  D
Sbjct  68   LMEGHRANNDVSARASGIDEDHDEKTQLL---HELLAVYEDSKAQDKARLVAAQQEAD  122

>H257_17402
Length=149

 Score = 45.8 bits (107),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG--ITPNNVRKRFDDLMSAFKQ  122
            D+ LL++V    PFAA  GQ    W  +A  +      G  +    V+ RF  L+   ++
Sbjct  15   DLTLLKQVTADTPFAAEKGQLRKAWQGLAETLMSCENFGRVVDGKKVQNRFQALVDEHRK  74

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
               ++ R SGS++E +E+ +LL DI
Sbjct  75   FDATSARLSGSDQEEKEKHMLLDDI  99

>H257_12998
Length=141

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (51%), Gaps = 6/99 (6%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG---ITPNN  108
            QKR+   +F    DI  L ++    PF A  G+  D W  VA ++A + G          
Sbjct  5    QKRR---QFTERQDILFLTQIRVEMPFLARRGKIMDVWDSVARNLATVGGFDRPQFDGKK  61

Query  109  VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
             + RF  L+   ++D+ +++RAS   E+  E+A++L DI
Sbjct  62   AQARFAILLRDHREDNRASMRASCVSEDVTEKAIMLDDI  100

>H257_03945
Length=230

 Score = 46.6 bits (109),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLST  127
            LL+EVV + PF   HG+ T  W K A  +   +   ++    + R D ++  F +D+ ++
Sbjct  19   LLKEVVRLGPFEVGHGKVTATWAKAAVAMHE-YDPNLSGRICQARCDTILHDFARDNQAS  77

Query  128  LRASGSEEEYQERALLLQDIHDF  150
            +RASG  E+  +   L QD+ D 
Sbjct  78   MRASGVYEDDDDMTKLKQDVLDI  100

>H257_00377
Length=223

 Score = 46.6 bits (109),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDL  116
            F    DI LLR+V    PF A  G   +RW  VA  +        S I       RF  L
Sbjct  10   FSEEDDIMLLRQVSLEMPFQARRGLVMERWNSVAASLRTAEDFSRSDIDAKRSCNRFMLL  69

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            + A ++    + RASG +EE  E+++LL D+
Sbjct  70   LDAHRKSDKQSERASGIDEEVTEKSMLLDDL  100

>PHYCA_124712
Length=202

 Score = 46.2 bits (108),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 2/58 (3%)

Query  92   VATHVARIHGSGITP--NNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            +A H       G+      +R RF +L+S FK D   ++R SG+ EEY ER +LLQDI
Sbjct  7    IAVHCRLDEAFGLKKPGTAMRTRFTNLVSQFKTDQCQSMRKSGTVEEYAEREVLLQDI  64

>PYIW_25658
Length=148

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 55/101 (54%), Gaps = 9/101 (9%)

Query  75   IQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN---VRKRFDDLMSAFKQDSLSTLRAS  131
             +P+ +        W  +A+ + R + S I       ++ RF+  M  F    L++LR S
Sbjct  2    CKPWESSRNSIMKNWETIASTL-RDNQSFIANKGGLAIKTRFEKTMKLFVSQDLASLRKS  60

Query  132  GSEEEYQERALLLQDIH----DFMTVSN-HRKREVKEESVV  167
            G++E+YQ R LLL+DI     +F+ +++  R+RE ++++ +
Sbjct  61   GTQEKYQRRELLLKDIRQRTTEFVELADVQREREKEKQAGI  101

>PHYSO_536456
Length=212

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query  89   WTKVATHVARIHGSGITPNN--VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQD  146
            + ++A H       G+      +R RF  LMS FK D   ++R SG+ EEY+ER +LLQ+
Sbjct  4    FNQIAAHCLLDPAFGLKKQGPAMRTRFTTLMSQFKADQYQSMRKSGTVEEYEEREVLLQN  63

Query  147  I  147
            I
Sbjct  64   I  64

>H257_14889
Length=157

 Score = 45.1 bits (105),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 50/101 (50%), Gaps = 5/101 (5%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTK--VATHVARIHGSGITPNNVRKRFDDLMSAFKQDSL  125
            LL+EVV + PF   H + T  W K  VA H    + SG      + R D ++  F +D  
Sbjct  19   LLKEVVRLGPFEVGHDKVTATWAKAAVAMHEYDPNLSGCI---CQARCDTILHDFARDIQ  75

Query  126  STLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESV  166
            +++RASG  E+  +  +  QD+ D    S  ++   +E ++
Sbjct  76   ASMRASGVYEDDDDMTMFKQDLLDMREYSKSKRTRKRENAL  116

>PYIW_15058
Length=131

 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 40/61 (66%), Gaps = 5/61 (8%)

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIH----DFMTVSN-HRKREVKEESV  166
            RF+ ++  F    L++LR SG++EEYQER LLL++I     DF  +++  R RE ++++ 
Sbjct  2    RFEKIVKLFVSQDLASLRKSGTQEEYQERELLLENIRQRTTDFAELADVQRAREKEKQAG  61

Query  167  V  167
            +
Sbjct  62   I  62

>PPTG_04118
Length=274

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 46/81 (57%), Gaps = 4/81 (5%)

Query  72   VVYIQPFAAPHGQTTDRWTKVATHVARIHGS---GITPNNVRKRFDDLMSAFKQDSLSTL  128
            ++ I+PFA  HG+   R+  +A +++ +H      ++   V++RF  L+  FKQ+  +  
Sbjct  1    MLAIEPFAGGHGKIGARYQLMADNLS-VHLKLDPKLSKRTVQERFTLLLDEFKQNDQAYR  59

Query  129  RASGSEEEYQERALLLQDIHD  149
            + +G  E Y+E   LLQD+ D
Sbjct  60   KKTGVAENYEEHKQLLQDLSD  80

>PITG_19098
Length=295

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F  A D+ LLR V  I+P+ +      D   + A  V    G  +     R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAE----DICNETAGFVRDKQGPAL-----RTRFDKLIRQ  87

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
             +   + + R+SG+ EEY ER +LLQDI
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDVLLQDI  115

>PHYCA_38983
Length=217

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F  A D+ LLR V  I+P+ +      D   ++A  V    G  +     R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAK----DICNEMAGFVRDKQGPAL-----RTRFDKLIRQ  87

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
             +   + + R+SG+ EEY ER  LLQDI
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDI  115

>H257_14150
Length=119

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 49/107 (46%), Gaps = 13/107 (12%)

Query  59   RFRCASDIDL--LREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDL  116
            + +   D+DL  LREVV ++P+   H          A  ++     GI   + R  +D L
Sbjct  8    QLKWTDDLDLALLREVVRVEPYDGEH----------AASLSLYSNQGIPRRSARDHYDGL  57

Query  117  MSAFK-QDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
            +  FK  D       +GS+E+  E+  LLQD+ D    ++  K  VK
Sbjct  58   VQGFKATDKSQRQWGTGSDEDVPEKVQLLQDLVDQRDATDTLKTAVK  104

>PITG_12686
Length=223

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F  A D+ LLR V  I+P+ +      D   + A  V    G  +     R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWES----AKDICNETAGFVRDKQGPAL-----RTRFDKLIRQ  87

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
             +   + + R+SG+ EEY ER +LLQDI
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDVLLQDI  115

>PHYSO_389597
Length=188

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 59/127 (46%), Gaps = 21/127 (17%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHV------ARIHGSG-ITPNNVRKR  112
            F    D+ LLR+ +  +PF    G+T   W  +A  +      +R    G ++    + R
Sbjct  6    FSAEEDLALLRQALSNRPFLKERGKTMAAWDALAAQLVSDANFSRSASRGKLSGKTAQAR  65

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNH------------RKRE  160
            FD L++  +Q + + L ASG +EE  E+ +LL ++     + +H            RKR+
Sbjct  66   FDKLVTQKRQQNAAALAASGVDEEETEKDVLLDEL--IALIDDHIEAVAAENDTAKRKRD  123

Query  161  VKEESVV  167
              EE+ +
Sbjct  124  ADEEASL  130

>H257_08032
Length=251

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 53/112 (47%), Gaps = 5/112 (4%)

Query  62   CASDIDLLREVV-YIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLMS  118
            CA D  LL E V  ++P+AA  G+    W  +A  +    G  +  +    + RF+ ++ 
Sbjct  31   CARDDILLCEAVNEVKPWAARSGEIMMYWANIADKLMHTRGFALRKDGPACKTRFEKIVK  90

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDE  170
                     LR SGSE+E+ ER  L+  I   M +  ++  ++   +V+ +E
Sbjct  91   MITGGEQDVLRKSGSEDEFAERERLVMGI--CMQIDEYQAADIPTRAVLDNE  140

>PHYSO_548072
Length=362

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG-----ITPNNVRKRF  113
            +F  A DI LL +V+  +P+A PH    D W +V     R+ G        T    + R 
Sbjct  144  QFVSADDILLLTQVLETKPWAYPH--VMDGWQEVCD---RLRGHSEFHLDKTAGACQARV  198

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMT  152
              L+   K  +++ LR SG+ EEY+ +  LL D+   +T
Sbjct  199  ALLLDHLKAGNIAALRKSGTSEEYERKRELLTDVQAKLT  237

>H257_13434
Length=236

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG--ITPNNVRKRFDDLMSAFKQ  122
            D+ LL++V    PFAA  GQ    W  +A  +      G  +    V+ RF  L+   ++
Sbjct  15   DLTLLKQVAADTPFAAEKGQLRKAWQGLAETLMPCENFGRVVDGKKVQNRFLALVDEHRK  74

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
               ++ R SGS++E +E+ +LL DI
Sbjct  75   FDATSARLSGSDQEEKEKHMLLDDI  99

>PITG_05131
Length=200

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 40/79 (51%), Gaps = 2/79 (3%)

Query  92   VATHVARIHGSGITP--NNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHD  149
            +A H       G+      +R RF +L++ +K D   ++R SG+ EEY ER +LLQ+I  
Sbjct  7    IAIHCRLEQSFGLKKPGTAMRTRFTNLVNQYKADQCQSMRKSGTTEEYAEREVLLQNIVT  66

Query  150  FMTVSNHRKREVKEESVVP  168
             M     ++ + KEE    
Sbjct  67   LMNDWEDKEAQRKEEQTAK  85

>PHYCA_4828
Length=295

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F  A D+ LLR V  I+P+ +      D   ++A  V    G  +     R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAK----DICNEMAGFVRDKQGPAL-----RTRFDKLIRQ  87

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
             +   + + R+SG+ EEY ER  LLQDI
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDI  115

>PHYCA_98971
Length=295

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F  A D+ LLR V  I+P+ +      D   ++A  V    G  +     R RFD L+  
Sbjct  37   FTTADDLILLRAVNTIKPWESAK----DICNEMAGFVRDKQGPAL-----RTRFDKLIRQ  87

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
             +   + + R+SG+ EEY ER  LLQDI
Sbjct  88   HRDAQVVSRRSSGTTEEYNERDELLQDI  115

>H257_07657
Length=212

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 42/86 (49%), Gaps = 3/86 (3%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V    PF A  G   +RW  VA+ +        S I       RF  L+ A +
Sbjct  15   DVMLLRQVSLEMPFQARRGHVMERWADVASALEMADDFRRSDIDAKRACNRFMLLLDAHR  74

Query  122  QDSLSTLRASGSEEEYQERALLLQDI  147
            + +  + RASG  E+  E+ +LL D+
Sbjct  75   KANNQSQRASGVAEDVSEKTVLLDDL  100

>PHYCA_14089
Length=199

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 59/136 (43%), Gaps = 9/136 (7%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            +KRKT  RF    D  LL+EV+   PF    G      T     VA      +     R+
Sbjct  8    KKRKTQVRFDEDDDDALLKEVLAANPFEVERGGK----TAAWAAVASALALDVDARRCRE  63

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI----HDFMTVSNHRKREVKEESVV  167
            R   L++ FK     +  ASG +EE+ ER  LL D+     D  TV    K++ KE    
Sbjct  64   RCSLLLTDFKAKMARSEAASGIDEEHTERDDLLADVLELFEDAETVEEE-KKQAKEAKQR  122

Query  168  PDERPDSFLEPPKTSL  183
             DER D+  +   T +
Sbjct  123  DDERADAMRDEAMTGM  138

>PHYCA_503833
Length=313

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGI--TPNNVRKRFDDL  116
            +F  A DI LL +V+  +P+A P  Q  D W +V   +   +   +  T    + R   L
Sbjct  131  QFVSADDILLLTQVLITKPWAYP--QLMDGWQEVCEQLREHNDFNLEKTAGACQARMLLL  188

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIH  148
            +  F   +++ LR SG+ EEY+ +  LL ++H
Sbjct  189  LDHFHAGNVAALRKSGTSEEYERKRELLIEVH  220

>PHYRA_86617
Length=241

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 47/103 (46%), Gaps = 7/103 (7%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V+  +PF  P G+   RW  +A  +    G   S  +  N + R + L+ A +
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQRWDSLAATLVASPGFTHSKFSGKNAQSRMNQLVQAHR  87

Query  122  QDSLSTLRASGSEEEYQERALLLQD----IHDFMTVSNHRKRE  160
            +        SG  EE  ER  LL +    + D   V   +K+E
Sbjct  88   ETMKKAALLSGVSEEITERDQLLNELVVLLDDATLVKECKKKE  130

>PPTG_24854
Length=291

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 0/78 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D +L+RE +  +PFAA +G+    W  VA HV+      +    VR R   L 
Sbjct  3    FRFTEDHDKELMREAIAQKPFAAKYGEAARAWASVAEHVSSAIKERVLEKQVRDRVRLLK  62

Query  118  SAFKQDSLSTLRASGSEE  135
              +    L +   SG EE
Sbjct  63   KNWHAGELRSSLGSGIEE  80

>H257_06895
Length=202

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 39/73 (53%), Gaps = 2/73 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGIT--PNNVRKRFDDL  116
            +F C  DI LL++V   +P+   +G+    W +VAT + R+ G  +   P  ++ RF+ L
Sbjct  17   KFACCHDIMLLQQVSLSRPWEGEYGKVMTIWAEVATELNRMPGFSMVKKPGALKTRFEYL  76

Query  117  MSAFKQDSLSTLR  129
            ++  ++     LR
Sbjct  77   LAKHEKGENIKLR  89

>PPTG_11144
Length=251

 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 0/78 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D +L++E +  +PFAA +G+    W  VA HV+      +    VR R   L 
Sbjct  3    FRFTDDYDKELMKEAIAQKPFAAKYGEAARVWASVAEHVSSTIKERVLEKQVRDRVGLLK  62

Query  118  SAFKQDSLSTLRASGSEE  135
              +    L +   SG EE
Sbjct  63   KNWHAGELRSSLGSGIEE  80

>PPTG_06351
Length=225

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (55%), Gaps = 1/66 (2%)

Query  82   HGQTTDRWTKVATHV-ARIHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEEYQER  140
            HG+T   W KVA+ + A +          R+ F  L  AF+++   +LRASG+ EEY ER
Sbjct  17   HGKTPVAWEKVASGINAALPACTADGKVCRRPFGALHDAFRREEKESLRASGTSEEYTER  76

Query  141  ALLLQD  146
              LL D
Sbjct  77   EQLLTD  82

>H310_04215
Length=257

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 3/89 (3%)

Query  62   CA-SDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLMS  118
            CA  DI L   V  I+P+ AP G+    W  +A  +    G  +  +    + RF+ ++ 
Sbjct  25   CARDDILLCLAVKEIKPWEAPSGEIMMSWAHIAEKLLHTRGFALRKDGPACKTRFEKILK  84

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
                     LR SG++EE+ ER  L+  I
Sbjct  85   MITGGESDVLRKSGNDEEFAERERLVWSI  113

>H257_13170
Length=198

 Score = 43.1 bits (100),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 39/85 (46%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHV--ARIHGSGITPNNVRKRFDDLMSAFKQ  122
            DI LLR+V    PF A HG     W  VA  +      G  +     + RF+ L+   K 
Sbjct  17   DIVLLRQVSADLPFEASHGTIGSNWESVARTLTSCSTFGRNVNGKKCQNRFNILLDEQKI  76

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
                 ++ASG+ E+  E+  LL D+
Sbjct  77   LRQEAMKASGASEDETEKTQLLDDL  101

>PHYCA_62751
Length=116

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/93 (28%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG----SGITPNNVRKRFD  114
            +F    D+ LLR+V    PF A  G     W  +A ++  +        IT  + + RF+
Sbjct  8    KFTKTDDVALLRQVQAELPFKAAKGGVMASWDALANNLKTLKDFSKEDTITGKSAQARFN  67

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
             L+++ ++    + RASG ++ Y E+  LL D+
Sbjct  68   TLVASHRKFDKKSERASGIDQRYAEKRQLLDDL  100

>PPTG_03797
Length=210

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (49%), Gaps = 0/78 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF    D +L+ EV+  +PFAA +G+T   W +VAT V+      +    V+ R   L 
Sbjct  3    FRFSEDMDKELMCEVIKQRPFAAKYGETGTVWVQVATRVSASIKVVVIDKQVQDRVRLLK  62

Query  118  SAFKQDSLSTLRASGSEE  135
              ++   L     SG EE
Sbjct  63   KNWRAGELRATLGSGIEE  80

>PHYSO_389268
Length=107

 Score = 41.2 bits (95),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 0/60 (0%)

Query  76   QPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDSLSTLRASGSEE  135
            +PFAA  G T   W +VA  V+      +    VR R + L + FK D L + RAS  EE
Sbjct  1    KPFAAKRGSTGSVWEEVAKGVSSAIKVQLNAKQVRDRLNLLEAKFKADELCSSRASDVEE  60

>PHYKE_4001
Length=496

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGI--TPNNVRKRFDDL  116
            +F  A DI LL EV+ ++P+A  H    D W +VA ++  +    +  T    + R   L
Sbjct  267  QFSSADDIVLLTEVLSMKPWAFAH--EMDGWQQVALNLRELTACRLEKTAGACQSRIMLL  324

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIH  148
            +   +  +++ LR SG+E+E+  +  LL ++ 
Sbjct  325  LEHLRAGNIAALRKSGTEDEFSRKHELLTEVQ  356

>CCI47495
Length=285

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query  109  VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTV-----SNHRKREVKE  163
             ++RFD L+ A ++  L +LRASGSEEE  ER  LL DI   ++       N+R R+   
Sbjct  64   CKRRFDTLLDAHRRRDLDSLRASGSEEECCEREQLLLDIDRLISTHDEWRKNNRTRKTSS  123

Query  164  ESVVPDERPDSFLEPPKTSLLKRK-LPETQPPPSTID  199
             S    +    +L     +LL    L  T+  P  ++
Sbjct  124  NSSSHCDESFPYLSGAAEALLDSSPLELTKKSPDILE  160

>H257_18543
Length=323

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 44/88 (50%), Gaps = 14/88 (16%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F C+ DI LL  V      A P     +R  KV        G G T      RFD L  A
Sbjct  37   FGCSDDITLLTAV----NDAKPCDLKANRRFKVDKD-----GQGCTT-----RFDKLAKA  82

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
            +K+ SL ++R SG++EE++E   LL+DI
Sbjct  83   YKERSLVSIRRSGTDEEFKECEQLLEDI  110

>PYIW_23282
Length=227

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 60/134 (45%), Gaps = 17/134 (13%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDL  116
            F    DI LLR+ +   PF A  G+    W  +A  +A         +   N + RFD L
Sbjct  20   FTDEEDIALLRQALADLPFLAARGKVIAAWGALADKLANDDSFPREQLAGKNAQSRFDKL  79

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLL----QDIHDFMT------VSNHRKREVKEESV  166
            ++     +   L  SG  EE  E+++LL    Q I+D         ++  +KRE  EES 
Sbjct  80   VAGQWDLNADALTLSGVAEEETEKSILLNGLIQHINDNQVALQASRIAEQKKRERDEESS  139

Query  167  VPDERPDSFLEPPK  180
            +   RP+S   PP+
Sbjct  140  L--RRPES--SPPQ  149

>PHYRA_74884
Length=241

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (45%), Gaps = 7/103 (7%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V+  +PF  P G+   RW  +A  +    G   S  +  N + R + L+   +
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQRWDSLAATLVASPGFTHSKFSGKNAQSRMNQLVQTHR  87

Query  122  QDSLSTLRASGSEEEYQERALLLQD----IHDFMTVSNHRKRE  160
            +        SG  EE  ER  LL +    + D   V   +K+E
Sbjct  88   ETMKKAALLSGVSEEITERDQLLNELVVLLDDATLVKECKKKE  130

>H257_00956
Length=202

 Score = 42.0 bits (97),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 58/145 (40%), Gaps = 13/145 (9%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIH---GSGITPNNVRKRFDD  115
            RF    DI +LREV    PF A  G     W  VA  V+  H     G        RF  
Sbjct  8    RFSDTEDILILREVNARLPFNAKRGSVMLAWNAVADAVSTNHDFAWPGFDGKRALNRFTL  67

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPD--  173
            LM     ++  + RASG +E++ E+  LL ++   + V    K + K   V   E  D  
Sbjct  68   LMEGHCANNDVSARASGIDEDHDEKTQLLDEL---LAVYEDSKAQDKARLVAAQEEADRI  124

Query  174  -----SFLEPPKTSLLKRKLPETQP  193
                 +  E    SL K+K   T P
Sbjct  125  ENMGATIREEALQSLGKQKAGPTDP  149

>PPTG_19779
Length=319

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 0/79 (0%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMS  118
            RF+      L+  V   + FAAPHG+  + W  VA  +  +  +  +    R +   L+ 
Sbjct  19   RFQLCDLTKLMLIVTRRKSFAAPHGKGDEEWQAVADELNAVDTTSFSLRACRDKVAALIK  78

Query  119  AFKQDSLSTLRASGSEEEY  137
              KQ+S ++ RASG  EE+
Sbjct  79   KHKQESAASRRASGVAEEH  97

>PHYSO_340307
Length=479

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (45%), Gaps = 19/92 (21%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            F F   +++ L +E++ ++P+A  HG    R+                      R + L+
Sbjct  225  FFFTQEAELALFKEMLSVEPYATEHGFKKQRYQA-------------------NRLELLL  265

Query  118  SAFKQDSLSTLRASGSEEEYQERALLLQDIHD  149
            S F  D  S L+ SG  E+Y E   LLQDI D
Sbjct  266  SEFMLDDQSYLKKSGVSEQYTEHKRLLQDISD  297

>SDRG_04653
Length=243

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query  55   KTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFD  114
            K  F+F    D++LLR V+  +P+ A HG   ++W ++ T +    G   +    + R+ 
Sbjct  13   KKRFKFNYEEDMELLRLVLKHEPYNAVHGSVAEKWEQIRTTLCAYVGKQFSARACKDRYG  72

Query  115  DLM-SAFK  121
             LM S F+
Sbjct  73   ILMQSGFR  80

>PHYSO_453976
Length=138

 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 41/86 (48%), Gaps = 4/86 (5%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++R+T  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+
Sbjct  8    KRRETIVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE----VDVDGRRCRE  63

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEY  137
            R D L+ A++   +++ + SG  EEY
Sbjct  64   RCDQLVDAYEAKQMASEKRSGPCEEY  89

>H257_08837
Length=225

 Score = 42.0 bits (97),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK---RFDDL  116
            F    DI LLR+V    PF A  G   D WT +A  +A     G    + +K   RF  L
Sbjct  10   FTEEEDIMLLRQVSADMPFLARRGLIMDNWTAIAETLAANEDFGRPDFDAKKANNRFIAL  69

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
              A ++    + RASG  E+  E+  LL DI
Sbjct  70   AEAHRKIHRVSARASGISEDVGEKVALLDDI  100

>H310_15146
Length=76

 Score = 39.3 bits (90),  Expect = 0.003, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 31/57 (54%), Gaps = 0/57 (0%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+VV ++P+   +G    RW  +A  +A +    I   + R  ++ ++ AFK
Sbjct  17   DLALLRQVVRVEPYDGEYGTLIARWKVIAVSLATLFEYEIKYRSARDHYESMVEAFK  73

>H257_18152
Length=209

 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 41/92 (45%), Gaps = 3/92 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDD  115
            RF    D+ +LREV    PF A  G     W  VA  VA        G      + RF  
Sbjct  8    RFSEYEDVLILREVNARLPFMAKRGLVMVGWAAVAEAVASQEEFSRPGFDAKRAQNRFTL  67

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            L+   +     ++RASG  E+Y E++ LL ++
Sbjct  68   LLEGHRVRDDESMRASGVAEDYNEKSQLLDEL  99

>H310_08383
Length=71

 Score = 38.9 bits (89),  Expect = 0.004, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 30/57 (53%), Gaps = 0/57 (0%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+VV ++P+   +G    RW  +A  +A      I   + R  ++ ++ AFK
Sbjct  12   DLALLRQVVRVEPYDGKYGTLIARWKVIAVSLATFFEYEIKYRSARDHYESMVEAFK  68

>H310_03921
Length=104

 Score = 39.7 bits (91),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)

Query  131  SGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDS  174
            SG+EEEY ER  LLQD  D +  S+ RKR +KEE +   E+ +S
Sbjct  14   SGTEEEYSEREHLLQDSVDLIDQSHSRKRMLKEEKLAKVEKRES  57

>SDRG_15499
Length=278

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIH--GSGITPNNVRKRFDDLMSAFKQ  122
            D+ LLR++   +PFA  HG+    W KVA  +         +    ++ RF  L+ A K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
             +  +   SG +E+  E+ +LL D+
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDDL  121

>HYAP_00630
Length=432

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query  55   KTAFR--FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGI--TPNNVR  110
            +TA R  F  A DI LL +V   +P+A PH    D W  V + + +     +  T    +
Sbjct  209  RTASRKQFVSADDILLLTQVKVTKPWAYPH--LMDGWQAVCSELRKHSNFNLEKTAGACQ  266

Query  111  KRFDDLMSAFKQDSLSTLRASGSEEEY-QERALLLQ  145
             R   L+   +  +++ LR SG+ EEY Q+R LL+Q
Sbjct  267  ARVALLLDHLRAGNVAALRKSGTLEEYEQKRELLVQ  302

>PYU1_G010696
Length=297

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 47/101 (47%), Gaps = 0/101 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            F F   +D+ +LRE + ++ FAAP GQ      +    V     + I   +  +RF  L+
Sbjct  37   FYFTPGADVVVLREALVLELFAAPRGQKHKLIDEFGERVCAALNASIIARSAYERFLLLV  96

Query  118  SAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRK  158
              F+++     + SG+  +Y E   LL ++ D +     +K
Sbjct  97   RTFEKNDKVHKKNSGTYSQYLETQKLLNEVCDRIEACEAQK  137

>SDRG_17266
Length=278

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIH--GSGITPNNVRKRFDDLMSAFKQ  122
            D+ LLR++   +PFA  HG+    W KVA  +         +    ++ RF  L+ A K 
Sbjct  37   DVMLLRQISADRPFAQHHGRLRMAWAKVANTLMSCEEFTREVDAKKIQNRFSALLEAHKA  96

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
             +  +   SG +E+  E+ +LL D+
Sbjct  97   FNKGSAAKSGVDEDETEKIMLLDDL  121

>PPTG_06633
Length=292

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 37/78 (47%), Gaps = 0/78 (0%)

Query  58   FRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FRF   +D +L+RE +  +PFAA +G +   W  VA  ++      +    VR R   L 
Sbjct  3    FRFTNENDKELMREAIAQKPFAAKYGDSARVWATVAERMSAAIQIVVLEKQVRDRVRLLK  62

Query  118  SAFKQDSLSTLRASGSEE  135
              ++   L +   SG EE
Sbjct  63   KIWRAGELRSALGSGIEE  80

>H257_09605
Length=235

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 40/88 (45%), Gaps = 25/88 (28%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F C+ DI LL  V   +P+ A  G                          + RFD+L  A
Sbjct  51   FGCSDDITLLIAVNDAKPWTASQG-------------------------CKTRFDNLTKA  85

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI  147
            +K+ +L+ +  SGS++E+ E   LL+DI
Sbjct  86   YKEHTLAAMPRSGSDKEFGECEQLLEDI  113

>H310_04226
Length=236

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (51%), Gaps = 5/87 (6%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPN----NVRKRFDDLMSAF  120
            D+ LL +V    PF A  G+  D W  VA ++A I G    PN      + RF  L+   
Sbjct  15   DVLLLTQVSVEMPFLAHRGKIMDVWESVARNLATI-GEFDRPNFDGKKAQARFLILLRDH  73

Query  121  KQDSLSTLRASGSEEEYQERALLLQDI  147
            +  + ++ RASG+ E   E+ +LL D+
Sbjct  74   RDSNNASQRASGAAEHVTEKTVLLDDL  100

>H257_05356
Length=224

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 44/96 (46%), Gaps = 6/96 (6%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK---RFDDL  116
            F    +I LLR+V    PF A  G   D+W  +A  +A     G    + +K   RF  L
Sbjct  10   FTEEEEITLLRQVSADMPFLARRGLIMDKWVAIAETLAANEDFGSPDFDAKKANNRFIAL  69

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI---HD  149
              A ++ +  + RASG  E+  E   LL DI   HD
Sbjct  70   AEAHRKSNRVSARASGISEDVGENVALLDDILSAHD  105

>PHYSO_516255
Length=412

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 47/97 (48%), Gaps = 10/97 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG-----ITPNNVRKRFD  114
            F  + DI LL  V+ ++P+  P+    D W +V   V ++ G G      T    + R +
Sbjct  195  FVSSEDILLLTRVLAVKPWTFPYA--MDGWQQV---VEKLRGDGNFRLEKTAGACQARVN  249

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
             L+   K  + + LR SG+E+E+  +  LL ++   M
Sbjct  250  LLLGHMKAGNTAALRKSGTEDEFDRKCALLSEVSSQM  286

>H257_03208
Length=105

 Score = 38.9 bits (89),  Expect = 0.006, Method: Composition-based stats.
 Identities = 21/48 (44%), Positives = 30/48 (63%), Gaps = 2/48 (4%)

Query  110  RKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            + RF+ L+ A   DSL+ +R SG+ EE+ ER  LL+DI   M   +HR
Sbjct  27   KSRFEKLIKAHSGDSLAAMRRSGTGEEFGERDQLLEDISSQM--EDHR  72

>PYAR_24700
Length=154

 Score = 40.0 bits (92),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 6/91 (7%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN---VRKRFDDL  116
            F CA DI+LLRE  + +P+A P       W  +A  + R + S     +   +  RF+ L
Sbjct  9    FTCADDINLLREASFHRPWAQPWLMRA--WETLAQRL-RTYASFPQDKDGKALSTRFNLL  65

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            +  ++++++ ++R SG EEE+ ER  LL++I
Sbjct  66   VKKYRENAVHSMRKSGREEEFFEREQLLEEI  96

>H310_11951
Length=81

 Score = 38.1 bits (87),  Expect = 0.007, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK  121
            LLREVV ++P+   +G    RW  +A  +A +    I   + R  ++ ++ AFK
Sbjct  19   LLREVVRVEPYDCEYGTFIARWKVIAASLATLFKCEIPYRSARDHYESMVEAFK  72

>H310_15160
Length=200

 Score = 40.4 bits (93),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 46/94 (49%), Gaps = 9/94 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA------RIHGSGITPNNVRKRF  113
            F    DI LL +V   +P  A  G+  D W  VA ++       R H  G      + RF
Sbjct  10   FNEREDILLLTQVSVERPHIARRGRIMDVWDSVARNLNTLDEFNRRHFDG---KRAQARF  66

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            + L+   K+ ++++ R SGS+E   ER +LL D+
Sbjct  67   NLLLRDHKERNVASNRPSGSDEVVDERVVLLDDL  100

>H257_05272
Length=133

 Score = 39.3 bits (90),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 38/80 (48%), Gaps = 3/80 (4%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR---FDDLMSAFKQDS  124
            LLR+V    PF A HG   D+W  VA  +        T  + +K    F+ L+   ++ +
Sbjct  2    LLRQVSLELPFLARHGLIMDKWATVAWALVAADEFTRTDLDTKKANNGFNALVDGHRKHN  61

Query  125  LSTLRASGSEEEYQERALLL  144
                RASG  EE  E+ LLL
Sbjct  62   NEAERASGVSEEVSEKILLL  81

>PPTG_16083
Length=241

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIH---GSGITPNN  108
            +KR+  F F   +D+ LL+E++  +PFA  HG+   R+  VA +++  H      ++   
Sbjct  160  KKRRRKFFFDQKADLALLKEMLANEPFAGGHGKIGARYQLVADNLS-AHLKLDQKLSKRT  218

Query  109  VRKRFDDLMSAFKQD  123
            V++RF  L+  FKQ+
Sbjct  219  VQERFALLLDEFKQN  233

>PHYSO_376280
Length=138

 Score = 39.3 bits (90),  Expect = 0.008, Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 45/96 (47%), Gaps = 4/96 (4%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++RKT  RF    D  L++E   I P+   +G+ T  W  VA  +       +     R+
Sbjct  8    KRRKTMVRFTDERDFQLIQEAQAINPYGEDYGKKTQAWADVAAALE----VDVDGRRCRE  63

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            R + L+ A++    ++ + SG  EEY  +   L ++
Sbjct  64   RCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAEL  99

>PHYSO_317488
Length=411

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 47/97 (48%), Gaps = 10/97 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG-----ITPNNVRKRFD  114
            F  + DI LL  V+ ++P+  P+    D W +V   V ++ G G      T    + R +
Sbjct  201  FVSSEDILLLTRVLAVKPWTFPYA--MDGWQQV---VEKLRGDGNFRLEKTAGACQARVN  255

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
             L+   K  + + LR SG+E+E+  +  LL ++   M
Sbjct  256  LLLGHMKAGNTAALRKSGTEDEFDRKCALLSEVSSQM  292

>PHYSO_380505
Length=138

 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (5%)

Query  54   RKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRF  113
            RKT  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+R+
Sbjct  10   RKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQTWADVAAALE----VDVDGRRYRERY  65

Query  114  DDLMSAFKQDSLSTLRASGSEEEY  137
            + L+ A++    ++ + SG  EEY
Sbjct  66   NQLVDAYEAKQKASEKRSGPCEEY  89

>H310_03462
Length=243

 Score = 40.4 bits (93),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG--SGITPNNVRKRFDDLMSAFKQ  122
            D+ LL +V   QPFAA  GQ T  W  +A  + +       +    V+ RF  L+    +
Sbjct  15   DVALLIQVAADQPFAATKGQLTKSWQLLAETLMQSDNFTRVVDSRKVQNRFSLLVDEHIK  74

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
             +  + + SG +EE++E+ +LL D+
Sbjct  75   FNSESAKLSGVDEEHREKHILLDDM  99

>H257_04751
Length=119

 Score = 38.5 bits (88),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 2/74 (3%)

Query  76   QPFAAPHGQTTDRWTKVA-THVARIHGSGITPN-NVRKRFDDLMSAFKQDSLSTLRASGS  133
            +PFAA  GQ T  W  +A T +A  H + +     V+ RF  L+   ++ + ++ + SG 
Sbjct  26   KPFAAEKGQLTKAWQALANTLLACDHFTRVVDGRKVQNRFSALVEEHRRFNKASAKLSGD  85

Query  134  EEEYQERALLLQDI  147
            +EE  E+ +LL DI
Sbjct  86   DEEETEKHILLDDI  99

>PHYSO_373613
Length=130

 Score = 38.9 bits (89),  Expect = 0.012, Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 41/88 (47%), Gaps = 4/88 (5%)

Query  53   KRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR  112
            +RKT  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+R
Sbjct  1    RRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALV----VDVDGRRCRER  56

Query  113  FDDLMSAFKQDSLSTLRASGSEEEYQER  140
             + L+ A++   +++ + SG  EEY  +
Sbjct  57   CNQLVDAYEAKQMASEKPSGPCEEYAPK  84

>PHYSO_470381
Length=145

 Score = 38.9 bits (89),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 40/86 (47%), Gaps = 4/86 (5%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++RKT  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+
Sbjct  8    KRRKTMVRFTDELDFQLIQEAQARNPYGEDYGKKTQAWADVAAALE----VDVDGRRCRE  63

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEY  137
            R + L+ A++    ++ + SG  EEY
Sbjct  64   RCNQLVDAYEAKQKASEKRSGPCEEY  89

>PHYRA_93678
Length=217

 Score = 39.7 bits (91),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 42/106 (40%), Gaps = 11/106 (10%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPN-------NVRK  111
            +F  A D+ LL  +    PF A HG     W  VA  V    G  +  N         R 
Sbjct  29   KFNGAMDVLLLEALQVNNPFTAKHGTRLQMWHNVAESV----GVSVFKNPAAYSWHTCRD  84

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            R   LM  +       L   G+ EE   +  +L++I+D +   NH+
Sbjct  85   RVTALMKMYTDGKHDKLFKHGTMEENARKEAILREINDTLIRKNHK  130

>PHYSO_254181
Length=154

 Score = 38.9 bits (89),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 24/102 (24%), Positives = 46/102 (45%), Gaps = 4/102 (4%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++RKT  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+
Sbjct  19   KRRKTMVRFTDELDFQLIQEAQARYPYGEDYGKKTQAWADVAAALE----VDVDGRRCRE  74

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTV  153
            R + L+ A++    ++ + SG  EEY  +   L ++ +   +
Sbjct  75   RCNQLVDAYEAKQKASEKRSGPCEEYTPKDECLAELLEMREI  116

>H310_04474
Length=210

 Score = 39.7 bits (91),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 1/100 (1%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGS-GITPNNVRKRFDDLMS  118
            F    D+ LL +     PF A  GQ  D W  VA ++A +           + RF  L+ 
Sbjct  10   FSEREDVLLLTQFSAEMPFLARRGQIMDVWDSVARNLATLFDRPQFDGEKAQGRFLILLR  69

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRK  158
              + +  ++ RASG+ E   E+ +LL D++  +  +N ++
Sbjct  70   DNRDNKNASRRASGAPENVTEKTILLDDLYKQVDKANQKE  109

>H257_12986
Length=385

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 3/80 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V    PF A  G  T++WT VA  +        +G+       RF+ L+++ +
Sbjct  15   DLMLLRQVSLELPFLARRGLITEKWTAVARALVASDEFTRTGLDAKKANNRFNALVNSHR  74

Query  122  QDSLSTLRASGSEEEYQERA  141
            + +  + R SG  EE  E+ 
Sbjct  75   KYNKDSERTSGVSEEVSEKV  94

>PPTG_06723
Length=149

 Score = 38.5 bits (88),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 8/75 (11%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFKQDS  124
            D +L+REV+  +PFAA +G+T   W +VAT V+    + I    + K+  D +   K++ 
Sbjct  2    DKELMREVIKQRPFAAKYGETGTVWVQVATCVS----ASIKVVEIDKQVQDRVRLLKKNW  57

Query  125  LS-TLRA---SGSEE  135
             +  LRA   SG EE
Sbjct  58   RAGELRATLGSGIEE  72

>PPTG_14366
Length=283

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG----SGITPNNVRKRFD  114
            +F  A D+ LLR+V    PF A  G     W  +A ++  +        I+  + + RF+
Sbjct  125  KFTNADDVALLRQVQADMPFKAAKGGVMASWDSLANNLKTLKNFSKKDTISGKSAQARFN  184

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
             L+ ++++    +  AS  ++ Y E+  LL D+
Sbjct  185  TLVISYRKFDRKSEGASDIDQRYAEKRQLLDDL  217

>H257_11942
Length=232

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 3/79 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V    PF A  G   D+WT VA  +        + +       RF+ L+ + +
Sbjct  15   DLMLLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNALIDSHR  74

Query  122  QDSLSTLRASGSEEEYQER  140
            + +  + RASG  EE  E+
Sbjct  75   KHNKDSERASGVSEEVSEK  93

>PHYSO_325763
Length=157

 Score = 38.1 bits (87),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 40/86 (47%), Gaps = 4/86 (5%)

Query  52   QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK  111
            ++RKT  RF    D  L++E     P+   +G+ T  W  VA  +       +     R+
Sbjct  19   KRRKTMVRFTDELDFQLIQEAQARNPYGKDYGKKTQAWADVAAALE----VDVDGRRCRE  74

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEY  137
            R + L+ A++    ++ + SG  EEY
Sbjct  75   RCNQLVDAYEAKQKASEKRSGPCEEY  100

>PPTG_00270
Length=249

 Score = 38.9 bits (89),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGS---GITPNNVRKRFDDL  116
            F  + DI LL +V+ I+P+  P+    D W +V T   R   S     T    + R + L
Sbjct  36   FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQV-TEKLRAEESFRLDKTAGACQARLNLL  92

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFM  151
            +   K  + + LR SG+EEE+  +  ++ ++   M
Sbjct  93   LGHLKAGNTTALRKSGTEEEFDRKCAMVAEVAKQM  127

>PPTG_00272
Length=436

 Score = 39.7 bits (91),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGS---GITPNNVRKRFDD  115
            +F  A DI LL +V+  +P+A P  Q  D W +V   + R H       T    + R   
Sbjct  219  QFVSADDILLLSQVLETKPWAYP--QLMDGWQEVCDQL-RQHSDFNLDKTAGACQARVVL  275

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMT  152
            L+   +  +++ LR SG+ +EY+ +  LL ++   +T
Sbjct  276  LLDHLRAGNVAALRKSGTSQEYERKRELLTEVQAKIT  312

>HYAP_06778
Length=224

 Score = 38.9 bits (89),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (43%), Gaps = 5/103 (5%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG----SGITPNNVRKRFD  114
            +F  + D+ LL  +    PF A HG     W  VA  V  + G    +  + +  R R  
Sbjct  13   KFNGSMDVLLLEALQENNPFTAKHGTRLQMWQNVAETVG-LQGFKNPAAFSWHTCRDRVT  71

Query  115  DLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
             LM  +       L   G+ EE   +  +L++I++ +   NH+
Sbjct  72   ALMKMYTDGKHDKLFKHGTMEENSRKESILREINNTLIRKNHK  114

>H310_14075
Length=217

 Score = 38.5 bits (88),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 40/89 (45%), Gaps = 9/89 (10%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG------ITPNNVRKRFDDLMS  118
            DI LLR+V    PF A  GQ  +RW  VA+ +    GSG      I       RF  L+ 
Sbjct  15   DIMLLRQVSLEMPFQARRGQVMERWADVASALL---GSGEFTRDDIDAKRACNRFMLLLD  71

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
               + +  +  ASG  +E  E+   L D+
Sbjct  72   GHHRINKESQCASGVSDEVGEKTNFLDDL  100

>H310_15181
Length=93

 Score = 36.2 bits (82),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 0/50 (0%)

Query  125  LSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESVVPDERPDS  174
            +++LRAS ++EEY ER  LLQ++ D +     +KR  KEE    +++ +S
Sbjct  1    MASLRASETDEEYNERDQLLQELSDMIDSIALKKRAFKEEKSKNEDKRES  50

>H310_10580
Length=199

 Score = 38.1 bits (87),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 34/89 (38%), Gaps = 40/89 (45%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMS  118
            +F C  DI LL ++ +  P+ A HG+               H S                
Sbjct  24   KFACHHDIKLLLQITFASPWEADHGK---------------HAS----------------  52

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDI  147
                     LR SG+ EEY+ER  LLQDI
Sbjct  53   ---------LRKSGTAEEYEEREHLLQDI  72

>PHYCA_129230
Length=141

 Score = 37.4 bits (85),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 0/39 (0%)

Query  109  VRKRFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            +R RFD L+   +   + + R+SG+ EEY ER  LLQDI
Sbjct  30   LRTRFDKLIRQHRDAQVVSRRSSGTTEEYNERDELLQDI  68

>H257_04948
Length=247

 Score = 38.1 bits (87),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 40/85 (47%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNN--VRKRFDDLMSAFKQ  122
            DI LL EV + +P+ +        W K+A  +          +   +RKR + L+     
Sbjct  26   DIALLNEVSFSRPWESRRSAAGLAWEKIAKKLTTDTSLSAFKSGPALRKRTEFLLKKHAA  85

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
            +  ++LR SGS EEY  R  LL D+
Sbjct  86   NEHASLRKSGSTEEYDVRTQLLTDV  110

>H257_06151
Length=139

 Score = 37.0 bits (84),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 50/71 (70%), Gaps = 7/71 (10%)

Query  349  VFAKANEIKAGEVQ-------ValrkveleearlalerserearFVLERREREMHIEFMK  401
            + AKANE+KA EV+       +A + +EL+E R  L+++EREARF LERRERE  +EF+ 
Sbjct  1    MVAKANEVKAEEVRAQHENNMLAQQMLELDEKRYELDKAEREARFALERREREAQLEFLH  60

Query  402  GTLEILKVFAS  412
            GTLE  + F++
Sbjct  61   GTLEYRERFSA  71

>PHALS_06409
Length=227

 Score = 38.1 bits (87),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 25/102 (25%), Positives = 46/102 (45%), Gaps = 3/102 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA-RIHG--SGITPNNVRKRFDD  115
            +F  + D+ LL+ +    PF A HG     W  +A  V  +I    +  + +  R R   
Sbjct  22   KFNGSMDVVLLQALQLNNPFTAKHGTRLQMWQHIAEAVGLQIFNNPNAFSWHTCRDRVTA  81

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            LM  +       L   G+ EE  ++  +L++I++ +   NH+
Sbjct  82   LMKMYTDGKHDKLFKHGTMEENAQKESILREINETLLRKNHK  123

>SPRG_10836
Length=82

 Score = 35.4 bits (80),  Expect = 0.065, Method: Composition-based stats.
 Identities = 14/43 (33%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  52  QKRKTAFRFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVAT  94
           ++ K  F+F    D++LLR V+  +P+ A HG   ++W  + T
Sbjct  10  EEGKKRFKFNYEEDMELLRLVLKYEPYNAVHGSVAEKWEHIRT  52

>PPTG_00266
Length=437

 Score = 38.5 bits (88),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (7%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGS---GITPNNVRKRFDDL  116
            F  + DI LL +V+ I+P+  P+    D W +V T   R   S     T    + R + L
Sbjct  224  FVSSDDILLLTQVLVIKPWTFPY--VMDGWQQV-TEKLRAEESFRLDKTAGACQARLNLL  280

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            +   K  + + LR SG+EEE+  +  ++ ++
Sbjct  281  LGHLKAGNTTALRKSGTEEEFDRKCAMIAEV  311

>H310_11868
Length=117

 Score = 36.2 bits (82),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 5/87 (6%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPN----NVRKRFDDLMSAF  120
            D+ LL +V    PF A  G+  D W  VA ++A I G    P       + RF  L+   
Sbjct  15   DVLLLTQVSAEMPFLARRGKIMDVWDSVARNLATI-GEFDRPQFDGKKAQARFLILLRDH  73

Query  121  KQDSLSTLRASGSEEEYQERALLLQDI  147
            + +S ++  ASG+ E   E+ +LL ++
Sbjct  74   RDNSNASRHASGAAENVTEKTILLDNL  100

>H257_10999
Length=244

 Score = 37.7 bits (86),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  65  DIDLLREVVYIQPFAAPHGQTTDRWTKVAT  94
           ++ LLREV  I+PFAA HG+   RW  VA+
Sbjct  20  EVALLREVTRIEPFAADHGELLQRWKLVAS  49

>PHYRA_78761
Length=184

 Score = 37.4 bits (85),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 36/79 (46%), Gaps = 3/79 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V+  +PF  P G+    W  +A  +    G   S ++  N + R + L+   +
Sbjct  28   DVALLRQVLLDRPFDKPRGKVMQHWDSLAATLVASSGFTRSKLSGKNSQSRINQLVRTHR  87

Query  122  QDSLSTLRASGSEEEYQER  140
            +        SG  EE  ER
Sbjct  88   ETMKKAALLSGVSEEITER  106

>H257_16845
Length=209

 Score = 37.4 bits (85),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 48/115 (42%), Gaps = 7/115 (6%)

Query  80   APHGQTTDRWTKVATHVARIHGS---GITPNNVRKRFDDLMSAFKQDSLSTLRASGSEEE  136
            A  GQ   RW+ VA  V    G    G      + RF  L+   +       RASG++E 
Sbjct  2    AKRGQVMVRWSAVAEAVQSQDGFDRPGFDGKRAQNRFTLLLEGHRHKDEEGKRASGTDEG  61

Query  137  YQERALLLQDI----HDFMTVSNHRKREVKEESVVPDERPDSFLEPPKTSLLKRK  187
            Y E+  LL D+     D+      R  EV++E+   D    +  +    SL KRK
Sbjct  62   YGEKFQLLDDLLSAFDDWKNEEKVRLEEVQQEADRVDAMAATIRDEAMKSLGKRK  116

>H257_13212
Length=153

 Score = 36.6 bits (83),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (4%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LLR+V    PF A  G   ++WT VA  +        + +       RF+ L+ + +
Sbjct  15   DVMLLRQVSLELPFLARRGIIMEKWTAVARALVASDEFTRTDLDAKKANNRFNLLIDSHR  74

Query  122  QDSLSTLRASGSEEEYQER  140
            + +  + RASG  EE  E+
Sbjct  75   KHNKDSERASGVSEEVSEK  93

>SPRG_04833
Length=219

 Score = 37.4 bits (85),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (51%), Gaps = 4/83 (5%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHG---SGITPNNVRKRFDDLMSAFK  121
            D+ LLREV   +PF A +G     WT +A  V    G   +  +    + RF  L+S  +
Sbjct  12   DVILLREVARDRPFLARYGLVAGAWTSLAAKVVATEGFTRTNFSSTKAQVRFTTLISNHR  71

Query  122  QDS-LSTLRASGSEEEYQERALL  143
             ++  S L +  SE  +++R+LL
Sbjct  72   SETETSLLDSKCSEVCFEKRSLL  94

>PPTG_08500
Length=285

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (45%), Gaps = 2/78 (3%)

Query  60   FRCASDID--LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLM  117
            FR + DID  L+RE +  +P+ A +G+    W +VA  V+      +    V+ R   L 
Sbjct  3    FRFSEDIDKELMREAIKQKPYTAKYGEAAAVWVQVAKCVSAAVKVSLVDKQVQDRVRLLK  62

Query  118  SAFKQDSLSTLRASGSEE  135
              +    L     SG EE
Sbjct  63   KNWSAGELRAALGSGIEE  80

>PITG_15738
Length=227

 Score = 37.4 bits (85),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 24/102 (24%), Positives = 42/102 (41%), Gaps = 3/102 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            +F    D+ LL  +    PF A HG     W  VA  +      + +  + +  R R   
Sbjct  40   KFNGTMDVMLLEALQINNPFTAKHGTRLQMWQNVAEAIGMQVFKNPAAFSWHTCRDRVTA  99

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            LM  +       L   G+ EE   +  +L++I++ +   NH+
Sbjct  100  LMKMYTDGKHDKLFKHGTMEENARKETILREINETLLRKNHK  141

>PHYCA_504134
Length=205

 Score = 37.0 bits (84),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (42%), Gaps = 3/96 (3%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDDLMSAFK  121
            D+ LL  +    PF A HG     W  VA  V      + S  + +  R R   LM  + 
Sbjct  2    DVLLLEALQLNNPFTAKHGTRLQMWQNVAEAVGMQVFKNPSAFSWHTCRDRVTALMKMYT  61

Query  122  QDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
                  L   G+ EE   +  +L++I++ +   NH+
Sbjct  62   DGKHDKLFKHGTMEENARKESILREINETLVRKNHK  97

>PPTG_18296
Length=248

 Score = 37.0 bits (84),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 24/102 (24%), Positives = 41/102 (40%), Gaps = 3/102 (3%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVAR---IHGSGITPNNVRKRFDD  115
            +F    D+ LL  +    PF A HG     W  VA  +      +    + +  R R   
Sbjct  40   KFNGTMDVMLLEALQVNNPFTAKHGTRLQMWQNVAESIGMQVFKNPGAFSWHTCRDRVTA  99

Query  116  LMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            LM  +       L   G+ EE   +  +L++I++ +   NH+
Sbjct  100  LMKMYTDGKHDKLFKHGTMEENARKETILREINETLLRKNHK  141

>H257_14499
Length=170

 Score = 36.2 bits (82),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDL  116
            F    DI LLR+V     F A   Q  +RW +VA+ +        + I        F  L
Sbjct  10   FTEGEDIMLLRQVTLEMLFEARRDQVMERWAEVASGLNTADEFRRTDIDAKKACNHFILL  69

Query  117  MSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            + A ++ +  + +ASG  E+  E+ +LL D+
Sbjct  70   LDAHRKANNQSQQASGVAEDVGEKVVLLDDL  100

>PHYSO_354699
Length=206

 Score = 36.6 bits (83),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 40/96 (42%), Gaps = 3/96 (3%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDLMSAFK  121
            D+ LL  +    PF A HG     W  VA  V      + +  + +  R R   LM  + 
Sbjct  2    DVTLLEALQVNNPFTAKHGTRLQMWQNVAESVGISLYKNPAAYSWHTCRDRVTALMKMYT  61

Query  122  QDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
                  L   G+ EE   +  +L++I++ +   NH+
Sbjct  62   DGKHDKLFKHGTMEENARKETILREINETLIRKNHK  97

>H257_13416
Length=232

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 3/76 (4%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVA---RIHGSGITPNNVRKRFDDLMSAFKQDS  124
            LLR+V    PF A  G   D+WT VA  +        + +       RF+ L+ + ++ +
Sbjct  18   LLRQVSLELPFLARRGLIMDKWTAVARALVASDEFTRTDLDAKKANNRFNALIDSHRKHN  77

Query  125  LSTLRASGSEEEYQER  140
              + RASG  EE  E+
Sbjct  78   KYSERASGVSEEVSEK  93

>H257_08669
Length=212

 Score = 36.6 bits (83),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 45/85 (53%), Gaps = 2/85 (2%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRW-TKVATHVARIHGSGIT-PNNVRKRFDDLMSAFKQ  122
            DI LL +V   +PFAA  GQ    W T+  T +     + +     +  RF  L+   ++
Sbjct  15   DIMLLIQVANDKPFAAEKGQVAKAWQTQAETLMESEQFTRVVDARKLLNRFTILVDEHRR  74

Query  123  DSLSTLRASGSEEEYQERALLLQDI  147
             ++++ + SGS++E Q + +LL DI
Sbjct  75   FAVASAKLSGSDQEEQGKHMLLDDI  99

>H257_04666
Length=206

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query  77   PFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKR---FDDLMSAFKQDSLSTLRASGS  133
            PF A  GQ  +RWT+VA+ +       +T  + +K    F  L+ A ++ +  + +ASG 
Sbjct  2    PFQARRGQVMERWTEVASGLNTADEFRLTDIDAKKACNCFILLLDAHRKANNQSQQASGV  61

Query  134  EEEYQERALLLQDI  147
             E+  E+ +LL D+
Sbjct  62   AEDVGEKVVLLDDL  75

>H257_10707
Length=213

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 44/96 (46%), Gaps = 18/96 (19%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSA  119
            F C+ DI LL  V      A P     +R  KV        G G      + RF+ L  A
Sbjct  127  FGCSDDITLLIAV----NDAKPCDLKDNRRFKVDKD-----GQG-----CKTRFNKLAKA  172

Query  120  FKQDSLSTLRASGSEEEYQERALLLQDI----HDFM  151
             K+ S S +R SG++EE+ E   LL DI    +DF+
Sbjct  173  NKERSFSAMRRSGTDEEFNECEQLLGDILSQVNDFV  208

>PYIW_26363
Length=144

 Score = 35.4 bits (80),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 37/83 (45%), Gaps = 3/83 (4%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSG---ITPNNVRKRFDDLMSAFKQDS  124
            L REV    P+ A +    + WT VA  +  I   G   +T  +   RF  L+   +  +
Sbjct  23   LAREVNAKLPYRAGYNGVMNAWTAVAAALKIIPDLGMASVTAKSCHSRFKALIELHRCSN  82

Query  125  LSTLRASGSEEEYQERALLLQDI  147
              + RAS   EE  E A +L D+
Sbjct  83   RESARASDVSEEITELACVLGDL  105

>H257_15530
Length=237

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 20/127 (16%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA------RIHGSGITPNNVRKRFDDLMS  118
            D+ LLR++   +PF A HG+  + W  VA  +A      R H  G      + RF  L+ 
Sbjct  15   DLMLLRQISDDKPFLARHGRIMEAWESVARALAAQVDFDRPHFDG---KKAQSRFAILLR  71

Query  119  AFKQDSLSTLRA--SGSEEEYQERALLLQDIHDF-----MTVSNHRKREVKEESVVP---  168
              + ++ + +RA  + + E+  E+  LL+DI        +  S ++  E KE + VP   
Sbjct  72   DHRDNNNAPMRAVSACTGEDSAEKMDLLEDISRLERSSTLAASGNQVDEAKEANDVPRST  131

Query  169  -DERPDS  174
             D+R D+
Sbjct  132  TDDRDDA  138

>PHYSO_448112
Length=115

 Score = 34.7 bits (78),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 42/108 (39%), Gaps = 0/108 (0%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMS  118
            RF   SD  LL EV+   PFAA     T  W  VA  +        +    R R   L+ 
Sbjct  3    RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFSFRACRDRTSLLLR  62

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVKEESV  166
             +         ASG+ E + E   +L+ +      +   ++E K +S 
Sbjct  63   KYAVRKARNEAASGTSEVHTENDDILEQLQQLKNAAVAEQQEKKTKST  110

>PHYSO_340790
Length=270

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 40/104 (38%), Gaps = 0/104 (0%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMS  118
            RF   SD  LL EV+   PFAA     T  W  VA  +        +    R R   L+ 
Sbjct  65   RFNATSDKALLAEVLATPPFAADRKTVTGVWKGVANRLNATLSEAFSFRECRDRTSLLLR  124

Query  119  AFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHRKREVK  162
             +         ASG+ E + E   +L+ +      +  +K + K
Sbjct  125  KYAVRKARNEAASGTCELHTESDDILEQLQQLKNAAEQQKNKAK  168

>PYAP_23972
Length=598

 Score = 36.6 bits (83),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 0/54 (0%)

Query  68   LLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRKRFDDLMSAFK  121
            +LR++  I PF A HGQ    W +VA  +    GS  T    R R   L+  ++
Sbjct  1    MLRQIKRIDPFNAAHGQKGAAWDQVADCLNSAMGSRTTGIVCRARMTQLLDQYE  54

>H257_14759
Length=198

 Score = 35.4 bits (80),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 28/86 (33%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query  65   DIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPNNVRK---RFDDLMSAFK  121
            DI LLR+V   +PF A  G+    W  VA  +A   G      + +K   RF  +M    
Sbjct  15   DIMLLRQVNAERPFEAKKGEFMKVWGLVAKALADHEGFARPQFDAKKAQNRFSAVMDNHV  74

Query  122  QDSLSTLRASGSEEEYQERALLLQDI  147
              +  +  ASG  E Y ER  LL ++
Sbjct  75   HYNRESAMASGVAETYDERIALLDEL  100

>PYVX_17808
Length=230

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 41/106 (39%), Gaps = 11/106 (10%)

Query  59   RFRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVARIHGSGITPN-------NVRK  111
            +F    D+ LL  +    PF A HG     W      +A I G  ++ N         R 
Sbjct  30   KFNGGMDVLLLEALRSHNPFTAKHGTRLQMWQS----IAEIVGEELSKNPEAYSWHTCRD  85

Query  112  RFDDLMSAFKQDSLSTLRASGSEEEYQERALLLQDIHDFMTVSNHR  157
            R   LM  +       L   G+ EE   +  +L++I+  +   NH+
Sbjct  86   RVTALMKMYTDGKHDKLFKHGTAEENARKETILREINTALARKNHK  131

>PPTG_20418
Length=219

 Score = 35.4 bits (80),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 43/94 (46%), Gaps = 9/94 (10%)

Query  60   FRCASDIDLLREVVYIQPFAAPHGQTTDRWTKVATHVA------RIHGSGITPNNVRKRF  113
            F    D+  LR++   +PF    G     W  +AT +       R   SG T +    RF
Sbjct  10   FTDDEDLAQLRQIHADRPFLRQRGGIMAAWDALATKLVVDENFPRNKVSGKTASG---RF  66

Query  114  DDLMSAFKQDSLSTLRASGSEEEYQERALLLQDI  147
            D L+ A +  +    +ASG +E+  E+ +LL D+
Sbjct  67   DKLVEAHRAAAEEPAKASGVDEDESEKVILLDDL  100

Lambda      K        H        a         alpha
   0.313    0.128    0.354    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 29065525731

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40