Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_01782147551231235869e-79
SPRG_06335147551231235373e-71
H310_09224147551231243073e-36
H257_06293147551231243047e-36
PYIR_13454147551291042657e-30
PYIW_19970147551301062632e-29
PYU1_G001736147551231062571e-28
PHYKE_8392147551381102521e-27
PHYSO_321155147551361092511e-27
PHYRA_95903147551341102483e-27
PHYCA_11834147551341092466e-27
PHALS_06479147551361092414e-26
CCI44820147551231052387e-26
CCA17542147551201052318e-25
PYAP_17747147551341082283e-24
PPTG_17126147551361092207e-23
PITG_18455147551321092181e-22
HYAP_07103147551641432173e-22
PYVX_18180147551351082084e-21
PHYKE_8932346953466760.19
PYAR_24908106024594110655.4
H310_061661432366141646.5
SPRG_2026513646932942637.4
SPRG_222236519174880639.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_01782

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_01782                                                            230        9e-79
SPRG_06335                                                            211        3e-71
H310_09224                                                            122        3e-36
H257_06293                                                            121        7e-36
PYIR_13454                                                            106        7e-30
PYIW_19970                                                            105        2e-29
PYU1_G001736                                                          103        1e-28
PHYKE_8392                                                            101        1e-27
PHYSO_321155                                                          101        1e-27
PHYRA_95903                                                           100        3e-27
PHYCA_11834                                                           99.4       6e-27
PHALS_06479                                                           97.4       4e-26
CCI44820                                                              96.3       7e-26
CCA17542                                                              93.6       8e-25
PYAP_17747                                                            92.4       3e-24
PPTG_17126                                                            89.4       7e-23
PITG_18455                                                            88.6       1e-22
HYAP_07103                                                            88.2       3e-22
PYVX_18180                                                            84.7       4e-21
PHYKE_8932                                                            33.9       0.19 
PYAR_24908                                                            29.6       5.4  
H310_06166                                                            29.3       6.5  
SPRG_20265                                                            28.9       7.4  
SPRG_22223                                                            28.9       9.8  

>SDRG_01782
Length=123

 Score = 230 bits (586),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MDATIRaaykkllklakSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60
            MDATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY
Sbjct  1    MDATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFM  120
            LKIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFM
Sbjct  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>SPRG_06335
Length=123

 Score = 211 bits (537),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 116/123 (94%), Gaps = 0/123 (0%)

Query  1    MDATIRaaykkllklakSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60
            MD TIRAAYKKLLKLAKSVPQEQRAQTLEKVR EFRAH GAATPEELDQLLRKAQSKISY
Sbjct  1    MDTTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISY  60

Query  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFM  120
            LKIVTPKKS S  QG+HFVYKNGQRIDGRELSADSATIKT DYNAMMTKHVQLVRRQHFM
Sbjct  61   LKIVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>H310_09224
Length=123

 Score = 122 bits (307),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 97/124 (78%), Gaps = 2/124 (2%)

Query  1    MDATIRaaykkllklakSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P EQ+   L+KVRHEFR+H    + ++LD+++ KAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISY  60

Query  61   LKIVTPKKSSSSTQGSHFVYKNGQRID-GRELSADSATIKTHDYNAMMTKHVQLVRRQHF  119
            LKIVTPK+ +  T    ++YK+G+R+D G    + +ATIKT D+NAMM +HV+LVRRQHF
Sbjct  61   LKIVTPKR-APQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>H257_06293
Length=123

 Score = 121 bits (304),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 2/124 (2%)

Query  1    MDATIRaaykkllklakSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISY  60
            M+ ++R AYKKL+KLA+S+P +Q+   L+K+RH+FR+    +T EELD+L+ KAQSKISY
Sbjct  1    MEKSVRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISY  60

Query  61   LKIVTPKKSSSSTQGSHFVYKNGQRIDGREL-SADSATIKTHDYNAMMTKHVQLVRRQHF  119
            LKIVTPK++  S     F+YK+G+R+D + L    + TIKT D NAMM +HV+L+RRQHF
Sbjct  61   LKIVTPKRTPQSGP-QRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHF  119

Query  120  MDRK  123
            MDRK
Sbjct  120  MDRK  123

>PYIR_13454
Length=129

 Score = 106 bits (265),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 1/104 (1%)

Query  20   PQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSHFV  79
            P+ +R  TL ++R EFR  +  + P+EL+ LL +AQS I YLKIVTP+KSS +    +++
Sbjct  27   PEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVTPRKSSDAGV-KNYI  85

Query  80   YKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            YKNGQR++   +  D A     DYNA M +H +L+RRQHFMDRK
Sbjct  86   YKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129

>PYIW_19970
Length=130

 Score = 105 bits (263),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 1/106 (1%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            ++P+ +R  T +++R EFR+ +  + P+EL+ LL +AQS ISYLKIVTP+KSS +    +
Sbjct  26   TLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVTPRKSSDAGV-KN  84

Query  78   FVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            ++YKNGQR++   +  D A  +  DYN  M +H +L+RRQHFMDRK
Sbjct  85   YIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PYU1_G001736
Length=123

 Score = 103 bits (257),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (69%), Gaps = 1/106 (1%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            ++P ++R  T+E++R EFR H G   P+E+  LL +AQS I YLKIVTP+ ++S     +
Sbjct  19   TLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTPR-ATSDAGVKN  77

Query  78   FVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            +VY  G+R++    + D A  KT DYNA M +HVQL+RRQHFMDRK
Sbjct  78   YVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123

>PHYKE_8392
Length=138

 Score = 101 bits (252),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 4/110 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQG-S  76
            ++P+ +R Q+L ++R EFR H   + P+E+ +LL+ AQS +SYLKIVTP+  + S  G  
Sbjct  21   ALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKIVTPRDETESNSGVQ  80

Query  77   HFVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
             ++Y+NGQR++  EL     ++A  KT D  A + +H QL+RRQHFMDRK
Sbjct  81   RYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMDRK  130

>PHYSO_321155
Length=136

 Score = 101 bits (251),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 75/109 (69%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P+ +R Q+L+++R EFR+H     PE +  L+++AQS +SYLKIVTP +  S+T    
Sbjct  21   SLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIVTP-RGESNTGVQR  79

Query  78   FVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            F+Y+NGQR++  E  A   ++A  KT D  A + +H QL+RRQ+FMDRK
Sbjct  80   FIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRK  128

>PHYRA_95903
Length=134

 Score = 100 bits (248),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 77/110 (70%), Gaps = 6/110 (5%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQG-S  76
            S+P+ +R Q+L+++R EFR+HE    P+E+  L+++AQS + YLKIVTP+  + S +G  
Sbjct  19   SLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVTPR--AESNKGIQ  76

Query  77   HFVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
             ++Y+NGQR++  E+ A   ++A  KT D    + +H QL+RRQHFMDRK
Sbjct  77   RYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRK  126

>PHYCA_11834
Length=134

 Score = 99.4 bits (246),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 77/109 (71%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P+ +R  +++++R EFR+HE    P+E+ +LL++AQS + YLKIVTP ++ S+T    
Sbjct  19   SLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVTP-RAESNTGVQR  77

Query  78   FVYKNGQRIDGRELSA---DSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            F+Y++G+R++  EL     ++A  KT D  A + +H QL+RRQ+FMDRK
Sbjct  78   FIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRK  126

>PHALS_06479
Length=136

 Score = 97.4 bits (241),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            ++PQ +R  +++++R EFR HE    P+E+ + +++AQS +SYLKI+TP ++ S+T    
Sbjct  21   NLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIITP-RTESNTGVQR  79

Query  78   FVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            F+Y+NGQR++  +      ++A  KT D  A   +H QL+RRQ+FMDRK
Sbjct  80   FIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRK  128

>CCI44820
Length=123

 Score = 96.3 bits (238),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 1/105 (1%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P E++A TL  +R EFR H     P +L QLL +AQS I YLKIVTP K S S    H
Sbjct  20   SLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVTPHKRSDSGV-KH  78

Query  78   FVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDR  122
            FVYK+G+RI+    + + A  K  D    + +H QL+RRQ+FMDR
Sbjct  79   FVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>CCA17542
Length=120

 Score = 93.6 bits (231),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 1/105 (1%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P E++A TL  +R EFR H   + P +L QLL +AQS I YLKIVTP K S S     
Sbjct  17   SLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVTPHKRSDSGV-KR  75

Query  78   FVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDR  122
            F++K+G+RI+    +++ A  K  D    + +H QL+RRQHFMDR
Sbjct  76   FMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PYAP_17747
Length=134

 Score = 92.4 bits (228),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 74/108 (69%), Gaps = 4/108 (4%)

Query  18   SVPQE-QRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGS  76
            S+P E +R  T++++R EFR+ + A  P+E+  L+++AQ+KI YLKIVTP+ ++ +   S
Sbjct  19   SLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIVTPRSTADAGVKS  78

Query  77   HFVYKNGQRIDGRELSA--DSATIKTHDYNAMMTKHVQLVRRQHFMDR  122
             FVY NG+R+D  ++    + A  KT D+   M +H QL+RRQHFMDR
Sbjct  79   -FVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMDR  125

>PPTG_17126
Length=136

 Score = 89.4 bits (220),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 72/109 (66%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P+ +R  +++++R +FR H     P+E+  L+++AQS +SYLKIVTP ++ S+     
Sbjct  21   SLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIVTP-RAESNMGVQR  79

Query  78   FVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            ++Y+NGQR++  E      ++A  KT D    + +H QL+RRQ+F+DRK
Sbjct  80   YIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRK  128

>PITG_18455
Length=132

 Score = 88.6 bits (218),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 73/109 (67%), Gaps = 4/109 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P+ +R  +++++R +FR+H     P+E+  L+++AQS +SYLKIVTP ++ S+T    
Sbjct  17   SLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIVTP-RAESNTGVQR  75

Query  78   FVYKNGQRIDGREL---SADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123
            ++Y+NGQR++  E      ++A  K  D    + +H QL++RQ+FM+RK
Sbjct  76   YIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRK  124

>HYAP_07103
Length=164

 Score = 88.2 bits (217),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 73/143 (51%), Gaps = 37/143 (26%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGS-  76
            S+P+ +R ++L+++R EFR H     P+E+  LL++AQS I +LKIVTP+  S     S 
Sbjct  14   SLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVTPRAESGGFMASL  73

Query  77   ---------------------------------HFVYKNGQRIDGREL---SADSATIKT  100
                                              FVY++G+RID  EL     ++A  KT
Sbjct  74   AFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAELKKKGEENARYKT  133

Query  101  HDYNAMMTKHVQLVRRQHFMDRK  123
             D  A M +H QL+RRQHFMDRK
Sbjct  134  QDIEAGMKRHHQLLRRQHFMDRK  156

>PYVX_18180
Length=135

 Score = 84.7 bits (208),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 4/108 (4%)

Query  18   SVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSH  77
            S+P+ +RA T+ ++R EFR+H       E+ +LL++AQS++ YLKIVTP+  S+S     
Sbjct  20   SLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIVTPRGPSASGV-KR  78

Query  78   FVYKNGQRIDGRELSADSAT---IKTHDYNAMMTKHVQLVRRQHFMDR  122
            ++Y+NGQR+D     A        KT D    + +H QL+RRQHFMDR
Sbjct  79   YIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDR  126

>PHYKE_8932
Length=534

 Score = 33.9 bits (76),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 0/66 (0%)

Query  23   QRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSHFVYKN  82
            Q  + LE+ R EF A + +      D L      + +Y    TP +  SS+   H  Y N
Sbjct  321  QELKQLEEQRAEFSARQASIAASASDPLYNSGYQENAYRPPTTPTRGRSSSSNDHHGYSN  380

Query  83   GQRIDG  88
            G R  G
Sbjct  381  GHRSYG  386

>PYAR_24908
Length=594

 Score = 29.6 bits (65),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (42%), Gaps = 15/110 (14%)

Query  23   QRAQTLEKVRHEFRA----HEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSHF  78
            ++ QTL  +R  F A    + G    EEL Q+LR    ++SY +     K     +G+  
Sbjct  412  EQGQTLSDLRRHFHASDPTNSGCIELEELRQILRYFGCQVSYFRFNDVAKLLFRLKGTCV  471

Query  79   VYKNGQRI--------DGRELSADSATIKT---HDYNAMMTKHVQLVRRQ  117
             Y   +R+          RE  A  A  +    H    +MT+  +L RR+
Sbjct  472  EYAQVERLLELAAMEDHARESMAPGAAPQNGAPHYMRTVMTEEAELHRRE  521

>H310_06166
Length=661

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  22  EQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLK  62
           EQ A TLEK+   F AH+GAA  E   +L+  A+ K S+++
Sbjct  37  EQHAATLEKIE-SFLAHDGAALQE---KLIEYAKDKNSFIE  73

>SPRG_20265
Length=329

 Score = 28.9 bits (63),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 3/42 (7%)

Query  18   SVPQEQRAQTLEKVRHEFR---AHEGAATPEELDQLLRKAQS  56
            SVP++++AQ L +V  E R       AA P  L QLLR   +
Sbjct  262  SVPRDEKAQLLRQVAFEHRRPTIRNEAAWPPSLLQLLRACWA  303

>SPRG_22223
Length=1748

 Score = 28.9 bits (63),  Expect = 9.8, Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 35/80 (44%), Gaps = 11/80 (14%)

Query  27   TLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVTPKKSSSSTQGSHFVYKNGQRI  86
            TL  ++ +FRA   A     LD+L  +     +YL  +T + S ++   +H         
Sbjct  123  TLASLQDQFRADVAANVAHHLDELQVRCLRNAAYLFYITDEPSEAAEMVAH---------  173

Query  87   DGRELSADSATIKTHDYNAM  106
                + AD A +K H  +AM
Sbjct  174  --TAMVADFALLKEHLSSAM  191

Lambda      K        H        a         alpha
   0.315    0.126    0.341    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40