Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_017811475633533515520.0
SPRG_063361475633533515060.0
H257_06294147563583636986e-89
H310_09223147563333306931e-88
PITG_18456147563513364714e-55
PPTG_17127147563513354551e-52
PYVX_18171147562942144501e-52
PHYSO_471523147563483344471e-51
PHYRA_81100147563493354462e-51
PYU1_G001735147563423314411e-50
PHYCA_556162147563513374367e-50
PYAP_17762147563483284298e-49
PHALS_06478147563453364243e-48
PYIR_13451147563593434184e-47
PYIW_19971147563483363773e-41
CCA18899147563433423764e-41
PHYKE_8393147563263293431e-36
PYAR_13570147563222123248e-34
CCI45123147563013062861e-28
PYAR_154631526710911611456e-09
PPTG_188981612815591041441e-08
PITG_205621612815591041431e-08
PHYRA_849161612815411091376e-08
PHYRA_825431526711991091376e-08
PHYSO_5445981526711631091351e-07
H310_002311612814952061361e-07
PYAP_169971612810181021351e-07
PYAR_23286161286071111341e-07
H257_03361123428699621351e-07
PYIW_1738116128952991351e-07
PPTG_193711526711951091341e-07
PYU1_G006347161281095991341e-07
SPRG_088341265688251171342e-07
PYAP_186361526710091091332e-07
CCA180231526711381321322e-07
PYAP_2264624178151271313e-07
PHYSO_3617471612815231111313e-07
PYIR_21589161281568991313e-07
PITG_192131526712011091314e-07
PHYRA_792812417809591304e-07
H257_06722161281482671305e-07
SDRG_021541265688221161305e-07
PHYCA_5061372417810531305e-07
PYVX_20438161281346991305e-07
CCA2453118533741051277e-07
PHYKE_56782417809531287e-07
PYU1_G00438624178371251287e-07
PHYKE_19901612814991111288e-07
CCI462351526711551131288e-07
CCI4714518533901881278e-07
PYIW_1848024177551261288e-07
PYAR_1988324178331181279e-07
PYIW_16987152678211091271e-06
PHYSO_3441122417813531271e-06
PPTG_055192417810531271e-06
PYU1_G008848152677651091271e-06
HYAP_080262417798531271e-06
CCI44752161281526981271e-06
PHYKE_6662152677651091261e-06
SDRG_127621612813921171261e-06
PITG_027622417810531261e-06
SPRG_060581612812581341261e-06
PYIR_183821526711541091261e-06
SPRG_003641222722551061222e-06
H310_0770124178111121252e-06
SPRG_0605912510913121191252e-06
SDRG_035311222722551061212e-06
H257_0751424178101121242e-06
HYAP_044571526712031051243e-06
SDRG_1276312510913171321243e-06
HYAP_086451612815141091243e-06
SDRG_1448618533081141213e-06
CCA1909718566881041233e-06
PYU1_G00673286329541511233e-06
H310_04843152679681091233e-06
SPRG_00890152678831541233e-06
SDRG_14487123428964551224e-06
SDRG_01407152678151541224e-06
SPRG_02752123428831551224e-06
CCA2171524177821511224e-06
CCA218601550787821511224e-06
SPRG_0275318533091141205e-06
PHALS_040981526711831051225e-06
CCA18875161281514981225e-06
PHALS_036452417830531216e-06
SPRG_17022131892107531117e-06
CCI10489158709777591207e-06
PYIR_22246125545591231198e-06
H257_03093152679751311191e-05
PYVX_183382417746551181e-05
PYIR_131202417814531181e-05
PITG_0210918535221111162e-05
PYIW_21108951125931641172e-05
SPRG_11900166051311162e-05
PYAP_16161986618891221172e-05
CCI41225144599811171162e-05
SPRG_0834624177971121162e-05
SDRG_0515024177871121153e-05
PYIR_233721583514151181153e-05
SDRG_0628816641571144e-05
CCA16487144599751171144e-05
PYU1_G0128701853352981124e-05
H310_0023012510912481131145e-05
PYAR_19914144597881231135e-05
PYVX_13574144599501051135e-05
H310_13627143136781161135e-05
PYAP_1369518533481031125e-05
PYAR_2550015835473991126e-05
PHALS_0656818533881111126e-05
PYIW_13172144599391051136e-05
PYIR_15309144599371051136e-05
PYU1_G001063144597831051126e-05
PYVX_133121526710161151127e-05
PYAR_1461586325171341117e-05
PITG_113039318293351107e-05
SDRG_014081225189161151127e-05
CCA171021529268841251127e-05
PHYKE_2479144591711021068e-05
PPTG_13401144599271051128e-05
PHYCA_5031121529262141051088e-05
PYAR_18690951124551151128e-05
H257_064692194476401008e-05
HYAP_0734886329731181119e-05
SPRG_008891225189941151119e-05
PYAP_2219586329011311111e-04
PYIR_135551853355531091e-04
PYIR_17453951126191411101e-04
PHALS_06533144599301051092e-04
PITG_18067144599241051092e-04
PHYRA_77834144599361051092e-04
PYIW_1781818501188481082e-04
PYVX_14527603012691181082e-04
PPTG_1463018533981031072e-04
CCI424571529269061301082e-04
H310_0192118533411041062e-04
PYAP_17290144598351231073e-04
PHYRA_82040863210541391073e-04
CCI4099124178011711064e-04
H257_0672112510912381061064e-04
PHYKE_914612554557921055e-04
PYVX_16714863210301071055e-04
PYIW_184911583516841011055e-04
PHYSO_47861118535221381046e-04
PYU1_G00950895765328321036e-04
PYIR_2301286329651071047e-04
H310_054571222722691051027e-04
PHYSO_35019712554557921038e-04
PYU1_G009249951125801641039e-04
PHYRA_793481583512401211030.001
H310_0666686328871051030.001
PYAR_16228986618621221030.001
PYIW_208911853291531010.001
PITG_10462863210281071030.001
CCI45127160987202190990.001
PYU1_G01285918501183491020.001
SDRG_14286143136701661020.001
PHYCA_56429686329571071020.001
PHYCA_50480118533981141010.001
H310_002091583511981131020.001
PHYSO_55849886329671071020.001
PYVX_130841347912671761020.001
H257_033631853316981000.001
PHYKE_104486325211071010.001
H257_0818216859551010.001
PPTG_0878586329441071010.001
PYU1_G012274158358731181010.001
PYIR_218315669515442960.001
PPTG_068231583513211211010.002
PHALS_0972986329491071010.002
PHYRA_734301853395111990.002
SPRG_0912814313620119990.002
PITG_20103158351301791000.002
H310_0880316916521000.002
PHYCA_52966011517345128980.002
PHALS_125031151734053980.003
PYIR_1511813479122232990.003
PYIW_1891113479119632990.003
H310_06667138868896130980.003
PHYSO_3436291445997737980.003
H257_01309138868895108980.004
SDRG_021352194430633960.005
PYIW_215268632963111970.005
PYIR_1678061471352110970.005
HYAP_1368818501036132970.005
CCI434561109212654910.005
H257_16349122272262100950.005
PYU1_G01126161471328120970.005
PYIW_1987356695185112930.005
SPRG_018608632674125960.005
PYVX_1326161471382110960.006
HYAP_117121255455892960.006
PHYKE_491118534637840.006
H257_013088632897105960.006
PHALS_0663695112386120960.006
H257_098231431365452960.006
PYU1_G0032291681031960.006
SDRG_082368632864113960.007
CCA2551013479113933950.008
HYAP_1375711517262141930.008
HYAP_117131764541792940.008
HYAP_13690185337739940.009
PYAP_24144158351022115950.009
PITG_141971151734953930.010
PYVX_22589158351375114950.010
CCA191181109212554880.010
H310_048421395771081114940.011
PYVX_190301255455692940.011
PHYCA_5093851255455792940.011
HYAP_09511158351295102940.011
H257_06698158351199109940.013
PHYSO_315255158351301126940.013
HYAP_0223081951195186930.013
SPRG_0606115835115998930.013
SDRG_0008012454429825920.014
PHYRA_8307195112300117930.014
PPTG_1171495112444159930.015
SDRG_088001445988147930.015
H310_0644928851361122930.017
H310_063781445983734920.017
PHYSO_52993195112211121930.017
PHYSO_48987281951240101920.018
H257_135671445983634920.018
PYAP_1629795112466106930.018
PYVX_216545153855115920.019
SPRG_054491445972347920.020
PHYKE_3811517227129890.021
H310_09363140947195453920.021
PHYCA_50471216208107890.022
PYU1_G00917811517336128900.023
PHYSO_3203611151734453900.023
PHALS_11367158351329107920.023
HYAP_0930413479114432910.023
SDRG_1277615835118498910.024
CCI4379313479111733910.025
PPTG_194711151734853900.025
PYVX_14593185096440910.026
SDRG_05128126310512125900.028
CCA268906147153055910.030
PYAP_1975361471340105900.031
PHYRA_836961151733753890.032
CCI458578632905141900.032
H310_02133640397077900.033
SPRG_1631213132226172880.033
PHYKE_55881675137900.036
PHYRA_7693181951212148900.039
SPRG_08326126310501125890.040
PITG_1157895112131101900.042
PHYSO_4845411691134890.047
PYIW_2525011517245127870.047
CCA1903395111883108890.047
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_01781

Length=335
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_01781                                                            602        0.0  
SPRG_06336                                                            584        0.0  
H257_06294                                                            273        6e-89
H310_09223                                                            271        1e-88
PITG_18456                                                            186        4e-55
PPTG_17127                                                            179        1e-52
PYVX_18171                                                            177        1e-52
PHYSO_471523                                                          176        1e-51
PHYRA_81100                                                           176        2e-51
PYU1_G001735                                                          174        1e-50
PHYCA_556162                                                          172        7e-50
PYAP_17762                                                            169        8e-49
PHALS_06478                                                           167        3e-48
PYIR_13451                                                            165        4e-47
PYIW_19971                                                            149        3e-41
CCA18899                                                              149        4e-41
PHYKE_8393                                                            136        1e-36
PYAR_13570                                                            129        8e-34
CCI45123                                                              114        1e-28
PYAR_15463                                                            60.5       6e-09
PPTG_18898                                                            60.1       1e-08
PITG_20562                                                            59.7       1e-08
PHYRA_84916                                                           57.4       6e-08
PHYRA_82543                                                           57.4       6e-08
PHYSO_544598                                                          56.6       1e-07
H310_00231                                                            57.0       1e-07
PYAP_16997                                                            56.6       1e-07
PYAR_23286                                                            56.2       1e-07
H257_03361                                                            56.6       1e-07
PYIW_17381                                                            56.6       1e-07
PPTG_19371                                                            56.2       1e-07
PYU1_G006347                                                          56.2       1e-07
SPRG_08834                                                            56.2       2e-07
PYAP_18636                                                            55.8       2e-07
CCA18023                                                              55.5       2e-07
PYAP_22646                                                            55.1       3e-07
PHYSO_361747                                                          55.1       3e-07
PYIR_21589                                                            55.1       3e-07
PITG_19213                                                            55.1       4e-07
PHYRA_79281                                                           54.7       4e-07
H257_06722                                                            54.7       5e-07
SDRG_02154                                                            54.7       5e-07
PHYCA_506137                                                          54.7       5e-07
PYVX_20438                                                            54.7       5e-07
CCA24531                                                              53.5       7e-07
PHYKE_5678                                                            53.9       7e-07
PYU1_G004386                                                          53.9       7e-07
PHYKE_1990                                                            53.9       8e-07
CCI46235                                                              53.9       8e-07
CCI47145                                                              53.5       8e-07
PYIW_18480                                                            53.9       8e-07
PYAR_19883                                                            53.5       9e-07
PYIW_16987                                                            53.5       1e-06
PHYSO_344112                                                          53.5       1e-06
PPTG_05519                                                            53.5       1e-06
PYU1_G008848                                                          53.5       1e-06
HYAP_08026                                                            53.5       1e-06
CCI44752                                                              53.5       1e-06
PHYKE_6662                                                            53.1       1e-06
SDRG_12762                                                            53.1       1e-06
PITG_02762                                                            53.1       1e-06
SPRG_06058                                                            53.1       1e-06
PYIR_18382                                                            53.1       1e-06
SPRG_00364                                                            51.6       2e-06
H310_07701                                                            52.8       2e-06
SPRG_06059                                                            52.8       2e-06
SDRG_03531                                                            51.2       2e-06
H257_07514                                                            52.4       2e-06
HYAP_04457                                                            52.4       3e-06
SDRG_12763                                                            52.4       3e-06
HYAP_08645                                                            52.4       3e-06
SDRG_14486                                                            51.2       3e-06
CCA19097                                                              52.0       3e-06
PYU1_G006732                                                          52.0       3e-06
H310_04843                                                            52.0       3e-06
SPRG_00890                                                            52.0       3e-06
SDRG_14487                                                            51.6       4e-06
SDRG_01407                                                            51.6       4e-06
SPRG_02752                                                            51.6       4e-06
CCA21715                                                              51.6       4e-06
CCA21860                                                              51.6       4e-06
SPRG_02753                                                            50.8       5e-06
PHALS_04098                                                           51.6       5e-06
CCA18875                                                              51.6       5e-06
PHALS_03645                                                           51.2       6e-06
SPRG_17022                                                            47.4       7e-06
CCI10489                                                              50.8       7e-06
PYIR_22246                                                            50.4       8e-06
H257_03093                                                            50.4       1e-05
PYVX_18338                                                            50.1       1e-05
PYIR_13120                                                            50.1       1e-05
PITG_02109                                                            49.3       2e-05
PYIW_21108                                                            49.7       2e-05
SPRG_11900                                                            49.3       2e-05
PYAP_16161                                                            49.7       2e-05
CCI41225                                                              49.3       2e-05
SPRG_08346                                                            49.3       2e-05
SDRG_05150                                                            48.9       3e-05
PYIR_23372                                                            48.9       3e-05
SDRG_06288                                                            48.5       4e-05
CCA16487                                                              48.5       4e-05
PYU1_G012870                                                          47.8       4e-05
H310_00230                                                            48.5       5e-05
PYAR_19914                                                            48.1       5e-05
PYVX_13574                                                            48.1       5e-05
H310_13627                                                            48.1       5e-05
PYAP_13695                                                            47.8       5e-05
PYAR_25500                                                            47.8       6e-05
PHALS_06568                                                           47.8       6e-05
PYIW_13172                                                            48.1       6e-05
PYIR_15309                                                            48.1       6e-05
PYU1_G001063                                                          47.8       6e-05
PYVX_13312                                                            47.8       7e-05
PYAR_14615                                                            47.4       7e-05
PITG_11303                                                            47.0       7e-05
SDRG_01408                                                            47.8       7e-05
CCA17102                                                              47.8       7e-05
PHYKE_2479                                                            45.4       8e-05
PPTG_13401                                                            47.8       8e-05
PHYCA_503112                                                          46.2       8e-05
PYAR_18690                                                            47.8       8e-05
H257_06469                                                            43.1       8e-05
HYAP_07348                                                            47.4       9e-05
SPRG_00889                                                            47.4       9e-05
PYAP_22195                                                            47.4       1e-04
PYIR_13555                                                            46.6       1e-04
PYIR_17453                                                            47.0       1e-04
PHALS_06533                                                           46.6       2e-04
PITG_18067                                                            46.6       2e-04
PHYRA_77834                                                           46.6       2e-04
PYIW_17818                                                            46.2       2e-04
PYVX_14527                                                            46.2       2e-04
PPTG_14630                                                            45.8       2e-04
CCI42457                                                              46.2       2e-04
H310_01921                                                            45.4       2e-04
PYAP_17290                                                            45.8       3e-04
PHYRA_82040                                                           45.8       3e-04
CCI40991                                                              45.4       4e-04
H257_06721                                                            45.4       4e-04
PHYKE_9146                                                            45.1       5e-04
PYVX_16714                                                            45.1       5e-04
PYIW_18491                                                            45.1       5e-04
PHYSO_478611                                                          44.7       6e-04
PYU1_G009508                                                          44.3       6e-04
PYIR_23012                                                            44.7       7e-04
H310_05457                                                            43.9       7e-04
PHYSO_350197                                                          44.3       8e-04
PYU1_G009249                                                          44.3       9e-04
PHYRA_79348                                                           44.3       0.001
H310_06666                                                            44.3       0.001
PYAR_16228                                                            44.3       0.001
PYIW_20891                                                            43.5       0.001
PITG_10462                                                            44.3       0.001
CCI45127                                                              42.7       0.001
PYU1_G012859                                                          43.9       0.001
SDRG_14286                                                            43.9       0.001
PHYCA_564296                                                          43.9       0.001
PHYCA_504801                                                          43.5       0.001
H310_00209                                                            43.9       0.001
PHYSO_558498                                                          43.9       0.001
PYVX_13084                                                            43.9       0.001
H257_03363                                                            43.1       0.001
PHYKE_1044                                                            43.5       0.001
H257_08182                                                            43.5       0.001
PPTG_08785                                                            43.5       0.001
PYU1_G012274                                                          43.5       0.001
PYIR_21831                                                            41.6       0.001
PPTG_06823                                                            43.5       0.002
PHALS_09729                                                           43.5       0.002
PHYRA_73430                                                           42.7       0.002
SPRG_09128                                                            42.7       0.002
PITG_20103                                                            43.1       0.002
H310_08803                                                            43.1       0.002
PHYCA_529660                                                          42.4       0.002
PHALS_12503                                                           42.4       0.003
PYIR_15118                                                            42.7       0.003
PYIW_18911                                                            42.7       0.003
H310_06667                                                            42.4       0.003
PHYSO_343629                                                          42.4       0.003
H257_01309                                                            42.4       0.004
SDRG_02135                                                            41.6       0.005
PYIW_21526                                                            42.0       0.005
PYIR_16780                                                            42.0       0.005
HYAP_13688                                                            42.0       0.005
CCI43456                                                              39.7       0.005
H257_16349                                                            41.2       0.005
PYU1_G011261                                                          42.0       0.005
PYIW_19873                                                            40.4       0.005
SPRG_01860                                                            41.6       0.005
PYVX_13261                                                            41.6       0.006
HYAP_11712                                                            41.6       0.006
PHYKE_4911                                                            37.0       0.006
H257_01308                                                            41.6       0.006
PHALS_06636                                                           41.6       0.006
H257_09823                                                            41.6       0.006
PYU1_G003229                                                          41.6       0.006
SDRG_08236                                                            41.6       0.007
CCA25510                                                              41.2       0.008
HYAP_13757                                                            40.4       0.008
HYAP_11713                                                            40.8       0.008
HYAP_13690                                                            40.8       0.009
PYAP_24144                                                            41.2       0.009
PITG_14197                                                            40.4       0.010
PYVX_22589                                                            41.2       0.010
CCA19118                                                              38.5       0.010
H310_04842                                                            40.8       0.011
PYVX_19030                                                            40.8       0.011
PHYCA_509385                                                          40.8       0.011
HYAP_09511                                                            40.8       0.011
H257_06698                                                            40.8       0.013
PHYSO_315255                                                          40.8       0.013
HYAP_02230                                                            40.4       0.013
SPRG_06061                                                            40.4       0.013
SDRG_00080                                                            40.0       0.014
PHYRA_83071                                                           40.4       0.014
PPTG_11714                                                            40.4       0.015
SDRG_08800                                                            40.4       0.015
H310_06449                                                            40.4       0.017
H310_06378                                                            40.0       0.017
PHYSO_529931                                                          40.4       0.017
PHYSO_489872                                                          40.0       0.018
H257_13567                                                            40.0       0.018
PYAP_16297                                                            40.4       0.018
PYVX_21654                                                            40.0       0.019
SPRG_05449                                                            40.0       0.020
PHYKE_38                                                              38.9       0.021
H310_09363                                                            40.0       0.021
PHYCA_504712                                                          38.9       0.022
PYU1_G009178                                                          39.3       0.023
PHYSO_320361                                                          39.3       0.023
PHALS_11367                                                           40.0       0.023
HYAP_09304                                                            39.7       0.023
SDRG_12776                                                            39.7       0.024
CCI43793                                                              39.7       0.025
PPTG_19471                                                            39.3       0.025
PYVX_14593                                                            39.7       0.026
SDRG_05128                                                            39.3       0.028
CCA26890                                                              39.7       0.030
PYAP_19753                                                            39.3       0.031
PHYRA_83696                                                           38.9       0.032
CCI45857                                                              39.3       0.032
H310_02133                                                            39.3       0.033
SPRG_16312                                                            38.5       0.033
PHYKE_5588                                                            39.3       0.036
PHYRA_76931                                                           39.3       0.039
SPRG_08326                                                            38.9       0.040
PITG_11578                                                            39.3       0.042
PHYSO_484541                                                          38.9       0.047
PYIW_25250                                                            38.1       0.047
CCA19033                                                              38.9       0.047
CCA23572                                                              38.9       0.048
PHYRA_78815                                                           38.9       0.049
H257_11158                                                            38.5       0.050
CCI10928                                                              38.9       0.050
PHYRA_73297                                                           36.6       0.051
PYIR_14494                                                            38.5       0.053
CCA27157                                                              38.5       0.060
H310_07683                                                            38.1       0.060
CCI42711                                                              38.5       0.063
PYAR_19122                                                            38.1       0.063
PYAR_13491                                                            38.5       0.065
PYU1_G010818                                                          37.0       0.067
SPRG_02939                                                            38.5       0.067
PYAP_19085                                                            38.1       0.068
H310_14019                                                            38.1       0.069
PYU1_G008119                                                          36.2       0.072
PPTG_04553                                                            38.1       0.072
SPRG_08783                                                            37.7       0.076
SDRG_00756                                                            38.1       0.078
PHYSO_335887                                                          38.1       0.080
PPTG_14626                                                            38.1       0.084
H310_12448                                                            37.7       0.091
SPRG_02502                                                            35.8       0.093
PITG_17893                                                            37.7       0.094
H257_11443                                                            37.7       0.095
SDRG_05608                                                            35.8       0.095
PYIW_14611                                                            37.7       0.095
PHALS_07930                                                           37.7       0.097
H310_12867                                                            37.7       0.10 
PPTG_18989                                                            37.7       0.10 
PYIR_13168                                                            37.7       0.10 
PITG_02106                                                            37.7       0.11 
CCI44571                                                              35.8       0.11 
PYAP_23744                                                            35.4       0.11 
PHYSO_556164                                                          37.4       0.12 
CCI45895                                                              37.7       0.12 
PHALS_03540                                                           37.4       0.12 
PYIW_22477                                                            37.4       0.13 
PHYRA_81944                                                           37.4       0.13 
PPTG_19153                                                            37.4       0.13 
PITG_13665                                                            35.4       0.14 
PPTG_09008                                                            37.4       0.14 
PPTG_16659                                                            37.4       0.14 
PHYRA_73535                                                           37.4       0.15 
H310_13412                                                            37.0       0.15 
PHYRA_85100                                                           35.0       0.15 
PHYRA_85097                                                           35.0       0.15 
PHYRA_81188                                                           37.0       0.15 
PHALS_07062                                                           35.0       0.16 
H257_03521                                                            37.0       0.16 
PHYRA_73432                                                           37.0       0.16 
PYIR_22259                                                            35.4       0.18 
PHALS_06334                                                           37.0       0.18 
PYAP_16658                                                            36.6       0.18 
H257_11802                                                            37.0       0.18 
HYAP_02360                                                            35.0       0.19 
PITG_00020                                                            37.0       0.19 
PHALS_02608                                                           36.6       0.19 
SPRG_08532                                                            37.0       0.19 
PYAP_16734                                                            37.0       0.20 
PITG_09930                                                            37.0       0.20 
H257_03095                                                            37.0       0.20 
PYIR_14542                                                            36.2       0.21 
H257_16221                                                            37.0       0.21 
PHALS_08097                                                           36.6       0.21 
SDRG_10107                                                            37.0       0.21 
SDRG_06342                                                            37.0       0.21 
PHYSO_349983                                                          36.6       0.22 
PYAR_23366                                                            36.6       0.22 
H257_10913                                                            36.6       0.23 
SPRG_05843                                                            36.6       0.26 
CCA15513                                                              36.6       0.27 
PYAR_24323                                                            36.2       0.28 
H257_03931                                                            36.2       0.29 
H257_09028                                                            36.2       0.29 
PHYSO_289146                                                          34.3       0.29 
PHYKE_7347                                                            34.3       0.29 
PHALS_06699                                                           36.2       0.30 
CCI41909                                                              35.8       0.30 
PYVX_22150                                                            35.8       0.30 
H310_02933                                                            36.2       0.31 
PHYCA_510506                                                          34.3       0.32 
PPTG_19631                                                            34.3       0.33 
PHALS_12874                                                           35.8       0.34 
HYAP_06101                                                            36.2       0.34 
PYIW_26522                                                            34.3       0.34 
SDRG_05567                                                            36.2       0.35 
SPRG_06021                                                            36.2       0.35 
PYVX_16256                                                            35.8       0.35 
PYIR_15407                                                            34.3       0.35 
PYAR_15792                                                            33.9       0.36 
PITG_16461                                                            35.8       0.36 
PYAR_18008                                                            34.3       0.38 
PYAP_15706                                                            35.4       0.38 
SDRG_14771                                                            35.8       0.38 
PHYCA_98948                                                           33.9       0.38 
PYIW_21901                                                            35.8       0.39 
SPRG_04912                                                            35.4       0.40 
CCA14529                                                              35.8       0.42 
PHYKE_7856                                                            35.4       0.43 
PYVX_15906                                                            33.9       0.43 
CCI39367                                                              35.8       0.44 
PYAP_23478                                                            35.8       0.46 
H257_07492                                                            35.4       0.47 
PHYRA_82888                                                           35.4       0.47 
HYAP_01795                                                            35.4       0.49 
PHYKE_8531                                                            35.0       0.49 
PYU1_G000724                                                          34.7       0.50 
CCA24267                                                              34.3       0.51 
CCA21572                                                              34.3       0.51 
SPRG_09211                                                            35.4       0.52 
HYAP_10830                                                            35.4       0.53 
PYU1_G007423                                                          35.4       0.53 
PYIW_24869                                                            35.0       0.54 
PYIW_18840                                                            34.3       0.56 
PYU1_G001268                                                          34.7       0.57 
PYAP_18890                                                            33.5       0.58 
PHYRA_73534                                                           35.4       0.60 
PHYSO_485120                                                          33.5       0.60 
PHYCA_71329                                                           32.7       0.61 
CCI11474                                                              35.0       0.61 
PYU1_G002683                                                          35.0       0.62 
PHYCA_568901                                                          35.4       0.62 
PPTG_07800                                                            33.9       0.63 
PYAR_16504                                                            35.4       0.63 
H310_01510                                                            35.0       0.63 
PITG_03458                                                            35.0       0.64 
SPRG_05970                                                            35.0       0.64 
H310_01094                                                            33.1       0.66 
PHYSO_354120                                                          35.0       0.66 
PHYCA_566962                                                          35.0       0.67 
H257_00729                                                            33.1       0.70 
HYAP_02057                                                            35.0       0.71 
PYAP_23307                                                            35.0       0.72 
PYIW_23677                                                            32.7       0.75 
PHYSO_354122                                                          35.0       0.76 
PHYRA_77134                                                           35.0       0.76 
PITG_07286                                                            35.0       0.77 
PHYRA_77130                                                           35.0       0.77 
PPTG_04169                                                            35.0       0.77 
SPRG_14312                                                            35.0       0.78 
PHYRA_94409                                                           35.0       0.80 
CCA25744                                                              34.3       0.81 
H257_02642                                                            34.7       0.83 
SDRG_04871                                                            34.7       0.85 
CCA22329                                                              34.7       0.85 
PHYSO_248481                                                          35.0       0.85 
PPTG_16044                                                            34.7       0.87 
PITG_03318                                                            34.7       0.87 
PPTG_05753                                                            34.7       0.88 
SPRG_08217                                                            34.7       0.89 
H310_13911                                                            34.3       0.90 
SPRG_08607                                                            34.7       0.94 
PYAP_22685                                                            34.7       0.94 
PYIR_24588                                                            34.7       0.99 
PHYKE_159                                                             34.3       1.0  
HYAP_04252                                                            34.3       1.0  
PYAP_15732                                                            34.3       1.0  
PPTG_04165                                                            34.7       1.1  
HYAP_11295                                                            34.3       1.1  
PITG_07289                                                            34.7       1.1  
PYVX_19982                                                            34.3       1.1  
PPTG_09889                                                            33.5       1.2  
PHALS_03704                                                           34.3       1.2  
PYAR_19291                                                            34.3       1.2  
SDRG_10680                                                            34.3       1.2  
H310_07070                                                            34.3       1.2  
PYIR_25066                                                            33.9       1.3  
SDRG_07302                                                            34.3       1.3  
PYIR_17155                                                            33.9       1.3  
H257_13346                                                            34.3       1.3  
SPRG_20275                                                            33.9       1.3  
PITG_16799                                                            34.3       1.3  
H257_05679                                                            33.9       1.4  
PYAP_16005                                                            34.3       1.4  
SDRG_01838                                                            34.3       1.5  
SPRG_06273                                                            34.3       1.5  
CCI47178                                                              33.9       1.5  
PITG_15553                                                            33.9       1.5  
PITG_04836                                                            33.9       1.5  
HYAP_14013                                                            33.9       1.5  
PHYCA_505441                                                          33.9       1.5  
PYAR_16674                                                            33.9       1.6  
PYU1_G012858                                                          33.9       1.6  
PYVX_23349                                                            33.9       1.6  
SDRG_15601                                                            33.5       1.6  
SPRG_13975                                                            33.5       1.6  
PITG_17594                                                            33.9       1.6  
H310_06277                                                            33.9       1.6  
H257_00263                                                            33.9       1.7  
SDRG_07012                                                            33.5       1.7  
PITG_00263                                                            33.9       1.7  
PHALS_05587                                                           33.9       1.7  
PPTG_06991                                                            33.5       1.8  
PYIR_20162                                                            33.9       1.8  
H257_13468                                                            33.9       1.8  
PHALS_09667                                                           33.9       1.9  
PHALS_12153                                                           33.9       1.9  
PHYSO_351681                                                          33.9       1.9  
PPTG_10911                                                            33.9       1.9  
H310_00912                                                            33.9       1.9  
PHYRA_72612                                                           33.9       2.0  
PYAP_17960                                                            33.5       2.0  
PYU1_G004115                                                          32.3       2.0  
PYAR_13275                                                            33.1       2.0  
PYU1_G007013                                                          33.5       2.1  
HYAP_13267                                                            33.5       2.1  
PYIW_21944                                                            33.5       2.1  
H257_10063                                                            33.5       2.1  
PHYSO_355952                                                          33.1       2.1  
PHYRA_80100                                                           33.1       2.1  
PYVX_13435                                                            33.5       2.2  
PHYRA_82811                                                           33.5       2.3  
PPTG_03644                                                            32.7       2.3  
PPTG_16174                                                            33.5       2.3  
PYVX_17890                                                            33.1       2.3  
PHYSO_258828                                                          33.5       2.4  
H310_06059                                                            33.5       2.4  
PHYSO_304784                                                          33.5       2.4  
PITG_21026                                                            33.5       2.4  
PYIR_21473                                                            33.1       2.4  
PHYRA_84567                                                           33.1       2.4  
PHYRA_79015                                                           33.5       2.4  
PYIW_15014                                                            33.1       2.5  
SDRG_05465                                                            33.1       2.5  
PITG_19877                                                            33.1       2.6  
PPTG_03759                                                            33.1       2.6  
SPRG_00683                                                            33.1       2.6  
PHALS_13270                                                           33.1       2.6  
PHYCA_553561                                                          32.7       2.6  
SPRG_11532                                                            33.1       2.6  
PHALS_10225                                                           33.1       2.7  
PHYCA_9844                                                            32.7       2.7  
PYAP_15374                                                            33.1       2.7  
PITG_09298                                                            32.7       2.8  
PYAP_19560                                                            32.7       2.9  
PHYKE_10704                                                           33.1       3.0  
PHALS_00378                                                           33.1       3.0  
PYVX_15936                                                            31.6       3.1  
SDRG_09034                                                            33.1       3.2  
PYAR_21583                                                            32.3       3.2  
PHALS_02897                                                           33.1       3.3  
PYVX_16095                                                            33.1       3.3  
PYAP_18827                                                            33.1       3.3  
CCA19369                                                              32.7       3.4  
PHYCA_538275                                                          32.7       3.4  
PYAP_23464                                                            32.7       3.4  
PHALS_10968                                                           32.7       3.5  
PYIW_18236                                                            33.1       3.5  
PPTG_14751                                                            32.7       3.5  

>SDRG_01781
Length=335

 Score = 602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/335 (100%), Positives = 335/335 (100%), Gaps = 0/335 (0%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  121  NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180
            NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT
Sbjct  121  NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180

Query  181  VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksks  240
            VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKS
Sbjct  181  VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKS  240

Query  241  aRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVER  300
            ARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVER
Sbjct  241  ARSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVER  300

Query  301  TTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335
            TTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL
Sbjct  301  TTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335

>SPRG_06336
Length=335

 Score = 584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/335 (96%), Positives = 325/335 (97%), Gaps = 0/335 (0%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY+DSKTIYKSDKPKEKGS
Sbjct  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGS  60

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK
Sbjct  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120

Query  121  NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180
            NV PQAS DQRA+ALLGHRA SGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT
Sbjct  121  NVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180

Query  181  VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksks  240
            VSEMGHNAEMLDIAEANMDYV TELDRGDNIIKKMTSPFFYYFSSSKSKKKG GSPKSKS
Sbjct  181  VSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKS  240

Query  241  aRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVER  300
            ARSH PQTPMNSPT+KK SGP SK GG TTDAGDDELDQLSKILASLEVHANTISTEVER
Sbjct  241  ARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVER  300

Query  301  TTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335
            TTEQIDRIQKKMVEADER+VEQSAKVHAIQ+KNKL
Sbjct  301  TTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335

>H257_06294
Length=358

 Score = 273 bits (698),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 157/363 (43%), Positives = 213/363 (59%), Gaps = 45/363 (12%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            M+++L+   QTSCEGYVTKRGH+MKSW+RRYMVL+GDTL VSY+DSK IY S K   KGS
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTS-KGHPKGS  59

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            F+L+E EK D SDEG  VKP+GFK +GH PG GYKE+ VYVE+  DQT+WL VAHNALGK
Sbjct  60   FVLSECEKQDLSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK  119

Query  121  NVAPQASADQRATAL------------------------LGHRAASGFLTSAPVQLRNVN  156
            N +PQ S  QR   +                        LGH+ ++G + S   Q++NV 
Sbjct  120  NSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVK  179

Query  157  KTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDN------  210
            KT +ELL++AI   + A  +GD TV+EM +  ++L+ AE  +D +G ++D  ++      
Sbjct  180  KTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLK  239

Query  211  --IIKKMTspffyyfsssk--skkkgagspksksaRSHLPQTPMNSPTNkkpsgptsktg  266
              I+ K+T  F    S  K     K        S  S + +  +  P  +  +       
Sbjct  240  HPILYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPE---  296

Query  267  gpttDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKV  326
                   DD+LDQLSKILA L   A+TIS    RTTEQ+DRI +K+   D+RV +++  V
Sbjct  297  -------DDQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAKLV  349

Query  327  HAI  329
             A+
Sbjct  350  QAV  352

>H310_09223
Length=333

 Score = 271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 210/330 (64%), Gaps = 4/330 (1%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            M+++L+   QTSCEGYVTKRGH+MK+W+RRYMVL GDTL V+Y+DSK IYKS+ P  KGS
Sbjct  1    MHVNLSKIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGS  59

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            F+L+E EK D SDEGG VKP+GFK +GH PG GYKE+ V+VET  DQT+WL VAHNALGK
Sbjct  60   FVLSECEKQDLSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGK  119

Query  121  NV-APQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179
                P  S +    A  GH+ ++G + S   Q++NV KT  ELL++AI   + A  +GD 
Sbjct  120  TTYIPSPSMESHGGA--GHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDA  177

Query  180  TVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksk  239
            TV EM +  E+L+ AE  +D +G ++DR +++ K +  P  Y F+   S+KK     +  
Sbjct  178  TVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGA  237

Query  240  saRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVE  299
            S++         S    +          P     +D+LD+LSKILA L   A+TIS    
Sbjct  238  SSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDITT  297

Query  300  RTTEQIDRIQKKMVEADERVVEQSAKVHAI  329
            RTTEQ+DRI +K+   DERV +++  V ++
Sbjct  298  RTTEQVDRIDQKVTSVDERVTKEAKLVESV  327

>PITG_18456
Length=351

 Score = 186 bits (471),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 188/336 (56%), Gaps = 28/336 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT-----IYKSDKPKEKGSFIL  63
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSY++S+      I +   P  KG F L
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAP--KGIFYL  76

Query  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG-K  120
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NALG K
Sbjct  77   SSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGAK  136

Query  121  NVAPQASADQRATALLGHRAASGF---LTSAPV-----QLRNVNKTKEELLRKAIVTLEH  172
                + + DQ  +   G +   GF   L+  P      Q++ ++K+K+ELL +A+  LE 
Sbjct  137  RQLTRQAIDQSVSP--GKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEA  194

Query  173  ARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkg  232
            A+ VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K  
Sbjct  195  AKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKST  254

Query  233  agspksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHAN  292
              S  S   RSH  Q+  +SPT              ++DAG  +L++L++ L  LEV A 
Sbjct  255  GSSKGSSPQRSH--QSGGSSPTR------LPPALEISSDAGVSDLERLAQALGELEVQAE  306

Query  293  TISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
             ++ E  R+++QI+RI+  +     RV +Q+ +  A
Sbjct  307  LLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASA  342

>PPTG_17127
Length=351

 Score = 179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 183/335 (55%), Gaps = 26/335 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++V+DG  L+VSY++S+        +    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG-KNV  122
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+V+T  D+ +WLEVA NAL  K  
Sbjct  79   IEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSVKRQ  138

Query  123  APQASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHA  173
              + + DQ  +     L G   A   L+  P      Q++ + K+K+ELL +A+  LE A
Sbjct  139  LTRQAIDQSVSPNKKTLFGFSVA---LSPQPAMSPQKQMQTLAKSKDELLSEALRELEAA  195

Query  174  RTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkga  233
            + VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K   
Sbjct  196  KLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKSTG  255

Query  234  gspksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANT  293
            GS  S   R H  Q+  +SP+              ++DAG  +L++L++ L  LEV A  
Sbjct  256  GSKGSSPQRFH--QSGGSSPSR------LPPAFDTSSDAGGSDLERLAQALGELEVQAEM  307

Query  294  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
            ++ E   +++QI+RI+  +     RV +Q+ +  A
Sbjct  308  LNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASA  342

>PYVX_18171
Length=294

 Score = 177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 133/214 (62%), Gaps = 8/214 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            + TSCEGYVTKRGH  KSWR RY+VLDG  L+V+YF+SKT ++ +    KG F L+ I+K
Sbjct  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ-NGAASKGEFYLSSIDK  68

Query  69   HDYSDEGGGV-----KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKN  121
            H Y   G G      KP+GFK+VGHAP  GY E  ++VET  D T+WLEVAHNAL     
Sbjct  69   HAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128

Query  122  VAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181
            ++ +A+ D   +A           TS   QL+ ++ +K+ELL+ A+  LE A+ +G    
Sbjct  129  MSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188

Query  182  SEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKM  215
            +EM    E LD  EAN+  + ++LD GD +++++
Sbjct  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRL  222

>PHYSO_471523
Length=348

 Score = 176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 174/334 (52%), Gaps = 27/334 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++VLDG  L VSY++S+        +    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNV  122
            IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL  K  
Sbjct  79   IEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSAKRQ  138

Query  123  APQASADQRATALLGHRAASGF---LTSAP-----VQLRNVNKTKEELLRKAIVTLEHAR  174
              + + DQ  +     +   GF   L+  P      Q++ + K+++ELL  A+  +E A+
Sbjct  139  LTRQAIDQSVSP--NRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEAAK  196

Query  175  TVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgag  234
             VG    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS     K  A 
Sbjct  197  QVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKASAS  256

Query  235  spksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTI  294
               S        + P   P                 DAG  +L++L++ L  LEV A  +
Sbjct  257  KASSPQRSQQSGRPPRLPPA-----------MDSINDAGVSDLERLAQALGELEVQAELL  305

Query  295  STEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
            + E  R T+QI+RI+ ++     RV +Q+ +  A
Sbjct  306  NGEAGRGTQQIERIEHQLSNVTARVEKQTKQASA  339

>PHYRA_81100
Length=349

 Score = 176 bits (446),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/335 (34%), Positives = 180/335 (54%), Gaps = 28/335 (8%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAE  65
            + TSCEGYVTKRGH  KSWR R++VL+G  L++SY++S+       ++    KGSF L+ 
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78

Query  66   IEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNV  122
            IE H+Y     G   KP+GFK++GHAP  GY E  V+VET  D+ +WLEVA NAL  K  
Sbjct  79   IEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSAKRQ  138

Query  123  APQASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHA  173
              + + DQ  ++    L G   +   L+  P+     Q++ + + K+ELL  A+  +E A
Sbjct  139  LTRQAIDQSVSSNKKNLFGFGVS---LSPQPLMTPQKQMQTLTQNKDELLSGALRDIEAA  195

Query  174  RTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkga  233
            + VG    +E+    E LD  E ++  +  +LD GD +++++        S +       
Sbjct  196  KLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRL-------KSPTLHLFSDD  248

Query  234  gspksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANT  293
              PKS +++ H PQ    S  +               DAG  +L++L++ L  LEV A  
Sbjct  249  SRPKSTASKGHSPQ---RSQQSGGSPSRLPPAMETINDAGVSDLERLAQALGELEVQAEI  305

Query  294  ISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
            ++ E  R+T+QI+R++ ++     RV +Q+ +  A
Sbjct  306  LNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASA  340

>PYU1_G001735
Length=342

 Score = 174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 124/331 (37%), Positives = 185/331 (56%), Gaps = 13/331 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            K TSCEGYVTKRGH  KSWR RY+V +G  L+VSYF+S+    +     KGSF ++ +EK
Sbjct  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVAP  124
            H+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +WLEV  NAL   K +  
Sbjct  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTR  139

Query  125  QASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184
            +   D    ++ G  A+     S  +Q++ +  TKEELLR+A+  +E A+ +G   V+E+
Sbjct  140  KGMTDS-TKSMFGFGAS----ISPQLQVKKLAATKEELLREALREIEGAKLIGREAVNEI  194

Query  185  GHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksksaRSH  244
                E LD  E ++ +V  +LD  D +++ + SP  + FS+   +KKGA +  + SA   
Sbjct  195  VSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKGAPTAATASASGG  254

Query  245  LPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVERTTEQ  304
               +   SP +       +K  G      D E+  L+  L+ LE  AN ++ E  R+TEQ
Sbjct  255  --ASATTSPVSGTEGQLHAKITGGGGTLNDLEM--LALALSELEEQANLMNAEAARSTEQ  310

Query  305  IDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335
            I RI++++   ++RV  Q+ K  A  +   L
Sbjct  311  IARIEERLTSVNDRVQHQTKKATATMKAGNL  341

>PHYCA_556162
Length=351

 Score = 172 bits (436),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/337 (35%), Positives = 182/337 (54%), Gaps = 30/337 (9%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK-----TIYKSDKPKEKGSFIL  63
            + TSCEGYVTKRGH  KSWR R++VLDG  L+V+Y++S+     T  ++  P  KGSF L
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPP--KGSFYL  76

Query  64   AEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GK  120
            + IE H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NAL  K
Sbjct  77   SSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSAK  136

Query  121  NVAPQASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLE  171
                + + DQ  +     L G   +   L+  P      Q++ + K K++LL  A+  +E
Sbjct  137  RQLTRQAIDQSVSPNKKNLFGFSVS---LSPQPALSPQKQMQTLTKNKDDLLSDALRDIE  193

Query  172  HARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkk  231
             A+ +G    +E+    E LD  E ++  +  +LD GD +++++ SP  + FS+    K 
Sbjct  194  AAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKS  253

Query  232  gagspksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHA  291
             + S  +   RS   Q+  +SPT        ++      D G  +L++L++ L  LE+ A
Sbjct  254  TSSSKANSPQRSQ--QSGGSSPTR------LAQAAESRIDPGASDLERLAQALGELELQA  305

Query  292  NTISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
              ++ E   +T+QI  I+  +     RV +Q+ +  A
Sbjct  306  ELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASA  342

>PYAP_17762
Length=348

 Score = 169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 114/328 (35%), Positives = 179/328 (55%), Gaps = 20/328 (6%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            K TSCEGYVTKRGH  KSWR R++VL+G  L VSY+DSK + ++     KGSF L+ +EK
Sbjct  28   KPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEK  87

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA------LGK  120
            H+Y     G   KP+GFK+VGHAP  GY E  ++VET  D  +WLEV  NA      L +
Sbjct  88   HEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKKLTR  147

Query  121  NVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNT  180
               P+A A +   +L G   A    TS   Q++ +  TKE++L++AI  +E A+ +G + 
Sbjct  148  TGQPEALAPK---SLFGFSPA----TSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSA  200

Query  181  VSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksks  240
              E+    E LD     + +V  +LD  D +++ M +P  + FSS    +         S
Sbjct  201  CQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPS  260

Query  241  aRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVER  300
            +R     TP ++ + +  +   S +      A   ++++L+ +L  LE  A  ++ E  +
Sbjct  261  SRD----TP-SAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIK  315

Query  301  TTEQIDRIQKKMVEADERVVEQSAKVHA  328
             T Q++R+ +++   +ERV  Q+ K +A
Sbjct  316  GTAQVERVGEQLAHVNERVKAQTRKANA  343

>PHALS_06478
Length=345

 Score = 167 bits (424),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 114/336 (34%), Positives = 178/336 (53%), Gaps = 38/336 (11%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAEIE  67
            TSCEGYVTKRGH  KSWR R++VLDG  L+V+Y++S+        +    KGSF L+ IE
Sbjct  21   TSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSNIE  80

Query  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-GKNVAP  124
             H+Y     G   +P+GFK+VGHAP  G+ E  V+VET  D+ +WLEVA NAL  K    
Sbjct  81   PHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKAKRQLT  140

Query  125  QASADQRATA----LLGHRAASGFLTSAPV-----QLRNVNKTKEELLRKAIVTLEHART  175
            + + DQ  +     L G    S   ++ PV     Q++ +  +KE LL +A+  +E A+ 
Sbjct  141  RQAIDQSVSPNKKKLFGFSVPS---STQPVMSPQKQMQTLATSKEGLLLEALREIEAAKL  197

Query  176  VGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgags  235
            VG    +E+ +  E LD+ E ++  +  +LD GD ++ ++ SP  ++FS           
Sbjct  198  VGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTR-------  250

Query  236  pksksaRSHLPQTPM-NSP--TNkkpsgptsktggpttDAGDDELDQLSKILASLEVHAN  292
                      P+ P+ + P  +              T DAG  +L +L++ L  LEV A 
Sbjct  251  ----------PKVPLGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAE  300

Query  293  TISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHA  328
             +++E   +++QI+RI+  +    ERV +Q+ +  A
Sbjct  301  LLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVA  336

>PYIR_13451
Length=359

 Score = 165 bits (418),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/343 (33%), Positives = 173/343 (50%), Gaps = 23/343 (7%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK-------PKEKGS  60
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+V+Y++S+   K          P  KGS
Sbjct  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGVPVPKGS  83

Query  61   FILAEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            F ++ +EKH+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +W+EV  NAL
Sbjct  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143

Query  119  G---KNVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
                K        D   T  +   +AS    S  +Q++ +  TKE+LLR A+  +E A+ 
Sbjct  144  DAAKKRSRTGGFQDNSTTKTMFGFSAS---ASPQLQVKKLAATKEDLLRDALREIEGAKL  200

Query  176  VGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNI---IKKMTspffyyfssskskkkg  232
            +G   V+E+    E LD+ E+++  V  +LD  D +   +K+     F      K     
Sbjct  201  IGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSPHT  260

Query  233  agspksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHAN  292
             G+       SH       +           +     +D     L++L+  L  LE  AN
Sbjct  261  GGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSD-----LEKLALALGELEEQAN  315

Query  293  TISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335
             ++ E  ++TEQI R+++++   ++RV  Q+ K +A  +   L
Sbjct  316  LMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNL  358

>PYIW_19971
Length=348

 Score = 149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 169/336 (50%), Gaps = 18/336 (5%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
            FK TSCEGYVTKRGH  KSWR RY+V +      +   +     +     KGSF ++ +E
Sbjct  22   FKATSCEGYVTKRGHFRKSWRVRYLVFN-----GADLQAAGGGGASPATPKGSFFVSSVE  76

Query  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG---KNV  122
            KH+Y     GG  KP+GFKLVGHAP  GY E  ++VET  D  +W+EV  NAL    K+ 
Sbjct  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136

Query  123  APQASADQRATA-LLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181
                +AD   T  + G  A      S  +Q++ +  TKEELLR A+  +E A+ +G   V
Sbjct  137  RTPGAADSSTTKNMFGFSAT----VSPQLQVKKLAATKEELLRDALREIEGAKLIGREAV  192

Query  182  SEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksksa  241
            S++      L++ E ++  V ++LD G  ++  M  P  + FS+    K  A    S S 
Sbjct  193  SDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAHHSGSHSD  252

Query  242  R--SHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVE  299
                H    P +  ++ + +          T    D L++L   L  LE  A  ++ E  
Sbjct  253  HKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSD-LERLVLALGELEEQATAMNAEAV  311

Query  300  RTTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335
            ++TEQI R+++++   ++RV  Q+ K  A  +   L
Sbjct  312  KSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNL  347

>CCA18899
Length=343

 Score = 149 bits (376),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/342 (31%), Positives = 169/342 (49%), Gaps = 38/342 (11%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64
            L  +  TSCEGYVTKRGH  KSWR RY+V+ G  ++VSY++SK   KS     KGSFIL 
Sbjct  10   LARYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQ  69

Query  65   EIEKHDYSDE---GGGV--KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-  118
              EKH+Y       G V  KP+GFK+VGHAP  GY E  V+V+++ D  QWL+V +N L 
Sbjct  70   SAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLK  129

Query  119  -GKNVAPQASADQRAT--ALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
              K +A +A   +  T  ++LG    S   T++  Q++ +   K + + +A+  +E A++
Sbjct  130  ASKCMAREAFMAEMDTTKSVLGF---SYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKS  186

Query  176  VGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgags  235
             G+    E+    E L   E N+  +  +L+  + +IK +               +    
Sbjct  187  AGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSI---------------RHPLR  231

Query  236  pksksaRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDEL-----------DQLSKIL  284
                 +R H   T   S +  +             D   D L           ++L+  L
Sbjct  232  YFFSRSRPHDRATISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMAL  291

Query  285  ASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKV  326
              LEV A  I++E  ++ EQI RI+ ++   ++R+  Q+++V
Sbjct  292  KDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQV  333

>PHYKE_8393
Length=326

 Score = 136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 107/329 (33%), Positives = 164/329 (50%), Gaps = 39/329 (12%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            + TSCEGYVTKRGH                     F     +  + P  KGSF L+ I  
Sbjct  19   RPTSCEGYVTKRGH---------------------FPCHPPH-GETPAHKGSFYLSNIAP  56

Query  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG--KNVAP  124
            H+Y     G   KP+GFK+VGHAP  GY E  V+VET  D+ +WLEVA NALG  + +  
Sbjct  57   HEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQIMR  116

Query  125  QA-----SADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDN  179
            QA     S  ++     G   +   L     Q++ +   KEELL +A+  LE A+ VG  
Sbjct  117  QAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMVGRE  176

Query  180  TVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTspffyyfssskskkkgagspksk  239
              +E+    E LD  E ++  +  +LD GD +++++ +P  + FS     K  A S +S 
Sbjct  177  ACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSNESS  236

Query  240  saRSHLPQTPMNSPTNkkpsgptsktggpttDAGDDELDQLSKILASLEVHANTISTEVE  299
              R+H  Q+  ++P +         + G   DA   +L++L+  L  LE+ A  ++ E  
Sbjct  237  PQRTH--QSAGSNPIH------LPFSMGSANDADASDLERLAHALGELELQAELLNGEAG  288

Query  300  RTTEQIDRIQKKMVEADERVVEQSAKVHA  328
            R+T+QI RI++++     RV +Q+ +  A
Sbjct  289  RSTQQIARIEQQLSNVTARVEKQTKQASA  317

>PYAR_13570
Length=322

 Score = 129 bits (324),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 78/212 (37%), Positives = 116/212 (55%), Gaps = 24/212 (11%)

Query  24   MKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY--SDEGGGVKPY  81
            + SWR RY+VL+G  L VSYFDSK + ++     KGSF L+ +EKH+Y     G   KP+
Sbjct  6    LPSWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPF  65

Query  82   GFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVAPQASADQRAT-ALLGH  138
            GFK+VGHAP  GY E  ++VE+  D  +WLEV  +AL   K +     +D  +T +L G 
Sbjct  66   GFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGF  125

Query  139  RAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM--------------  184
              A    TS   Q++ ++ +KEELL++AI  +E A+ +G     E+              
Sbjct  126  SPA----TSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSG  181

Query  185  -GHNAEMLDIAEANMDYVGTELDRGDNIIKKM  215
               +AE LD  E+ +  V  +LD GD ++  +
Sbjct  182  FSLHAEKLDHIESELQRVDADLDYGDKLLSHL  213

>CCI45123
Length=301

 Score = 114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 93/306 (30%), Positives = 161/306 (53%), Gaps = 15/306 (5%)

Query  39   LKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE---GGGVK--PYGFKLVGHAPGHG  93
            ++VSY++SK  YK+     KGSFIL  +EKH+Y       G VK  P+GFK+VGHAP  G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  94   YKEFCVYVETAKDQTQWLEVAHNAL--GKNVAPQASADQRAT--ALLGHRAASGFLTSAP  149
            Y E  V+V++  +  QWL+V +N L   K +A +A   +  T   +LG   A    T++ 
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG---TTSK  117

Query  150  VQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGD  209
             Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  + ++L+  +
Sbjct  118  QQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSE  177

Query  210  NIIKKMTspffyyfssskskkkgagspksksaRSHLPQTPMNSPTNkkpsgptsktggpt  269
             +IK +  P  Y+FS +   +K A S  + + RSH  QT +    + + +    +     
Sbjct  178  KLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI---LHMRKNDGKIEHVAEE  234

Query  270  tDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHAI  329
                 ++L++L+  L  LEV A  I++E  ++ +QI RI+ ++   ++R+  Q+ +V A 
Sbjct  235  ICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVAS  294

Query  330  QQKNKL  335
              K  L
Sbjct  295  SGKKNL  300

>PYAR_15463
Length=1091

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 74/161 (46%), Gaps = 31/161 (19%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG TL  +Y++SK   +S +   +G  I++++   +Y  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGR-NLRGRMIISKVRPENYG-  133

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE---------VAHNALGKNVAP  124
                 K +GF +     GH     C   E  KD   W+E         V HN L +++  
Sbjct  134  -----KAHGFLI--ETKGHKLFHLCCSTELEKD--MWVEMMQAAIDEGVKHNTLDRSLL-  183

Query  125  QASADQRATALLGHRAASGFLTSAPVQ--LRNVNKTKEELL  163
                   A AL    +ASG +  +P Q  LR+      ELL
Sbjct  184  ------SAAALTSTSSASGAVQPSPTQVDLRSFYFAFRELL  218

>PPTG_18898
Length=1559

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 56/104 (54%), Gaps = 13/104 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SY+    +  + K K     ++ +++K D 
Sbjct  407  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  463

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
                   +P+GF  + +        + VY +  +++T+W+   H
Sbjct  464  ------GEPFGFMFMTNE----QVPYYVYADNDRERTKWMNALH  497

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  Y+ S+     +K K+ G+  + ++    +S
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  263

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  264  GEAHGFMFYTTKQI---------PYYVYASSEAERSRWL  293

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 59/129 (46%), Gaps = 20/129 (16%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            L DF    +  SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++      
Sbjct  296  LKDFMVETEDVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQ------  347

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
              +AE+E    +   G      F  V G+        F V  +TA +Q +WL     +  
Sbjct  348  SAMAEVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWLATVKKSTA  400

Query  120  KNVAPQASA  128
                P + A
Sbjct  401  SVPEPVSCA  409

>PITG_20562
Length=1559

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 56/104 (54%), Gaps = 13/104 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SY+    +  + K K     ++ +++K D 
Sbjct  408  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNAKGKPLAEVLVEDVQKWD-  464

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
                   +P+GF  + +        + VY +  +++T+W+   H
Sbjct  465  ------GEPFGFMFMTNE----QVPYYVYADNDRERTKWMNALH  498

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  Y+ S+     +K K+ G+  + ++    +S
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  264

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  265  GEAHGFMFYTTKQI---------PYYVYASSEAERSRWL  294

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 59/129 (46%), Gaps = 20/129 (16%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            L DF    ++ SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++      
Sbjct  297  LKDFMVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQ------  348

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
              +AE+E    +   G      F  V G+        F V  +T  +Q +WL     +  
Sbjct  349  SAMAEVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTTGEQQKWLATVKKSTA  401

Query  120  KNVAPQASA  128
                P + A
Sbjct  402  SVPEPVSCA  410

>PHYRA_84916
Length=1541

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 58/109 (53%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+T  +SY+    +  + K K     ++ +++K D 
Sbjct  404  SCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVLVEDVQKWD-  460

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  + +        + VY +  +++ +W+    NAL K
Sbjct  461  ------GEPFGFMFMTNE----QVPYYVYADNDRERNKWM----NALNK  495

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  Y+ S+     +K K+ G+  + ++    +S
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAP--WS  260

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  261  GEAHGFMFYTTKQI---------PYYVYASSEGERSRWL  290

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (46%), Gaps = 16/125 (13%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64
            + + +  SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++        +A
Sbjct  297  MVETEDVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQS------AMA  348

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA  123
            E+E    +   G      F  V G+        F V  +T  +Q +WL     +      
Sbjct  349  EVEIRSVAPWDGEANGLMFMTVTGNV-------FYVIADTGGEQQKWLATVKKSTANVPE  401

Query  124  PQASA  128
            P + A
Sbjct  402  PVSCA  406

>PHYRA_82543
Length=1199

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  I++++   +Y  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  116

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  117  -----KAHGFLLETQ--GHKHFHLCCATELEKD--MWVEMMQAAIEEGV  156

>PHYSO_544598
Length=1163

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  I++++   +Y  
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  74

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  75   -----KAHGFLLETQ--GHKHFHLCCSTELEKD--MWVEMMQAAIEEGV  114

>H310_00231
Length=1495

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/206 (29%), Positives = 90/206 (44%), Gaps = 51/206 (25%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH++ S+R RY VL G ++K  YF  +T Y+S      G+  LAE+E     
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK--YFADETAYRS------GASALAEMEVR---  299

Query  73   DEGGGVKPYGFKLVGHAPGHGYK-----EFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
              GGG      +  G + G   K        +  E   +  +WLE    ALGK      +
Sbjct  300  --GGG------RWDGESTGLFIKTSTGSTLFLCAENVPELQKWLE----ALGK-----VT  342

Query  128  ADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVT---------LEHARTVGD  178
             D+    +    A +G+LT      R   K +  +LR   +          + H+R +G+
Sbjct  343  VDKPVQPI----ACAGWLTKQ-GHKRKSWKKRYFVLRGTTLAYYTDFDASNMRHSRPLGE  397

Query  179  NTVSEM----GHNAEMLDIAEANMDY  200
             TV E+    G     + +   N+ Y
Sbjct  398  VTVREVSTWDGEPGGFMFVTNDNVPY  423

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 65/139 (47%), Gaps = 20/139 (14%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLK-VSYFDSKTIYKSDKPKEKGSFILAEIEKHD  70
            +C G++TK+GH  KSW++RY VL G TL   + FD+  +  S +P       L E+   +
Sbjct  351  ACAGWLTKQGHKRKSWKKRYFVLRGTTLAYYTDFDASNMRHS-RP-------LGEVTVRE  402

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA---PQAS  127
             S   G  +P GF  V     +    + V+ +  +DQ +WL         + +   P+ +
Sbjct  403  VSTWDG--EPGGFMFV----TNDNVPYYVFADNERDQAKWLTALRKLFESSTSVEEPEKT  456

Query  128  ADQRATALLGHR--AASGF  144
              + A  L G R   A GF
Sbjct  457  CPRCAYVLTGSRFCGACGF  475

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 47/98 (48%), Gaps = 17/98 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+TKRGHV+ +W+ R+ VL     ++SY+  + +      K+ G   L ++    +S E
Sbjct  157  GYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGMK-----KKLGEVHLEKVSP--WSGE  208

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
              G   Y  K +          + VY  T  ++ +WLE
Sbjct  209  ANGFMFYTSKQIA---------YYVYASTNSERRRWLE  237

>PYAP_16997
Length=1018

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 18/102 (18%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEG++TKRGHV  +W+ RY VL G+ L+  YF        DK K  GS I+ ++   
Sbjct  204  EIACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSGD-----DKSKRYGSVIVEKVAP-  255

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             +S E  G   Y  K V          + VY  +  ++ +WL
Sbjct  256  -WSGEAHGFMFYTTKQV---------PYYVYASSEAERAKWL  287

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 58/112 (52%), Gaps = 17/112 (15%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY VL G++  ++YF       S+K K     I+ ++++ D 
Sbjct  401  ACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYFTDFDTANSNKGKALAEVIVEDVQRWD-  457

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA  123
                   +P+GF  +          + VY +  +++ +W+    NAL K  A
Sbjct  458  ------GEPFGFMFMTSE----QVPYYVYADNERERGKWM----NALRKLTA  495

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            L DF    ++ +CEG++T+RGH++ S R  Y VL+G +L+
Sbjct  290  LRDFMVEPEEVTCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>PYAR_23286
Length=607

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY VL G +  VSY+       S K K     ++ ++++ D 
Sbjct  388  ACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIEDVQRWD-  444

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +     P      + VY +  +++T+W+    NAL K
Sbjct  445  ------GEPFGFMFMTSEQIP------YYVYADNERERTKWM----NALRK  479

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  YF  +     DK K  GS ++ ++    +S
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFAGE-----DKSKRYGSVVVEKVAA--WS  244

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K V          + VY  +  ++ +WL
Sbjct  245  GEAHGFMFYTAKQV---------PYYVYASSESERAKWL  274

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +CEGY+T+RGH++ S R  Y VL+G +L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>H257_03361
Length=699

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 4/62 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
           +G++ K+G V+ SW++RY+VL G    +SYFD +    + + KEKGSF+LA ++ +   D
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQ--NISYFDKEV--SNPRAKEKGSFVLAGVQPNKSYD  66

Query  74  EG  75
            G
Sbjct  67  NG  68

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 24/32 (75%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            G++ K+G +++SW++RY VL G    ++YFD+
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRG--RNIAYFDT  241

>PYIW_17381
Length=952

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  YF  +     DK K  GS  +A++    +S
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFSGE-----DKGKRYGSVTVAKVAP--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K V          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQV---------PYYVYASSEAERSKWL  291

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   ++YF    I  S K K      + +++K D 
Sbjct  405  SCAGYLTKQGHKRKSWKKRYFILRGNL--IAYFTDYDIANSAKGKPLAEVTVEDVQKWD-  461

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +          + VY +  +++ +W+    NAL K
Sbjct  462  ------GEPFGFMFMTSE----QVPYYVYADNDRERNKWM----NALRK  496

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 32/46 (70%), Gaps = 2/46 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            ++  CEGY+T+RGH++ S R  Y VL+G +L+  ++  ++ Y+ ++
Sbjct  302  EEVGCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRENQ  345

>PPTG_19371
Length=1195

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  I++++   +Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIISKVRPENYG-  126

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  127  -----KAHGFLI--ETQGHKHFHLCCTTELEKD--MWVEMMQAAIEEGV  166

>PYU1_G006347
Length=1095

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL GD L+  YF  +     +K K+ GS  +A++    +S
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGE-----EKNKKYGSVTVAKVAP--WS  250

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  251  GEAHGFMFYTTKQI---------PYYVYAASEAERSKWL  280

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 21/114 (18%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SY+    +  S K K      + +++K D 
Sbjct  394  SCAGYLTKQGHKRKSWKKRYFILRGNL--ISYYSDYDLANSAKGKPLAEVAVEDVQKWD-  450

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA  123
                   +P+GF  +     P      + VY +  +++ +W+    NAL K  A
Sbjct  451  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALSKLTA  488

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 54/108 (50%), Gaps = 20/108 (19%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            ++ SCEGY+T+RGH++ S R  Y VL+G +L+  ++  ++ Y+ ++        +AE+E 
Sbjct  291  EEVSCEGYLTRRGHLVPSQRMAYYVLNGASLR--HYADQSAYRDNQ------SAIAEVEV  342

Query  69   HDYSDEGGGVKPYGFKL---VGHAPGHGYKEFCVYVETAKDQTQWLEV  113
               +   G  +P G       G+        F    +T  +Q +WL+ 
Sbjct  343  RSVAPWDG--EPNGLMFQTSTGNV-------FYASTDTVGEQQKWLQT  381

>SPRG_08834
Length=825

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 59/117 (50%), Gaps = 17/117 (15%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G++ K+G V+K+W+RR+MVL   +  + YF++  +  + KP  KGSF +  IE+     
Sbjct  127  RGWICKQGSVVKNWKRRFMVL--QSCHLHYFETDKLTPTLKP--KGSFQVLVIERASDLQ  182

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE--VAHNALGKNVAPQASA  128
             G         LV   PG+  + F  Y + A+  T W    V+H      VAP ASA
Sbjct  183  HG---------LVAKGPGN--RVFKFYADDAQSCTAWFTAIVSHLRNRPTVAPSASA  228

>PYAP_18636
Length=1009

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG TL  +Y+++K   +S +   +G  I++++   +Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGR-NLRGRMIISKVRPENYG-  158

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF L     GH +   C   E  KD   W+E+   A+ + V
Sbjct  159  -----KAHGFLL--ETMGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  198

>CCA18023
Length=1138

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 63/132 (48%), Gaps = 14/132 (11%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            Q   EGYV K+G  +  W  RY+VLDG TL  +Y+++K   +S +   +G  ++ ++   
Sbjct  121  QVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSAR-NLRGKMMIVKVRPE  177

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASAD  129
            +Y       K +GF +     GH +   C   E  KD   W+E+   A+ +  AP +S  
Sbjct  178  NYG------KAHGFLI--ETKGHKHFHLCCATELEKD--MWIEMMQAAI-EQAAPFSSNA  226

Query  130  QRATALLGHRAA  141
              +   L H  A
Sbjct  227  SHSFVSLHHSIA  238

>PYAP_22646
Length=815

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 56/127 (44%), Gaps = 13/127 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGY+ K+GHV++SWR RY +L G T   SY+ SK +   D  K +G   +   
Sbjct  96   DMFETDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDVAMLDTEKYRGRVSVTGA  153

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQA  126
            ++ D    G  +               +K F +Y  T  +   W+++   A+     P+ 
Sbjct  154  KRDDSRTNGVLIT-----------TTIHKIFALYTRTPVEAEIWVKMIQQAVANASTPKP  202

Query  127  SADQRAT  133
            S     T
Sbjct  203  SVSISTT  209

>PHYSO_361747
Length=1523

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 57/111 (51%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SY+    +  + K K     ++ +++K D 
Sbjct  413  SCAGYLTKQGHKRKSWKKRYFILRGNA--ISYYSDYDMANNSKGKPLAEVLVEDVQKWD-  469

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  470  ------GEPFGFMFMTTEQVP------YYVYADNDRERNKWM----NALNK  504

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 52/101 (51%), Gaps = 18/101 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  Y+ S+     +K K+ G+  + ++    +S
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVTVEKVAT--WS  269

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
             E  G   Y  K +          + VY  +  ++++WL V
Sbjct  270  GEAHGFMFYTTKQI---------PYYVYASSESERSRWLRV  301

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 16/125 (13%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64
            + + ++ SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++        +A
Sbjct  306  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQ------LAMA  357

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA  123
            E+E    +   G      F  V G+        F V  +TA +Q +WL     +      
Sbjct  358  EVEIRSVAAWDGEANGLMFMTVTGNV-------FYVIADTAGEQQKWLATVKKSTASVPE  410

Query  124  PQASA  128
            P + A
Sbjct  411  PVSCA  415

>PYIR_21589
Length=1568

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEG++TKRGHV  +W+ RY VL G+ L+  YF  +     DK K  GS  +A++    +S
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFAGE-----DKGKRYGSVTVAKVAP--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQI---------PYYVYAASEAERSKWL  291

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 55/109 (50%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   ++Y+    +  S K +      + +++K D 
Sbjct  405  SCAGYLTKQGHKRKSWKKRYFILRGNL--IAYYPDYDLANSAKGRALAEVTVEDVQKWD-  461

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +          + VY +  +++ +W+    NAL K
Sbjct  462  ------GEPFGFMFMTSE----QVPYYVYADNDRERNKWM----NALRK  496

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 33/46 (72%), Gaps = 2/46 (4%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            ++ SCEGY+T+RGH++ S R  Y VL+G +L+  ++  ++ Y+ ++
Sbjct  302  EEVSCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRDNQ  345

>PITG_19213
Length=1201

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  I+ ++   +Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIINKVRPENYG-  126

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  127  -----KAHGFLI--ETQGHKHFHLCCTTELEKD--MWVEMMQAAIEEGV  166

>PHYRA_79281
Length=809

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (63%), Gaps = 2/59 (3%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            ++    D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K+D  K +G
Sbjct  90   LSCAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTDTEKFRG  146

>H257_06722
Length=1482

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 12/67 (18%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            L+DF        CEGY+TKRGH++ S+R RY VL G T+K  Y+  +T Y+S      G+
Sbjct  239  LSDFYVEPDAVDCEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETAYRS------GA  290

Query  61   FILAEIE  67
              LAE+E
Sbjct  291  SALAEME  297

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 71/161 (44%), Gaps = 29/161 (18%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLK-VSYFDSKTIYKSDKPKEKGSFILAEIEKHD  70
            +C G++TK+GH  KSW++RY VL G+TL   + FD+  + +  KP       L E+   +
Sbjct  351  ACAGWLTKQGHKRKSWKKRYFVLRGNTLAYYTDFDASNL-RHGKP-------LGEVTVRE  402

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA---PQAS  127
             S   G  +P GF  +     +    + V+ +  +DQ +WL           +   P  +
Sbjct  403  VSAWDG--EPSGFMFI----TNDSVPYYVFADNDRDQAKWLAALRKLFESATSMEEPDKT  456

Query  128  ADQRATALLGHR--AASGFLTSAPVQLRNVNKTKEELLRKA  166
              + A  L G R   A GF         N+  T  E  R+A
Sbjct  457  CPRCAYVLTGSRFCGACGF---------NLRGTSNERSRQA  488

 Score = 38.9 bits (89),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 17/100 (17%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
              GY+TKRGHV+ +W+ R+ VL     ++SY+  + +      K+ G   L ++    +S
Sbjct  155  ASGYLTKRGHVVTNWKTRFFVLRAGG-RLSYYADEGMK-----KKLGEVHLEKVSP--WS  206

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
             E  G   Y  K +          + VY  T  ++ +WL+
Sbjct  207  GEANGFMFYTNKQIA---------YYVYASTNSERRRWLD  237

>SDRG_02154
Length=822

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 17/116 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G V+K+W+RR+MVL   +  + YF++  +  + KP  KGSF +  IE+      
Sbjct  128  GWICKQGSVVKNWKRRFMVL--QSCHLHYFETDKLTPTLKP--KGSFQVLAIERASDLQH  183

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE--VAHNALGKNVAPQASA  128
            G         LV  A G G + F  Y + A+  T W    V+H      V P ASA
Sbjct  184  G---------LV--AKGSGNRVFKFYADDAQSCTAWFTAIVSHLRSRPTVTPSASA  228

>PHYCA_506137
Length=810

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K+D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKTDTEKFRG  147

>PYVX_20438
Length=1346

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGHV  +W+ RY  L G+ L+  YF S      DK K+ G+  +A++    +S
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS-----DDKSKKYGAVTVAKVAP--WS  173

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++ +WL
Sbjct  174  GEAHGFMFYTTKQI---------PYYVYASSEVERAKWL  203

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G +  +SYF    +  S K K      LAE+   D 
Sbjct  318  ACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGK-----ALAEVTVEDV  370

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                G  +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  371  QRWDG--EPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALRK  409

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 54/120 (45%), Gaps = 20/120 (17%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SCEGY+TKRGH++ S R  Y VL G  L+  ++  +  Y+ ++        +AE+E    
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLR--HYADQQAYRENQSA------MAEVEVRSV  269

Query  72   SDEGGGVKPYGF---KLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
            +   G  +P+G     + G+        F    +T  +Q +WL     +      P A A
Sbjct  270  ATWDG--EPHGLMFQTVTGNV-------FYASADTQGEQQKWLATVKKSTANLPEPVACA  320

>CCA24531
Length=374

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 14/105 (13%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAE  65
            T  ++    G++ K+G +++SW++RYMVL G  L  SY+D+  I  S K KEKGSF +  
Sbjct  18   TSIRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVIT  74

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
            +E  +    G         L+ H  G G +   +Y ET ++ + W
Sbjct  75   VELSNEIKNG---------LLVH--GRGGRILKLYTETTEEASGW  108

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            G++ K G   KSW++RY VL G++L  +YF S+
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE  214

>PHYKE_5678
Length=809

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K+D  K +G
Sbjct  96   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEVAKTDTEKFRG  146

>PYU1_G004386
Length=837

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (46%), Gaps = 17/125 (14%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGY+ K+GHV++SWR RY +L G T   SY+ SK +   D  K +G   +   
Sbjct  132  DMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDVAMIDTEKFRGRVTVTGA  189

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL----EVAHNALGKNV  122
             K D    G  V     K+           F +Y  TA +   W+    +   NA G+ +
Sbjct  190  RKDDARTNGVLVTTTINKV-----------FALYTRTAIESEIWIKMIQQAVQNASGQKM  238

Query  123  APQAS  127
            +  A+
Sbjct  239  STSAT  243

>PHYKE_1990
Length=1499

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 57/111 (51%), Gaps = 21/111 (19%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G T  +SY+    +  + K K     ++ ++++ D 
Sbjct  405  ACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALAEVLVEDVQRWD-  461

Query  72   SDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                   +P+GF  +     P      + VY +  +++ +W+    NAL K
Sbjct  462  ------GEPFGFMFMTSEQVP------YYVYADNDRERNKWM----NALNK  496

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (53%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  Y+ S+     +K K+ G+ ++ ++    +S
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSE-----EKSKKYGAVMVEKVAT--WS  261

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  262  GEAHGFMFYTTKQI---------PYYVYASSEAERSKWL  291

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 16/125 (13%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64
            + + ++ SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++        +A
Sbjct  298  MVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGASLR--HYADQQAYRDNQS------AMA  349

Query  65   EIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA  123
            E+E    +   G      F+ V G+        F V  +T+ +Q +WL     +      
Sbjct  350  EVEIRSVAPWDGEANGLMFQTVTGNV-------FYVIADTSGEQQKWLSTVKKSTTNIPE  402

Query  124  PQASA  128
            P A A
Sbjct  403  PVACA  407

>CCI46235
Length=1155

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 13/113 (12%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            Q   EGYV K+G  +  W  RY+VLDG TL  +Y+++K   +S +   +G  ++ ++   
Sbjct  116  QVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSAR-NLRGKMMIVKVRPE  172

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
            +Y       K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  173  NYG------KAHGFLI--ETKGHKHFHLCCATELEKD--MWIEMMQAAIEQAV  215

>CCI47145
Length=390

 Score = 53.5 bits (127),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 88/188 (47%), Gaps = 27/188 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G +++SW++RYMVL G  L  SY+D+  I  S K KEKGSF +  +E  +    
Sbjct  39   GWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNIL-SLKVKEKGSFQVITVELSNEIKN  95

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRATA  134
            G         L+ H  G G +   +Y ET ++ + W    +NA+ +  A   S +     
Sbjct  96   G---------LLVH--GRGGRILKLYTETTEEASGW----YNAIIE--ATVISVETAVAI  138

Query  135  LLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIA  194
              G  + +G L S    L     T++         + H   +  N V+E+   +++ +  
Sbjct  139  AAGRTSRAGSLGSNETALSVDGCTRDS-------QMAHKICLDSNDVTELLDQSDLQNND  191

Query  195  EANMDYVG  202
            E  +D+ G
Sbjct  192  EIEIDHTG  199

 Score = 34.7 bits (78),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            G++ K G   KSW++RY VL G++L  +YF S+
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE  229

>PYIW_18480
Length=755

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 57/126 (45%), Gaps = 17/126 (13%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV++SWR RY +L G T   SY+ SK +   D  K +G   +   
Sbjct  46   DMFETDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH----NALGKNV  122
             K D      GV      LV        K F +Y  T  +   W+ +      NA G+  
Sbjct  104  RKDD--SRANGV------LVTTTIN---KVFSLYTRTPIESEIWVRMIQQAVVNASGQKP  152

Query  123  APQASA  128
            +  ASA
Sbjct  153  SMSASA  158

>PYAR_19883
Length=833

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 13/118 (11%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV+++WR RY +L G T   SY+ SK +   D  K +G   +    + 
Sbjct  99   ETDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVAMQDTEKYRGRVSVTGASRD  156

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
            D    G  +               +K F +Y  T  +   W+ +   A+     P+ S
Sbjct  157  DSRANGVLIT-----------TTIHKAFALYTRTPVEAEIWVRMIQQAVANATLPKPS  203

>PYIW_16987
Length=821

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +Y+++K   +S +   +G  I++++   +Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  175

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  176  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  215

>PHYSO_344112
Length=813

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKMDTEKFRG  147

>PPTG_05519
Length=810

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKMDTEKFRG  147

>PYU1_G008848
Length=765

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +Y+++K   +S +   +G  I++++   +Y  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  189

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  190  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  229

>HYAP_08026
Length=798

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K D  K +G
Sbjct  84   DLFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKVDTEKFRG  134

>CCI44752
Length=1526

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 18/98 (18%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+TKRGHV  +W+ R+ VL G+ L+  Y+ S+     +K K  GS ++A++    +S 
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE-----EKTKRYGSVVVAKVAP--WSG  273

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G   Y  K +          + VY  +  ++T+WL
Sbjct  274  EAHGFMFYTTKQI---------PYYVYAASEAEKTKWL  302

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 13/100 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G+   +SY+    +  + K K      LAE++  D 
Sbjct  417  ACAGYLTKQGHKRKSWKKRYFILRGNI--ISYYQDYDLANNAKGK-----ALAEVQVEDV  469

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
                G    + F      P      + VY +  +++ +W+
Sbjct  470  QKWDGEAFGFMFMTTEQVP------YYVYADNERERKKWM  503

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 53/121 (44%), Gaps = 17/121 (14%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEGY+T+RGH++ S R  Y VL G  L+  Y D +    +D         +AE+E  
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTYLR-HYADQQAYRDNDS-------AMAEVEIR  365

Query  70   DYSDEGGGVKPYGFK-LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN-VAPQAS  127
              +     V    FK + G+        F    ET  ++ +W+    N    N V P A 
Sbjct  366  SIAAWDAEVNGLMFKTMTGNV-------FYASTETESERQRWVSNHSNTTTSNTVEPVAC  418

Query  128  A  128
            A
Sbjct  419  A  419

>PHYKE_6662
Length=765

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG+V K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  I+ ++   +Y  
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NLRGRMIIVKVRPENYG-  127

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  128  -----KAHGFLI--ETQGHKHFHLCCSTELEKD--MWVEMMQAAIEEGV  167

>SDRG_12762
Length=1392

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (49%), Gaps = 20/117 (17%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH++ S+R RY V+ G  +K  Y+  +T Y++      G+  LAEIE     
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGSVVK--YYSDETAYRT------GASALAEIEVKSGG  309

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK--NVAPQAS  127
               G      FK   ++         V  E   D  +W+E    ALG+  N AP+ +
Sbjct  310  RWDGESTGLFFKTATNS------TMFVCAENVADLQKWIE----ALGRIFNEAPKPA  356

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 52/108 (48%), Gaps = 13/108 (12%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C G++TK+GH  KSW++RY VL G  L  SYF       +   K      L+E+   D 
Sbjct  359  ACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAANTRLGKA-----LSEVSVKDV  411

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +   G V  + F  + + P      + V+ +  +DQ +W+     A+G
Sbjct  412  APWDGEVCGFMFVTLENVP------YYVFADNERDQAKWMTALKKAVG  453

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 43/98 (44%), Gaps = 17/98 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+TKRGHV+ +W+ R+  L     ++SY++ + + K           L E+     S  
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQG-RLSYYNDEGMGKK----------LGEVHVSKVSPW  212

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
             G    + F+            + VY  +  ++ +WL+
Sbjct  213  SGETNGFMFQTTKQI------SYYVYASSNTERARWLK  244

>PITG_02762
Length=810

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVAKLDTEKFRG  147

>SPRG_06058
Length=1258

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 57/134 (43%), Gaps = 14/134 (10%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +   CEGY+TKRGH++ S+R RY V+ G  +K  Y+  +T Y++      G+  LAEIE 
Sbjct  43   RPVDCEGYLTKRGHLVPSYRLRYFVMCGSVVK--YYSDETAYRT------GASALAEIEV  94

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
                   G      FK   ++         V  E   D  +W+E       + + P   A
Sbjct  95   KSGGRWDGESTGLFFKTATNS------TMFVCAENVADLQKWIEALGRIFNEPIKPAPVA  148

Query  129  DQRATALLGHRAAS  142
                    GH+  S
Sbjct  149  CAGWLTKQGHKRKS  162

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (46%), Gaps = 13/111 (12%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHD  70
             +C G++TK+GH  KSW++RY VL G  L  SY+        +    +    L+++   D
Sbjct  147  VACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYAD-----FEAANTRAGKALSDVSLKD  199

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN  121
                 G    + F  + + P      + V+ +  +DQ +W+     A+G +
Sbjct  200  VGPWDGEACGFMFTTLENVP------YYVFADNERDQAKWMSALKKAVGAD  244

>PYIR_18382
Length=1154

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG  L  +Y+++K   +S +   +G  I++++   +Y  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSAR-NLRGRMIISKVRPENYG-  184

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  185  -----KAHGFLI--ETKGHKHFHLCCSTELEKD--MWVEMMQAAIDEGV  224

>SPRG_00364
Length=255

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 53/106 (50%), Gaps = 22/106 (21%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V KRG VM++W+RRY VL  + L  +Y+D   I    +PK+ G F+         S E
Sbjct  166  GWVEKRGAVMRTWKRRYFVLRENVL--AYYD---INLEGQPKKGGDFV--------QSIE  212

Query  75   GGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
               +KP G  FK+V        +    + ET  D  QWL +A N L
Sbjct  213  TSTIKPNGLEFKMVSG------RSLLGFTETTDDHVQWL-LAANTL  251

>H310_07701
Length=811

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV+++WR RY +L G     +Y+ SK    SD  K KG   +   
Sbjct  46   DLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMSDFEKFKGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K FC+Y +T  +   W+ +   A+
Sbjct  104  KK-DPSRSNGFVVTTTID----------KVFCMYTKTPIETELWIRMIEKAV  144

>SPRG_06059
Length=1312

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 20/119 (17%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
             K  SC GY+TK+GH  KSW+RRY VL G TL   Y D  ++ K           LAE+ 
Sbjct  221  IKPISCAGYLTKQGHRRKSWKRRYFVLRGGTLAY-YADYDSMNKQS---------LAEVG  270

Query  68   KHDYSDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAP  124
              D +   G  + +GF+ +     P      + V+ E+ +++ +W+      +  + AP
Sbjct  271  VEDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWMVALQTLVRTHSAP  321

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
           C GY+TKRGHV+ +W+ R+ VL    +   Y D
Sbjct  12  CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYAD  44

 Score = 34.7 bits (78),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query  11   TSCEGYVTKR--GHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEK  58
            T CEGY+TKR  G    S R +Y VL G  LK  Y D +     D P  K
Sbjct  125  TDCEGYLTKRTPGFSFLSSRPKYYVLTGTLLKC-YHDEEGYRGHDVPSAK  173

>SDRG_03531
Length=255

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 52/106 (49%), Gaps = 22/106 (21%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V KRG VM+SW+RRY VL  + L  +Y+D   I    +PK+ G  +         S E
Sbjct  166  GWVEKRGAVMRSWKRRYFVLRENVL--AYYD---INLEGQPKKGGDLV--------QSIE  212

Query  75   GGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
               VKP G  FK+V        +    + ET  D  QWL +A N L
Sbjct  213  TSTVKPNGLEFKMVSG------RSLVGFTETTDDHVQWL-LAANTL  251

>H257_07514
Length=810

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D  +T  EGYV K+GHV+++WR RY +L G     +Y+ SK    +D  K KG   +   
Sbjct  46   DLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMADFEKFKGRVTVTGA  103

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K FC+Y +T  +   W+ +   A+
Sbjct  104  KK-DPSRSNGFVVTTSID----------KVFCMYTKTPIETELWIRMIEKAI  144

>HYAP_04457
Length=1203

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 13/105 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G  +L ++   +Y  
Sbjct  62   EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSAR-NLRGRMLLLKVRPENYG-  117

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 K +GF L   +  H +   C   E  KD   W+E+   A+
Sbjct  118  -----KAHGFFLETQS--HKHFHLCCSSELEKD--MWVEMMQAAI  153

>SDRG_12763
Length=1317

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 31/132 (23%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            K  SC GY+TK+GH  KSW+RRY VL G TL   Y D  ++ K           LAE+  
Sbjct  220  KPISCAGYLTKQGHRRKSWKRRYFVLRGATLSY-YSDYDSMNKQS---------LAEVGV  269

Query  69   HDYSDEGGGVKPYGFKLVG--HAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKN-----  121
             D +   G  + +GF+ +     P      + V+ E+ +++ +W+ VA   L +N     
Sbjct  270  EDVALWDG--EQFGFQFITTEQVP------YYVFAESDRERQKWM-VALQTLIRNHGAPL  320

Query  122  -----VAPQASA  128
                 +AP +SA
Sbjct  321  QMPTVLAPPSSA  332

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 0/47 (0%)

Query  5   LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYK  51
           + D  +  C GY+TKRGHV+ +W+ R+ VL    +   Y D   + K
Sbjct  2   MGDGDEILCAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADDSMVKK  48

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query  11   TSCEGYVTKR--GHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEK  58
            T CEGY+TKR  G    S R +Y VL G  LK  Y D +     D P  K
Sbjct  123  TDCEGYLTKRTPGFSFLSSRPKYYVLTGTLLKC-YNDEEGYRGHDVPSAK  171

>HYAP_08645
Length=1514

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 17/109 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            SC GY+TK+GH  KSW++RY +L G+   +SY+    +  + K +      LAE+   D 
Sbjct  307  SCAGYLTKQGHKRKSWKKRYFILRGNL--ISYYSDYDMANNTKGRP-----LAEVLVEDV  359

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                G  +P+GF  + +        + VY +  +++ +W+    NAL K
Sbjct  360  QSWDG--EPFGFMFMTNE----QVPYYVYADNDRERNKWM----NALNK  398

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (51%), Gaps = 18/99 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            CEGY+TKRGH+  +W+ RY  L G+ L+  Y+  +     +K K+ G+  + ++    +S
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSGE-----EKSKKYGAVTVEKVAT--WS  163

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
             E  G   Y  K +          + VY  +  ++++WL
Sbjct  164  GEAHGFMFYTTKQI---------PYYVYASSESERSRWL  193

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 59/129 (46%), Gaps = 20/129 (16%)

Query  5    LTDF----KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
            L DF    ++ SCEGY+TKRGH++ S R  Y VL+G +L+  ++  +  Y+ ++      
Sbjct  196  LKDFMVETEEVSCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRENQSA----  249

Query  61   FILAEIEKHDYSDEGGGVKPYGFKLV-GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
              +AE+E    +   G      F  V G+        F V  +T  +Q +WL     +  
Sbjct  250  --MAEVEIRSVAPWEGETNGLMFMTVTGNV-------FYVIADTVGEQQKWLATVKKSTA  300

Query  120  KNVAPQASA  128
                P + A
Sbjct  301  SVPEPVSCA  309

>SDRG_14486
Length=308

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 15/114 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V K+G +++SW++RYMVL    L  SYFD++ +  S   K KGSF +  IE      
Sbjct  7    QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAS--TKAKGSFAVITIEYAKDIQ  62

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
             G         L+ H  G G +   +Y E+A+  T W +     +   V  QAS
Sbjct  63   HG---------LLIH--GVGGRVMKLYTESAESCTGWFDAVTAVMLGQVLSQAS  105

 Score = 35.8 bits (81),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            C G++ K G  +K+W+RR+  L G +L  +Y+D+  +  S K
Sbjct  137  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAK  176

>CCA19097
Length=688

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 53/104 (51%), Gaps = 16/104 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G V+K+W+RRYMVL+G+ LK  Y+DS     S K +EKGS  +  +E       
Sbjct  9    GWVHKQGAVIKTWKRRYMVLNGNVLK--YYDSAL---SIKMEEKGSVQILSVEMSGSIQN  63

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            G          + H  G G +   +Y +++    +W E   N +
Sbjct  64   G---------RIMH--GKGGRVLKIYTDSSMQNKEWFEAITNVV  96

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (63%), Gaps = 5/51 (10%)

Query  1    MNLDLTDFKQTSC---EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT  48
            M+LD T     S     G++ K+G  +K+W+RR+ +L GD L  SYFD+++
Sbjct  127  MSLDSTKAPSESTIQYSGWLVKQGGRVKNWKRRFFLLRGDNL--SYFDTES  175

>PYU1_G006732
Length=954

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 66/151 (44%), Gaps = 24/151 (16%)

Query  5    LTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFIL  63
            L +F  T   EGY+ K+G  +K W+RR+ V D  TL  SY+ S+   K  KP        
Sbjct  11   LAEFDATCMKEGYLQKKGQRLKGWKRRWFVCDARTL--SYYISR---KDRKPN-------  58

Query  64   AEIEKHDYSDEGGGV-KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK--  120
            A I     S + GG+ + +    +    G     +C+  E  +  TQWL V  NA+ K  
Sbjct  59   AVIPLEGCSVQDGGLSETWNSPRIYLTDGTNGVMYCLSSEDGEAVTQWLAVLRNAVAKVN  118

Query  121  --------NVAPQASADQRATALLGHRAASG  143
                    + APQ S ++   A     AA G
Sbjct  119  GTSDSASEDAAPQQSKNRNGNATRAATAAKG  149

>H310_04843
Length=968

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 13/109 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +Y++SK   ++ K   +G  I+  +   +Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEARTGK-NLRGRMIITRVLPENYG-  158

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V
Sbjct  159  -----KAHGFLI--ETMGHKHFHLCCTTELEKD--MWVEMMQAAIDEGV  198

>SPRG_00890
Length=883

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (47%), Gaps = 21/154 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +Y+++K   +S +   +G  I+  +   +Y  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGR-NLRGRMIITRVLPENYG-  86

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA--PQASADQR  131
                 K +GF +     GH +   C   E  KD   W+E+   A+ + ++  P  +  Q 
Sbjct  87   -----KAHGFLI--ETKGHKHFHLCCTTELEKD--MWVEMMQAAIDEGISHPPHLTTQQS  137

Query  132  ATALLGHRAASGFLTSAPVQ--LRNVNKTKEELL  163
            +    G   A+    ++P Q  LR+      +LL
Sbjct  138  S----GTFEATVSFQASPTQVDLRSFYSAFRKLL  167

>SDRG_14487
Length=964

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 4/55 (7%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
           EG++ K+G +M +W++RYMVL G    ++Y+D +    + + KEKG+F LA +E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYDKEV--SNPRAKEKGTFTLAAVER  57

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
            G++ K G  +KSW++R+ VL G  L  +Y+D
Sbjct  133  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  161

>SDRG_01407
Length=815

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 72/154 (47%), Gaps = 21/154 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +Y+++K   +S +   +G  I+  +   +Y  
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGR-NLRGRMIITRVLPENYG-  140

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVA--PQASADQR  131
                 K +GF +     GH +   C   E  KD   W+E+   A+ + ++  P  +  Q 
Sbjct  141  -----KAHGFLI--ETKGHKHFHLCCTTELEKD--MWVEMMQAAIDEGISHPPHLTTQQS  191

Query  132  ATALLGHRAASGFLTSAPVQ--LRNVNKTKEELL  163
            +    G   A+    ++P Q  LR+      +LL
Sbjct  192  S----GTFEATVSFQASPTQVDLRSFYSAFRKLL  221

>SPRG_02752
Length=831

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 4/55 (7%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
           EG++ K+G +M +W++RYMVL G    ++Y+D +    + + KEKG+F LA +E+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYDKEVT--NPRAKEKGTFTLAAVER  57

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
            G++ K G  +KSW++R+ VL G  L  +Y+D
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>CCA21715
Length=782

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 19/151 (13%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV++SWR RY VL G     SY+ SK I  +D  + +G   +   E+ 
Sbjct  105  ETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAERD  162

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASAD  129
                 G  ++    K+           F +   +  +   W+ +   A+  +   + S  
Sbjct  163  GSRTNGVLIRTTVNKV-----------FSIQTSSTIESDLWIRMISQAVANSTGLKTSLT  211

Query  130  QRATALLGHRAASGFLTSAPVQLRNVNKTKE  160
                   G   A    +S  ++ RN+N TK+
Sbjct  212  T------GSLLAQTVRSSGDLKTRNMNVTKQ  236

>CCA21860
Length=782

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 19/151 (13%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            +T  EGY+ K+GHV++SWR RY VL G     SY+ SK I  +D  + +G   +   E+ 
Sbjct  105  ETDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAERD  162

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASAD  129
                 G  ++    K+           F +   +  +   W+ +   A+  +   + S  
Sbjct  163  GSRTNGVLIRTTVNKV-----------FSIQTSSTIESDLWIRMISQAVANSTGLKTSLT  211

Query  130  QRATALLGHRAASGFLTSAPVQLRNVNKTKE  160
                   G   A    +S  ++ RN+N TK+
Sbjct  212  T------GSLLAQTVRSSGDLKTRNMNVTKQ  236

>SPRG_02753
Length=309

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 15/114 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V K+G +++SW++RYMVL    L  SYFD++ +  S   K KGSF +  IE      
Sbjct  7    QGWVFKQGSLVRSWKKRYMVLKNKQL--SYFDTENVTAS--TKAKGSFAVITIEY-----  57

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
                 K     L+ H  G G +   +Y E+A   T W +     +   V  QAS
Sbjct  58   ----AKDIQHGLLIH--GVGGRVMKLYTESADSCTGWFDAVTAVMLGQVLSQAS  105

 Score = 35.4 bits (80),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            C G++ K G  +K+W+RR+  L G +L  +Y+D+  +  S K
Sbjct  138  CSGWLAKEGGRVKNWKRRFFFLQGRSL--TYYDNDKMAGSAK  177

>PHALS_04098
Length=1183

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (49%), Gaps = 13/105 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG TL  +Y++SK   +S +   +G   + ++   +Y  
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSAR-NMRGRMTVYKVRPENYG-  130

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 K +GF L      H     C   E  KD   W+E+ H A+
Sbjct  131  -----KAHGFLL--ETQSHKQFHLCCATELEKD--MWVEMMHAAV  166

>CCA18875
Length=1514

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 51/98 (52%), Gaps = 18/98 (18%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+TKRGHV  +W+ R+ VL G+ L+  Y+ S+     +K K  GS ++A++    +S 
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSE-----EKTKRYGSVVVAKVAP--WSG  273

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G   Y  K +          + VY  +  ++ +WL
Sbjct  274  EAHGFMFYTTKQI---------PYYVYAASETEKAKWL  302

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            +C GY+TK+GH  KSW++RY +L G+   +SY+    +    K K      LAE++  D 
Sbjct  417  TCAGYLTKQGHKRKSWKKRYFILRGNI--ISYYQDYDLANHVKGK-----ALAEVQVEDV  469

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
                G    + F      P      + VY +  +++ +W+
Sbjct  470  QKWDGEAFGFMFMTTEQVP------YYVYADNERERKKWM  503

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 51/114 (45%), Gaps = 16/114 (14%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            + +CEGY+T+RGH++ S R  Y VL G  L+  Y D +    +D         +AE+E  
Sbjct  314  EVTCEGYLTRRGHLVPSQRVCYYVLSGTCLR-HYADQQAYRDNDS-------AMAEVEVR  365

Query  70   DYSDEGGGVKPYGFK-LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNV  122
              +     V    FK + G+        F    ET  ++ +W+    N L  NV
Sbjct  366  SIAAWDAEVNGLMFKTMTGNV-------FYASTETETERQRWVFNHTNTLTTNV  412

>PHALS_03645
Length=830

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY VL G     SY+ SK + K D  K +G
Sbjct  97   DIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSKDVAKMDTEKFRG  147

>SPRG_17022
Length=107

 Score = 47.4 bits (111),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (4%)

Query  7   DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
           D   T  EGY+ K+GHV+++WR RY VL G     +Y+ SK    +D  K KG
Sbjct  28  DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKG  78

>CCI10489
Length=777

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            +N    D  +T  EGY+ KRGHV++SWR R+ VL G  L  SY+ SK +   +  K +G
Sbjct  94   VNHTFEDMFKTDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVAMLNTEKYRG  150

>PYIR_22246
Length=559

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 62/123 (50%), Gaps = 18/123 (15%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  ++L++ YF S+  Y  +K   +G    + + K D        KP GF+  
Sbjct  43   WKKRYCVIYKESLQIVYFQSEADY--EKGTIRGKIPFSTVHKWD-------GKPNGFQF-  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRATALLGHRAASGFLT  146
             + P +  K F VY ETA++Q QWL     A+  + +P  SA    T++   R  +   T
Sbjct  93   -YTPSN--KCFRVYTETAEEQEQWLAAMQTAI--DNSPDKSA---VTSVPYQRPIASSPT  144

Query  147  SAP  149
            S+P
Sbjct  145  SSP  147

>H257_03093
Length=975

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 63/131 (48%), Gaps = 15/131 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY+VLDG +L  +Y++SK   ++     +G  I+ ++   +Y  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGT-NLRGRMIITKVLPENYG-  159

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRAT  133
                 K +GF +     GH +   C   E  KD   W+E+   A+ + V P       +T
Sbjct  160  -----KAHGFLI--ETMGHKHFHLCCTTELEKD--MWVEMMQAAIDEGV-PHPH-QLHST  208

Query  134  ALLGHRAASGF  144
              L H ++S F
Sbjct  209  PHLEHMSSSTF  219

>PYVX_18338
Length=746

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 2/55 (4%)

Query  5    LTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            + D  +T  EGY+ K+GHV++SWR RY VL G T   SY+ SK +   D  K +G
Sbjct  73   IEDAFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVATLDTEKYRG  125

>PYIR_13120
Length=814

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 2/53 (4%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKG  59
            D  +T  EGY+ K+GHV++SWR RY +L G T   SY+ SK +   D  K +G
Sbjct  100  DMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRG  150

>PITG_02109
Length=522

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +Y+D+  +  + KP  KGSF +  +E       
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLNPTVKP--KGSFQVITVELSPDIQN  193

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQ  125
            G         L+ H  G G + F +Y  +A+  + W  +  +A     APQ
Sbjct  194  G---------LLVH--GRGGRVFKLYTASAEATSAWYNMILDA--TTAAPQ  231

 Score = 39.3 bits (90),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 4/48 (8%)

Query  2    NLDLTDF--KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +L L+D   +Q +  G++ K G  +KSW+RRY VL G+ L  SYF+S+
Sbjct  266  SLPLSDSGSEQVTHFGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  311

>PYIW_21108
Length=2593

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 77/164 (47%), Gaps = 17/164 (10%)

Query  9     KQTSCEGYVTKRGHVMKS-WRRRYMVLDGDTLKVSYFDSKTIYKSDKPK---EKGSFILA  64
             K+   EGYV  R H + + WR R+ VL+G  L + Y DS      D+ +   EK   I  
Sbjct  2152  KRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDRERTALEKHDLIAV  2210

Query  65    EIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAP  124
             E     YS   G    +GF++   A   GY E C  V T  +QT+WL V  +A+  ++A 
Sbjct  2211  EKWHPTYSANLGSGSRFGFRVENEA--GGYLE-CT-VTTEDEQTKWLAVVSDAVS-DLAT  2265

Query  125   QASADQRATALLGHRAASGFLTSAPVQ--LRNVNKTKEELLRKA  166
              A+     + ++   A   F++ A ++  L+   K K  L  K+
Sbjct  2266  HAT-----SKMMARDAVLPFISGAAMEGYLKTKEKKKLALFWKS  2304

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 32/119 (27%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query  8     FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
              ++   EGY+ KRGH++ S R+RY VL  +   + YF +    ++   +  GSF + EI 
Sbjct  1228  LREALMEGYLVKRGHLIPSMRKRYCVLLKNA-SLEYFATHEDSRNPAIRPHGSFQV-EIV  1285

Query  68    KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQA  126
                +         +G +L       G   FC   + A+D+T W+    +A+    A  A
Sbjct  1286  SDWHGKTASKSYDHGMEL---ETSDGKTFFCAAYK-AEDKTAWMHAFKHAIALTRADHA  1340

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ KRG ++ + +RRY VL G T+   Y +     +   P++    +L  ++  D+  
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKG-TMLAYYTNEDECKRQATPRD----VLEVVQARDWDG  56

Query  74   EGGGVKPYGFKL-VGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
                 + Y     + +  G  Y+  C   ++ +D+  W++   +AL
Sbjct  57   ASALRQHYKHAFEIDYLGGATYQCHC---DSLEDKQLWMQAIQHAL  99

>SPRG_11900
Length=605

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (53%), Gaps = 22/131 (17%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G+V K+G ++KSW++R++V+ G    V+Y+D +++++ + P+EKGS +L ++ ++    
Sbjct  6    SGFVFKQGALIKSWKKRFLVVQGR--HVTYYD-RSVHEPN-PREKGSLVLVDVTQN----  57

Query  74   EGGGVKPYGFK--LVGH-APGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQ  130
                   +G K  LV H   G   K   +Y  +A D  +       A G N  P    D 
Sbjct  58   -------FGLKNGLVLHDVKGRQMK---MYTLSATDLDECFTALQAACGANARPSL-LDV  106

Query  131  RATALLGHRAA  141
            RA+++   RA+
Sbjct  107  RASSIASDRAS  117

 Score = 38.1 bits (87),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 24/32 (75%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            GY+ K+G  +K+WR+RY  +DG + ++SY D+
Sbjct  239  GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDA  270

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 15/72 (21%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             G++ K G  +++W+RR+ VL GD   V+YF      + + PK +G      ++ H    
Sbjct  143  RGWLYKEGQRVRNWKRRFFVLTGD--HVAYFAK----QGENPKGEGRVCGVSLDMH----  192

Query  74   EGGGVKPYGFKL  85
                 KP G  L
Sbjct  193  -----KPLGMLL  199

>PYAP_16161
Length=889

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 21/122 (17%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
            N D T  K    EGY+ K+G ++K W++R+ V DG TL  SY+ S+   +  KP      
Sbjct  22   NFDPTFMK----EGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSR---RDSKPS-----  67

Query  62   ILAEIEKHDYSDEGGGVKPYG---FKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            ++ E+ K+   ++GG  + +      L   A G  Y   C+  E  +  T+WL V  N +
Sbjct  68   VVMEL-KYCTVEDGGRSETWNSTRIHLTDSATGTLY---CLSSEDGQIATEWLTVLKNCI  123

Query  119  GK  120
            G+
Sbjct  124  GR  125

>CCI41225
Length=981

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 56/117 (48%), Gaps = 10/117 (9%)

Query  3    LDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            L+  D      EGYVTKRGH++++W+ R+  L+G+  ++SY++SK +    +   KG   
Sbjct  129  LESLDIPVVEWEGYVTKRGHLVRNWKMRFFTLEGN--RLSYYESK-VDAQQRAHLKGRVK  185

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +A +     S  G G   Y F     +   G K F   V T  +Q  W+      +G
Sbjct  186  VASVRIDQVSKWGSG---YEFTF---STTEG-KIFHCSVSTPLEQVLWVYFLEAGIG  235

>SPRG_08346
Length=797

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 50/112 (45%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D   T  EGY+ K+GHV+++WR RY VL G     +Y+ SK    +D  K KG   +   
Sbjct  28   DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGA  85

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K F +Y +T  +   W+ +   A+
Sbjct  86   KK-DPSRSNGFVVTTSID----------KLFTMYTKTPIETELWIRMIEKAV  126

>SDRG_05150
Length=787

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 50/112 (45%), Gaps = 13/112 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D   T  EGY+ K+GHV+++WR RY VL G     +Y+ SK    +D  K KG   +   
Sbjct  28   DIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASADLEKYKGRVTVTGA  85

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +K D S   G V                K F +Y +T  +   W+ +   A+
Sbjct  86   KK-DPSRSNGFVVTTSID----------KLFTMYTKTPIETELWIRMIEKAV  126

>PYIR_23372
Length=1415

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 62/118 (53%), Gaps = 19/118 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  +++SW+  Y VL+GDT+  +Y++S+  + S+      S ++  I+    
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDFISN------SKLMGRIQIQGV  373

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
             D+  G KP GF+++  GH   H      +   T  ++ QW      A+ K  AP++S
Sbjct  374  EDDNMG-KPNGFRVITEGHRTNH------LSSRTGFEKDQWKRAITVAITK--APESS  422

>SDRG_06288
Length=641

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 42/57 (74%), Gaps = 4/57 (7%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
             G+V K+G ++KSW++R++V+ G    VSY+D +++++ D P+EKGS +L ++ ++
Sbjct  5   WSGFVFKQGSLIKSWKKRFLVVQGR--HVSYYD-RSVHEPD-PREKGSLVLGDVTQN  57

 Score = 37.7 bits (86),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (63%), Gaps = 4/48 (8%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            G + K+G  +K+WR+RY  +DG + ++SY D++T    + PK  G  +
Sbjct  263  GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDAET----EPPKGYGKVV  306

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 35/71 (49%), Gaps = 15/71 (21%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K G  +++W+RRY VL GD   ++YF      + + PK +G  +   ++ H     
Sbjct  168  GWLYKEGQRVRNWKRRYFVLTGD--HIAYFAK----QGENPKGEGRVVSVILDLH-----  216

Query  75   GGGVKPYGFKL  85
                KP G  L
Sbjct  217  ----KPLGMLL  223

>CCA16487
Length=975

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 57/117 (49%), Gaps = 10/117 (9%)

Query  3    LDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            L+  D      EGYVTKRGH++++W+ R+  L+G+  ++SY+++K +    +   KG   
Sbjct  127  LESLDIPVVEWEGYVTKRGHLVRNWKMRFFTLEGN--RLSYYENK-VDAQQRAHLKGRVK  183

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
            +A +     S  G G   Y F     +   G K F   V T+ +Q  W+      +G
Sbjct  184  VASVRIDQVSKWGSG---YEFTF---STTEG-KTFHCSVSTSLEQLLWVYFLEAGIG  233

>PYU1_G012870
Length=352

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 19/98 (19%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF--ILAEIEKHDYS  72
            G+V K+G ++++W++R+MVL G  L  +Y+D+ +I  S K KEKGSF  I AE+     S
Sbjct  7    GWVFKQGSLVRNWKKRFMVLRGKQL--TYYDTASI--SPKTKEKGSFQVITAELS----S  58

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
            D   G       L+ H  G G +   +Y ++A+    W
Sbjct  59   DIQNG-------LLVH--GKGGRVLKLYTDSAESSRAW  87

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            +L L D       G++ K G  +K+W++RY  L G+TL  SY+DS
Sbjct  141  SLPLDDAGSIHHSGWLKKEGSRIKNWKKRYFTLHGNTL--SYYDS  183

>H310_00230
Length=1248

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 55/113 (49%), Gaps = 17/113 (15%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAE  65
            +  +  +C GY+TK+GH  KSW+RRY VL G  L  SY+   T Y+S   +      LAE
Sbjct  219  SSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYY---TDYESANKQ-----CLAE  268

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            +   D     G +  + F             + VY +T +++ +WL VA  AL
Sbjct  269  VGIEDVQVWDGEMHGFMFTTTEQV------MYYVYADTERERQKWL-VALKAL  314

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 6/60 (10%)

Query  13  CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
           C GY+TKRGHV+ +W+ R+ VL      +SY++ +++      K+ G   LA++   +Y+
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLRPHA-NLSYYEDESM-----SKKLGQVHLAKVAPWEYN  65

>PYAR_19914
Length=788

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SY+++K +   ++   KG   +  +
Sbjct  139  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK-VDARNRDHLKGRVNVVSV  195

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE-----VAHNALGKN  121
            +    S  G G   + F  V        K F   V T  ++  W+      V H+A  KN
Sbjct  196  KAEKVSKSGHGFD-FSFDTVEG------KTFHCSVPTETERLMWVYFLEAGVDHSATKKN  248

Query  122  VAP  124
              P
Sbjct  249  NKP  251

>PYVX_13574
Length=950

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY++SK +   ++   KG   +A +
Sbjct  152  DLPMVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYESK-VDARNRSHLKGRVNVASV  208

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  209  KIDKVAKSGQGFD-FSFETTEG------KVFHCSVPTQFDQLAWV  246

>H310_13627
Length=678

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 54/116 (47%), Gaps = 23/116 (20%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS---KTIYKSDKPKEK  58
            N+ L D +     G++ K+GH++K+W+RR+ VLDG  L+  YF      T+ KS   K K
Sbjct  257  NIGLDDTQLDRKSGWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLK  314

Query  59   GSFIL-----------AEIEKHDYS---DEGGGVKPYGFKLVGHAPGHGYKEFCVY  100
            G  +L             +   D++   D  GG    GF L+  A     +E  +Y
Sbjct  315  GEVLLFHKDTTVHYVDIHLSGRDFTFAIDTSGG----GFSLMLQASSLDEREDWIY  366

>PYAP_13695
Length=348

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G++ K+G ++K+W+RR+MVL G  L  +Y+D++ I  S + KEKGSF +  +E    SD 
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGKQL--TYYDTERI--SPRVKEKGSFQVITVELS--SDI  65

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
              G       L+ H  G G +   +Y ++  +   W     +A
Sbjct  66   QNG-------LIVH--GRGGRVLKLYTDSTDNTNGWYHAIMDA  99

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            Q    G++TK G  +K+W+RR+  L GDTL  SYFDS
Sbjct  151  QVQHSGWLTKEGMRVKNWKRRWFTLRGDTL--SYFDS  185

>PYAR_25500
Length=473

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (55%), Gaps = 9/99 (9%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            + EGY+ K+  V+  WR  Y VL+GDTL  +Y++S+  + S+  K  G   + ++   D 
Sbjct  60   AFEGYLHKKSEVLSHWRATYCVLEGDTL--AYYESREDFISNT-KLIGRIQVQDVGDDDQ  116

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW  110
            S   G  KP+GF+++      G++   +   TA ++ QW
Sbjct  117  SAPNG--KPHGFRIM----TEGHRAHHLSSRTAFEKDQW  149

>PHALS_06568
Length=388

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 55/111 (50%), Gaps = 17/111 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++KSW++RYMVL G  L  +Y+D+  + +  KPK     I  E+     +D 
Sbjct  12   GWVYKQGSIVKSWKKRYMVLSGRQL--TYYDTAKVDQKVKPKGSCQVITVELS----TDI  65

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQ  125
              G       L+ H  G G +   +Y  +A+  + W  +  +A     APQ
Sbjct  66   QNG-------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA--TKAAPQ  105

 Score = 40.4 bits (93),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +Q +  G++ K G  +KSWRRR+ VL G++L  SYF+S+
Sbjct  147  EQVTHSGWLKKEGARVKSWRRRFFVLRGNSL--SYFNSE  183

>PYIW_13172
Length=939

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SY++SK +   ++   KG   +A +
Sbjct  143  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK-VDARNRNHLKGRVNVASV  199

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  +Q  W+
Sbjct  200  KIEKVSKSGHGFD-FAFET---SEG---KVFHCSVPTQMEQLSWI  237

>PYIR_15309
Length=937

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SY++SK +   ++   KG   +A +
Sbjct  141  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK-VDARNRSHLKGRVNVASV  197

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  +Q  W+
Sbjct  198  KVEKVSKSGHGFD-FSFET---SEG---KVFHCSVPTQMEQLSWV  235

>PYU1_G001063
Length=783

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G  L  SY++SK +   ++   KG   +A +
Sbjct  140  DLPIVEWEGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESK-VDARNRSHLKGRVQVASV  196

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    S  G G   + F+    + G   K F   V T  DQ  W+
Sbjct  197  KLEKTSKSGHGFD-FSFET---SEG---KVFHCSVPTKFDQLTWV  234

>PYVX_13312
Length=1016

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 34/115 (30%), Positives = 54/115 (47%), Gaps = 13/115 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGYV K+G  +  W  RY++LDG  L  +Y++SK   +S +   +G   L+ +   +Y  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGR-NLRGRMQLSRVRPENYG-  131

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
                 K +GF +     GH     C   E  KD   W+E+   A+  + A   +A
Sbjct  132  -----KAHGFLI--ETRGHKSFHLCCTTELEKD--MWVEMMQAAIDDHDAAHGNA  177

>PYAR_14615
Length=517

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 59/134 (44%), Gaps = 17/134 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G   KSW+RR+ V DG TL  SY+ S+   K  KP        A I     + 
Sbjct  38   EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR---KDRKPN-------AIIPLESCTV  85

Query  74   EGGGV-KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQ--  130
            E GG+ + +    +    G     +C+  E  +  T WL V   A+ K +   A+  Q  
Sbjct  86   EDGGISETWNSPRIYLTDGTTGTMYCLSAEDGEVVTAWLNVLRTAIAKVLGGDAARSQGK  145

Query  131  --RATALLGHRAAS  142
               A   L  RA S
Sbjct  146  AKNAPPALKQRATS  159

>PITG_11303
Length=293

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            CEGY+TKRGHV  +W+ RY  L G+ L+  Y+ S+
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSE  246

>SDRG_01408
Length=916

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (48%), Gaps = 12/115 (10%)

Query  4    DLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFIL  63
            D+ + ++   EG+V K+G  +  W  RY+VLDG TL  +Y+  +   +S K   +G  +L
Sbjct  115  DIGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGK-NLRGRMVL  171

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              +   D+     G K +GF +     GH     C   E  KD   W+E+   AL
Sbjct  172  TYVGP-DFK----GKKAHGFMI--ETKGHKRFHLCCATELEKD--MWVEMMQTAL  217

>CCA17102
Length=884

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 57/125 (46%), Gaps = 17/125 (14%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYV KRGH++++W+ R+  L+G+  ++SY++SK   +  +   KG   LA +
Sbjct  103  DLPAVEWEGYVIKRGHLVRNWKMRFFTLEGN--RLSYYESKGDAQQ-RVHLKGRVKLASV  159

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL-------EVAHNALG  119
                 S  G G   + F+          K F   V T  DQ  W+       E A+   G
Sbjct  160  RIEAVSRLGNGFD-FTFETAES------KVFHCSVPTKLDQLLWIHFMETGAECANMRAG  212

Query  120  KNVAP  124
            + V P
Sbjct  213  RAVGP  217

>PHYKE_2479
Length=171

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (52%), Gaps = 10/102 (10%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            ++  EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A ++  
Sbjct  72   RSKWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASVKMD  128

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
              +  G G   + F+          K F   V T  DQ  W+
Sbjct  129  KVAKNGHGFD-FSFETTEG------KVFHCSVPTQFDQLAWV  163

>PPTG_13401
Length=927

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A +
Sbjct  102  DLPMVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  158

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  159  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQIAWV  196

>PHYCA_503112
Length=214

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A +
Sbjct  110  DLPIVEWEGYVTKRGHLVRNWKSRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  166

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  167  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQLAWV  204

>PYAR_18690
Length=2455

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 56/115 (49%), Gaps = 6/115 (5%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             EGY+ KRGH++ S R+RY VL  + L   Y   +    SD  +  GSF + EI    +  
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVLVKNVLTY-YLTQEDSRNSDTSQPLGSFRV-EIVSDWHGK  1195

Query  74    EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
                    +G +L  H    G   FC    +++++TQW+   H+ +  + A  A++
Sbjct  1196  TAMQTYEFGMELETH---DGKTFFCAAF-SSEEKTQWIRAFHHGIAISRAEAAAS  1246

>H257_06469
Length=76

 Score = 43.1 bits (100),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
           EGYV K+GHV+KSW+RRY  LD  T  + Y     I  +D
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEYLTELAIALAD  41

>HYAP_07348
Length=973

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 53/118 (45%), Gaps = 12/118 (10%)

Query  4    DLTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            +L DF  +   EG++ K+G  +K W+RR+ V DG TL  SY+ SK   K  KP       
Sbjct  29   NLPDFDASFMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISK---KDRKPNAVIPLE  83

Query  63   LAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
               +E    S+     + Y   L   A G  Y   C+  E     TQWL V   A+ +
Sbjct  84   GCSVEDGGLSETWNSPRIY---LTDPATGIMY---CLSAEEGTVVTQWLHVLRAAVAR  135

>SPRG_00889
Length=994

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (48%), Gaps = 12/115 (10%)

Query  4    DLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFIL  63
            DL + ++   EG+V K+G  +  W  RY+VLDG TL  +Y+  +   +S K   +G  +L
Sbjct  113  DLGNVQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGK-NLRGRMVL  169

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              +   D+  +    K +GF +     GH     C   E  KD   W+E+   AL
Sbjct  170  TYVGP-DFKSK----KAHGFMI--ETKGHKRFHLCCATELEKD--MWVEMMQTAL  215

>PYAP_22195
Length=901

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W+RR+ V +G TL  SY+ S+   K  KP          +E      
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR---KDRKPNAVIPLETCTVE------  86

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK--NVAPQASADQR  131
            +GG  + +    +    G     +C+  E A+    WL V  NA+ K     P   +D+ 
Sbjct  87   DGGLSETWNSPRIYLTDGTSGVMYCLSAEDAEVVNAWLTVLRNAVAKLGGRGPGTGSDKP  146

Query  132  ATALLGHRAAS  142
            A   L  +AAS
Sbjct  147  AP--LNDKAAS  155

>PYIR_13555
Length=355

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 4/53 (8%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
           G+V K+G ++++W++RYMVL G  L  +Y+D+ ++  + K KEKGSF +  +E
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQL--TYYDTASL--TAKTKEKGSFQVITVE  58

 Score = 37.0 bits (84),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            G++ K G  +KSW++RY  L G+TL  SY+DS
Sbjct  160  GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDS  189

>PYIR_17453
Length=2619

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query  13    CEGYVTKRGHVM-KSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAEIEK  68
             CEGYV  R H +  +WR R+ VL+ DT    Y D+       +  K  EK   I  +   
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLE-DTRLYLYPDTSAALSEGREQKALEKHDLIAVKKWH  2218

Query  69    HDYS-DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK---NVAP  124
               YS + G G   +GF++   A   GY E  V +E   +QT+WL    NA+ +   +V+ 
Sbjct  2219  PTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAVSEISTHVSS  2274

Query  125   QASADQRATALLGHRAASGFL  145
             +      A   +   A  G+L
Sbjct  2275  KVMTRDAALPFIPGAAMEGYL  2295

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  9     KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
             +Q   EGY+ KRGH++ S R+RY VL  +TL+  YF +    ++   +  GSF
Sbjct  1217  RQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPAIRPHGSF  1267

>PHALS_06533
Length=930

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A +
Sbjct  104  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VEARNRSHLKGRVNVASV  160

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  161  KVDKVAKNGHGFD-FSFETTEG------KVFHCSVPTHFDQLAWV  198

>PITG_18067
Length=924

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 52/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A +
Sbjct  102  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  158

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G   + F+          K F   V T  DQ  W+
Sbjct  159  KMDKVAKNGHGFD-FSFETTEG------KVFYCSVPTHFDQLAWV  196

>PHYRA_77834
Length=936

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 53/105 (50%), Gaps = 10/105 (10%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+   VSY+++K +   ++   KG   +A +
Sbjct  112  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNL--VSYYENK-VDARNRSHLKGRVNVASV  168

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +    +  G G + + F+          K F   V T  DQ  W+
Sbjct  169  KVDKVAKNGHGFE-FSFETTEG------KVFHCSVPTHFDQLAWV  206

>PYIW_17818
Length=1188

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 7/48 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            G++ K+G ++KSW+RRY VL+GD+L+  YFD+      DKP   G  +
Sbjct  505  GWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDN-----IDKPARGGGIV  545

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 29/49 (59%), Gaps = 8/49 (16%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
            C G++ K G  +K+W+RRY  L G TL+  YF      KS++ K  GS+
Sbjct  830  CSGWLNKEGGTIKTWKRRYFSLHGTTLR--YF------KSERKKLLGSY  870

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (48%), Gaps = 6/63 (10%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHD  70
            ++CEG++ K+G   K W+RRY  L  D L+  +         D P E    + A  + +D
Sbjct  343  STCEGWLLKQGRASKQWKRRYFSLAHDQLEYRH------TPEDFPNEDEVVVNAHFDNYD  396

Query  71   YSD  73
              D
Sbjct  397  QRD  399

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 31/54 (57%), Gaps = 9/54 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEK-GSFILAEIE  67
            G++ K G  +KSW++R+ VL G+ L        T Y+ ++   K G+ ++ ++E
Sbjct  179  GWLLKEGSKVKSWKKRFFVLRGNVL--------TYYEDERSSPKLGALVVRDVE  224

>PYVX_14527
Length=1269

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 60/118 (51%), Gaps = 19/118 (16%)

Query  15    GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
             G+V K+G ++++W++R+MVL G  L  +Y+D+  +  S   K KGSF L  +E       
Sbjct  903   GWVYKQGSLVRNWKKRFMVLHGRQL--TYYDTARLTPS--VKAKGSFTLITVELSTEIQN  958

Query  75    GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRA  132
             G         L+ H  G G +   +Y ++A+  + W    +N + +  A   + D+R+
Sbjct  959   G---------LLVH--GRGGRVLKLYTDSAESTSMW----YNRIMEATAAPGNVDRRS  1001

 Score = 38.9 bits (89),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  15    GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
             G++ K G  +KSW+RR+  L GD L  SYFDS+
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSE  1079

 Score = 32.3 bits (72),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +Q +  G+V K G +++SW++R++V  G  L  +Y+  K   + +  +  G+   A IE+
Sbjct  583  EQVTYAGWVFKEGSLVRSWKKRFLVAKGADL--AYY--KNTDRENHAQLLGALTAARIER  638

 Score = 31.6 bits (70),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            G++ K G   K+W++RY VL G+ L  S
Sbjct  714  GWLEKEGQHFKTWKKRYFVLRGNRLTYS  741

>PPTG_14630
Length=398

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 15/103 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +Y+D+  +  + KP  KGSF +  +E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDTSKLVPTVKP--KGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            G         L+ H  G G +   +Y  +A+  + W  +  +A
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA  99

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SYF+S+
Sbjct  149  EQVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  185

>CCI42457
Length=906

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 57/130 (44%), Gaps = 17/130 (13%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYV KRGH++++W+ R+  L+G+  +VSY++SK   +  +   KG   +  +
Sbjct  123  DLPAVEWEGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKGDAQ-QRVHLKGRVKVVSV  179

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQW-------LEVAHNALG  119
                 S  G G   + F+          K F   V T   Q  W       +E A+   G
Sbjct  180  RMETISKLGNGFD-FSFETAES------KVFHCSVPTKLSQLLWVHLLETGVECANMRAG  232

Query  120  KNVAPQASAD  129
            ++V P    D
Sbjct  233  RSVGPNLRHD  242

>H310_01921
Length=341

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 53/104 (51%), Gaps = 17/104 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE-KHDYSD  73
            G+V K+G ++KSW++RYMVL    L  +YF+S+ +      K KGSF +  +E  HD  +
Sbjct  24   GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKV--EGNSKAKGSFQVITVEIAHDIKN  79

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
                       L+ H  G G +   +Y +TA+   +W+     A
Sbjct  80   ----------GLLVH--GTGGRVMKLYTDTAEGCEEWINAIAQA  111

 Score = 37.0 bits (84),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTI  49
            C G++ K G  +K+W+RRY  L G +L  +YFD+  +
Sbjct  164  CFGWLAKEGGRVKNWKRRYFSLQGRSL--TYFDNANM  198

>PYAP_17290
Length=835

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (48%), Gaps = 15/123 (12%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
            D      EGYVTKRGH++++W+ R+  L+G+ L  SY+++K +   ++   KG   +A +
Sbjct  146  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENK-VDARNRDHLKGRVNVASV  202

Query  67   EKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE-----VAHNALGKN  121
            +    S  G G   + F+          K F   V T  +Q  W+      +  NA+ +N
Sbjct  203  KLDKVSKSGHG-HDFSFETTEG------KVFHCSVPTEMEQLAWVYFLEAGIDSNAMKRN  255

Query  122  VAP  124
              P
Sbjct  256  NKP  258

>PHYRA_82040
Length=1054

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 61/139 (44%), Gaps = 17/139 (12%)

Query  5    LTDFKQTSC-EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFIL  63
            L D+  T   EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP        
Sbjct  133  LADYDPTYMKEGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEG  187

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL-----  118
              ++    S+     + Y   L   A G  Y   C+  E     TQWL+V   A+     
Sbjct  188  CTVQDGGLSETWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVARANN  241

Query  119  GKNVAPQASADQRATALLG  137
            G  VA   +A   A+A  G
Sbjct  242  GTAVASDGTATSSASASRG  260

>CCI40991
Length=801

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 66/171 (39%), Gaps = 34/171 (20%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY-----------------FDSKTI  49
            D  +T  EGY+ K+GHV++SWR RY VL G     +                  + SK I
Sbjct  102  DLFETDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQSVITQLTGDCCVDYSSKEI  161

Query  50   YKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQ  109
              +D  + +G   +   E+ +    G         LV        K F +   +  +   
Sbjct  162  AMADTERYRGRVTVTGAERDESRTNG--------VLVSTTVN---KVFSIQTSSTIESDL  210

Query  110  WLEVAHNALGKNVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKE  160
            W+ +   A+        S  Q+ +   G   A    +S  ++ RN+N TK+
Sbjct  211  WIRMISQAVAN------STGQKTSLTSGSLLAQTVRSSGDLKTRNMNVTKQ  255

>H257_06721
Length=1238

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query  6    TDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAE  65
            +  +  +C GY+TK+GH  KSW++RY VL G  L  SY+   T Y S   +      LAE
Sbjct  225  SSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYY---TDYDSTNKQ-----CLAE  274

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            +   D     G +  + F             + VY E+ +++ +WL
Sbjct  275  VGIEDVQVWDGEMHGFMFTTSEQV------VYYVYAESERERQKWL  314

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 7/72 (10%)

Query  1   MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGS  60
           +  D +D ++  C GY+TKRGHV+ +W+ RY VL      +SY++ +++      K+ G 
Sbjct  3   LGFDYSD-EEILCRGYLTKRGHVVTNWKMRYFVLRPHA-SLSYYEDESM-----AKKLGQ  55

Query  61  FILAEIEKHDYS  72
             LA++   +Y+
Sbjct  56  VHLAKVAPWEYN  67

>PHYKE_9146
Length=557

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 46/92 (50%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L+++YF S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVVYKDELQITYFLSLEDF--EKRSIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +    F VY ETA+DQ +WLEV    L
Sbjct  92   -YTPSNTC--FRVYTETAEDQLKWLEVMQKVL  120

>PYVX_16714
Length=1030

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 48/107 (45%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG  L  SY+ S+   K  KP          ++    S+
Sbjct  160  EGFLQKKGQRLKGWKRRWFVCDGRAL--SYYISR---KDRKPNAVIPLEGCTVQDGGISE  214

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL V  NA+ +
Sbjct  215  TWNSPRIY---LTDGATGVMY---CLSAEDGTAVTQWLAVLRNAVAR  255

>PYIW_18491
Length=1684

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/101 (29%), Positives = 54/101 (53%), Gaps = 17/101 (17%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  ++++W+  Y VL+GDT+  +Y++S+  + S+      S ++  I+    
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDFISN------SKLIGRIQIQGV  358

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQW  110
             D+  G KP GF+++  GH   H      +   T  ++ QW
Sbjct  359  EDDNMG-KPNGFRIITEGHRTNH------LSSRTGFEKDQW  392

>PHYSO_478611
Length=522

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 66/138 (48%), Gaps = 22/138 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +Y+D+  +  +   K KGSF +  +E       
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVDPTV--KAKGSFQVITVELSTDIQN  196

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRATA  134
            G         L+ H  G G +   +Y  +A+  + W  +  +A      PQ +   R + 
Sbjct  197  G---------LLVH--GRGGRVLKLYTASAEATSSWYNMILDATA-TAPPQFAPPDRFST  244

Query  135  LLGHRAASGFLTSAPVQL  152
            L    AAS   TS PV +
Sbjct  245  L---SAAS---TSKPVDV  256

 Score = 39.7 bits (91),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SYF+S+
Sbjct  277  EQVAHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  313

>PYU1_G009508
Length=328

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (72%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            GY+ K+G   K+WRRRY +L  DT  +SY+DS
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>PYIR_23012
Length=965

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 50/107 (47%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W+RR+ V D  TL  SY+ ++   K  KP       +  +E     D
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCDARTL--SYYINR---KDRKPNA-----VIPLEGCTVQD  87

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
             GG  + +    +    G     +C+  E  +  TQWL V  NA+ K
Sbjct  88   -GGLSETWNSPRIYLTDGTSGVMYCLSAEDGEAVTQWLLVLRNAVTK  133

>H310_05457
Length=269

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (48%), Gaps = 21/105 (20%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +Q   +G+V KRG  ++SW+RR+ +L  + L  SY+D   I    +P++ G  +L     
Sbjct  177  RQDVMKGWVEKRGSRIRSWKRRFFILRENLL--SYYD---INLEGQPQKGGDVVL-----  226

Query  69   HDYSDEGGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
               S E   VKP G  FK+         +    + E A D  +WL
Sbjct  227  ---SIENSTVKPNGLEFKMTNG------RSLVGFTEEADDHARWL  262

>PHYSO_350197
Length=557

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 45/92 (49%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L++ YF S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDF--EKRAIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +    F VY ET +DQ +WLEV   AL
Sbjct  92   -YTPSNNC--FRVYTETPEDQLKWLEVMQKAL  120

>PYU1_G009249
Length=2580

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 75/164 (46%), Gaps = 28/164 (17%)

Query  15    GYVTKRGHVMKS-WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHD---  70
             GYV  R H + + WR R+MVL G +  + Y DS    + D+  E+       +EKH+   
Sbjct  2101  GYVRVRHHFLGAIWRERFMVLHGTSAYL-YPDSSAATEDDEQLERKK----ALEKHNLVA  2155

Query  71    -----------YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                        +         YGF++   A   GY E C+ V T ++QTQW++   +A  
Sbjct  2156  IAKWHPTYVSTFGSAHSSSNRYGFRVENEA--GGYLE-CI-VATEQEQTQWMKTISDA--  2209

Query  120   KNVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELL  163
               V   +++ Q A+ ++   AA  F+  A ++     K K+ LL
Sbjct  2210  --VTALSASSQLASNVMLRDAALPFIPGAAMEGYLKMKEKKSLL  2251

 Score = 38.1 bits (87),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 52/114 (46%), Gaps = 23/114 (20%)

Query  7     DFKQTSCEGYVTKRGHVMKSWRRRYMVL--DGDTLKVSYFDSKTIYKSDKPKEKGSFILA  64
             D +Q   EGY+ KRGH++ S R+RY VL   G+TL+  Y+ +    ++      GSF + 
Sbjct  1172  DDRQILLEGYLVKRGHLIPSMRKRYCVLLKRGNTLE--YYATHEDSRNPSVAPHGSFRVD  1229

Query  65    EIEKHDYSDEGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWL  111
              +     SD  G       K V     HG        K F     +A+++ +W+
Sbjct  1230  TV-----SDWHG-------KTVAQVYAHGMELETLDGKTFFCAAYSAEEKHKWM  1271

>PHYRA_79348
Length=1240

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 19/121 (16%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DTL  +++D++  + S+      + ++  I+ 
Sbjct  263  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYDTREDFISN------TKLIGRIQL  314

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQA  126
                DE  G KP GF+L+  G+   H      +   TA ++ QW      A+ K  AP+ 
Sbjct  315  QGIEDEDMG-KPNGFRLIAEGNHINH------LSSRTAFEKEQWKRAISIAISK--APEV  365

Query  127  S  127
            +
Sbjct  366  T  366

>H310_06666
Length=887

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 49/105 (47%), Gaps = 11/105 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SY+ SK         EK    +  +E     D
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKL--------EKKPNAVIPLESATVQD  73

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             GG  + +    +    G     +C+  +     +QWLEV   A+
Sbjct  74   -GGTSETWNSPRIYLTDGTSGTMYCLSGDEGDVVSQWLEVLDRAV  117

>PYAR_16228
Length=862

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 59/122 (48%), Gaps = 21/122 (17%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
            N D T  K    EG + K+G ++K W++R+ V DG TL  SY+ ++        +E    
Sbjct  22   NFDPTFMK----EGPLQKKGQMLKGWKQRWFVCDGRTL--SYYSNR--------RESRPS  67

Query  62   ILAEIEKHDYSDEGGGVKPYGFK---LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
            ++ E+ K+   ++GG  + +  K   L  +A G  Y   C+  E  K  + WL V  N +
Sbjct  68   VVVEL-KYCTVEDGGRSETWNSKRIHLTDNATGTLY---CLTSEDGKIASDWLAVFRNCI  123

Query  119  GK  120
             +
Sbjct  124  AR  125

>PYIW_20891
Length=291

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 38/53 (72%), Gaps = 4/53 (8%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
           G+V K+G ++++W++R++VL G  L  +Y+D+ ++  + K KEKGSF +  +E
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGKQL--TYYDTASL--TPKTKEKGSFQVITVE  57

 Score = 37.0 bits (84),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (72%), Gaps = 2/32 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            G++ K G  +K+W++RY  L G+TL  SYFDS
Sbjct  97   GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDS  126

>PITG_10462
Length=1028

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP          ++    S+
Sbjct  118  EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  172

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  173  TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  213

>CCI45127
Length=202

 Score = 42.7 bits (99),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 95/190 (50%), Gaps = 3/190 (2%)

Query  146  TSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEMGHNAEMLDIAEANMDYVGTEL  205
            T++  Q++ +   K + + +A+  +E A++ G     E+    E L   E N+  + ++L
Sbjct  15   TTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDL  74

Query  206  DRGDNIIKKMTspffyyfssskskkkgagspksksaRSHLPQTPMNSPTNkkpsgptskt  265
            +  + +IK +  P  Y+FS +   +K A S  + + RSH  QT +    + + +    + 
Sbjct  75   NHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGI---LHMRKNDGKIEH  131

Query  266  ggpttDAGDDELDQLSKILASLEVHANTISTEVERTTEQIDRIQKKMVEADERVVEQSAK  325
                     ++L++L+  L  LEV A  I++E  ++ +QI RI+ ++   ++R+  Q+ +
Sbjct  132  VAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQ  191

Query  326  VHAIQQKNKL  335
            V A   K  L
Sbjct  192  VVASSGKKNL  201

>PYU1_G012859
Length=1183

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 33/49 (67%), Gaps = 7/49 (14%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFIL  63
            G++ K+GH+++SW++RY VL GD+L+  YF++      DKP   G  ++
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN-----IDKPPRGGGIVV  538

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  10   QTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT  48
            Q++C G++ K+G  +K+W+RRY  L G TL+  YF  +T
Sbjct  808  QSNCHGWLNKQGGTIKTWKRRYFSLHGTTLR--YFKRET  844

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +CEG++ K+GH  K W+RRY  L+ D L+
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 6/54 (11%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
            +G++ K G  MK+W++R++VL G+ L  SY+  +T   S  P   GS ++ ++E
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYYADET--PSSPP--LGSLVIRQVE  244

 Score = 32.0 bits (71),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
            EG++ K+G   K+W++RY VL+   L   Y+D
Sbjct  613  EGWLLKKGQNFKTWKQRYFVLERSRLM--YYD  642

>SDRG_14286
Length=670

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 71/166 (43%), Gaps = 15/166 (9%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH-DYSD  73
            G++ K GH  K+W+ R+ VLDG  L+   + +  + K+  PK KG  +L   +    Y+D
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ---YYTDDVSKAKTPKLKGEVLLFHKDTTVHYAD  333

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQA----SAD  129
            E    + + F +       G     +   +  D+  W+    +A+    +  A    +AD
Sbjct  334  EPATGRAFCFAIDA-----GAYSLLLQAPSELDREAWIYAIEDAILCRDSYCALDDQAAD  388

Query  130  QRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
             R + ++  R+ S   TS    +  V       L  AIV L H  T
Sbjct  389  DRRSEVMRRRSLSA--TSVTASMGGVQDDDMHALYDAIVGLYHDAT  432

>PHYCA_564296
Length=957

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>PHYCA_504801
Length=398

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 56/114 (49%), Gaps = 17/114 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++K+W++R+MVL G  L  +Y+D+  +  +   K KGSF +  +E       
Sbjct  12   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKVNPTT--KAKGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
            G         L+ H  G G +   +Y  +A+  + W  +  +A     APQ  A
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWYNMILDA--TTAAPQQFA  108

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +Q +  G++ K G  +KSW+RRY VL G+ L  SYF+S+
Sbjct  150  EQVTHSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE  186

>H310_00209
Length=1198

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (50%), Gaps = 14/113 (12%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67
            F   + EGY++K+G ++ +W+  Y VL+G TL +  +DS+  + +D    K   IL    
Sbjct  255  FGGIAFEGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADA-GLKVRVILV---  308

Query  68   KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
              D +D+    +P+GF +       G+K   +   TA +Q QW+      L K
Sbjct  309  --DVNDDVA--RPHGFAI----KTEGHKTLHLASRTAFEQEQWVRAIRLQLTK  353

>PHYSO_558498
Length=967

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>PYVX_13084
Length=1267

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 42/176 (24%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GY+ K+G   K+WRRRY VL  D   +SYF SK     D   + G   +         DE
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSK-----DDLMKLGEIAI---------DE  287

Query  75   GGGVKPYGFKLVGHAPGHGY----------KEFCVYVETAKDQT--QWLEVAHNALGKNV  122
               V+P        AP  G+          ++  +  ET ++++   W++     +G  +
Sbjct  288  STTVEP--------APKDGFPNRFIVEHKGRKLVLLAETTENESMESWVKC----IGSCI  335

Query  123  APQASADQRATALLGHRAASGFLTSAPVQLRNVNKTK--EELL--RKAIVTLEHAR  174
              + +  +RA+    +R + G   S   Q+R        EELL  R +I  +E++R
Sbjct  336  EFRKTLAKRASGSFDNRRSGGSGDSFRSQMRLSENASMVEELLNDRASIPRMENSR  391

>H257_03363
Length=316

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 17/98 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE-KHDYSD  73
            G+V K+G ++KSW++RYMVL    L  +YF+++ I      K KGSF +  IE  HD  +
Sbjct  8    GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKI--EGNSKAKGSFQVITIEIAHDIKN  63

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
                       L+ H  G G +   +Y ++A+    W+
Sbjct  64   ----------GLLVH--GTGGRVMKLYTDSAESCEDWI  89

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 26/42 (62%), Gaps = 2/42 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            C G++ K G  +++W+RRY  L G +L  +YFD+  +  + K
Sbjct  147  CTGWLAKEGGRVRNWKRRYFSLQGRSL--TYFDNANMIGAAK  186

>PHYKE_1044
Length=521

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>H257_08182
Length=859

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 35/55 (64%), Gaps = 4/55 (7%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
           G++ K+G  +K+W++RYMVL G    V+Y+D   +     P EKG+ +L ++ ++
Sbjct  10  GWIYKQGSRVKTWKKRYMVLQGR--HVTYYDKSVL--EPNPTEKGALVLVDVTQN  60

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 4/35 (11%)

Query  9    KQTSC----EGYVTKRGHVMKSWRRRYMVLDGDTL  39
            ++TSC    EG++ K+G  +KSW+RRY V+ G  L
Sbjct  655  RRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL  689

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (58%), Gaps = 4/38 (11%)

Query  11   TSC---EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
            TSC    G++ K G  +KSW+RRY  L G  L V Y D
Sbjct  437  TSCAHHRGWLQKEGLAIKSWKRRYFTLHGRML-VYYKD  473

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTL  39
            G++ K G  +++W+RRY VL GD L
Sbjct  234  GWLYKEGQHVRNWKRRYFVLTGDHL  258

>PPTG_08785
Length=944

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  KP          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRKPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLRVAVAR  133

>PYU1_G012274
Length=873

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 61/118 (52%), Gaps = 19/118 (16%)

Query  12   SCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            S EGY+ K+  +++SW+  Y VL+G+T+  +Y++S+  +  +      + ++  I     
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMN------TKLIGRIHIQSV  361

Query  72   SDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQAS  127
             D+  G KP GF+++  GH   H      +   TA ++ QW      A+ K  AP+A+
Sbjct  362  EDDHMG-KPNGFRILTEGHRTNH------LSSRTAFEKDQWKRAITAAITK--APEAA  410

>PYIR_21831
Length=154

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 2/42 (5%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKP  55
            EG++TK+GHVM++ + RY VL   TL  SYF +K   K  KP
Sbjct  68   EGFLTKKGHVMRTQKERYFVLRQHTL--SYFRAKWSEKKSKP  107

>PPTG_06823
Length=1321

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 19/121 (16%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY++K+  V+ SW+  Y VL+ DTL  ++++++  + S+      S ++  I+ 
Sbjct  244  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQL  295

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQA  126
                DE  G KP GF+++  G+   H      +   TA ++ QW      A+ K  AP+ 
Sbjct  296  QGIEDEDMG-KPNGFRVIAEGNHVNH------LSSRTAFEKEQWKRAISIAISK--APEV  346

Query  127  S  127
            +
Sbjct  347  T  347

>PHALS_09729
Length=949

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 49/107 (46%), Gaps = 11/107 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EG++ K+G  +K W+RR+ V DG TL  SY+ S+   K  +P          ++    S+
Sbjct  38   EGFLQKKGQRLKGWKRRWFVCDGRTL--SYYISR---KDRRPNAVIPLEGCTVQDGGLSE  92

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                 + Y   L   A G  Y   C+  E     TQWL+V   A+ +
Sbjct  93   TWNSPRIY---LTDPATGIMY---CLSAEEGIVVTQWLDVLQVAVAR  133

>PHYRA_73430
Length=395

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 55/111 (50%), Gaps = 17/111 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G+V K+G ++++W++R+MVL G  L  +Y+D+  +      K KGSF +  +E       
Sbjct  12   GWVFKQGSLVRNWKKRFMVLRGRQL--TYYDTAKV--DPTVKAKGSFQVITVELSTDIQN  67

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQ  125
            G         L+ H  G G +   +Y  +A+  + W  +  +A   + APQ
Sbjct  68   G---------LLVH--GRGGRVLKLYTASAEATSAWFNMILDA--TSAAPQ  105

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 32/48 (67%), Gaps = 4/48 (8%)

Query  2    NLDLTD--FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            +L L+D   +Q +  G++ K G  +KSW+RRY VL G+ L  SYF+S+
Sbjct  137  SLPLSDDGSEQVTHSGWIKKEGARVKSWKRRYFVLRGNAL--SYFNSE  182

>SPRG_09128
Length=620

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (45%), Gaps = 9/119 (8%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH-DYSD  73
            G++ K GH  KSW+ R+ VLDG  L+   + +  + K   PK KG  +L   +    Y+D
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ---YYTDDVSKVKTPKLKGEVLLFHKDTTVHYAD  324

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRA  132
            E    + + F +       G     +   + +D+  W+    +A+    +  A  DQ A
Sbjct  325  EPAAGRAFCFAIDA-----GAYSLLLQAASERDREAWIYAIEDAILCRDSYSALDDQAA  378

>PITG_20103
Length=1301

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 45/79 (57%), Gaps = 9/79 (11%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY++K+  V+ SW+  Y VL+ DTL  ++++++  + S+      S ++  I+ 
Sbjct  221  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQL  272

Query  69   HDYSDEGGGVKPYGFKLVG  87
                DE  G KP GF+++ 
Sbjct  273  QSIEDEDMG-KPNGFRVIA  290

>H310_08803
Length=916

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 4/52 (8%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI  66
           G+V K+G  +K+W++RYMVL G    ++Y+D   +     P EKG+ +L ++
Sbjct  10  GWVYKQGSRVKTWKKRYMVLQGR--HITYYDKSVL--EPNPIEKGALVLVDV  57

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTL  39
            EG++ K G  MK+W+RRY +L G  L
Sbjct  688  EGWMLKEGSKMKNWKRRYFILKGTEL  713

 Score = 32.7 bits (73),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVL  34
            K TS  G++ K G  +KSW+RRY  L
Sbjct  451  KHTSHSGWLQKEGKSIKSWKRRYFTL  476

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTL  39
            G++ K G  +++W+RRY VL GD L
Sbjct  240  GWLHKEGQHVRNWKRRYFVLTGDHL  264

>PHYCA_529660
Length=345

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (44%), Gaps = 26/128 (20%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD-------  53
            MN+   D K +   G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD       
Sbjct  86   MNIPTQDLKGSVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASDVLGGGTQ  143

Query  54   --KPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQT--Q  109
                  +G   +A++E  D +        +G K+        Y    +YV+    ++  Q
Sbjct  144  CLDLPVRGGLRVAKVELSDMTS-------FGLKIT------SYSGRVLYVQAGDQESREQ  190

Query  110  WLEVAHNA  117
            WL+V   A
Sbjct  191  WLKVLKEA  198

>PHALS_12503
Length=340

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
            MN+   D K +   G++ KRGH  K+W++R+ +L+G  + ++Y+    +  SD
Sbjct  87   MNIPTQDLKGSVFYGWLWKRGHSFKTWKKRFFLLNG--VALTYYKQCCVIASD  137

>PYIR_15118
Length=1222

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            GY+ K+G   K+WRRRY +L  D   +SY+DS
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>PYIW_18911
Length=1196

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            GY+ K+G   K+WRRRY +L  D   +SY+DS
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>H310_06667
Length=896

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 60/130 (46%), Gaps = 15/130 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK-PKEKGSFILAEIEKHDYS  72
            EGY+ K+G ++K W++R+ V DG +L  SYF +    K+DK P        A ++    S
Sbjct  37   EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHT----KADKTPSAVIPLETATVQGGGTS  90

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQRA  132
            +   G K     +     G  Y   C+  E      QWL+V  +A+      +A+ D   
Sbjct  91   ERWNGPK---INVTDTVSGVVY---CLSGEDGATVMQWLDVLQHAVQHISNTKAATD--C  142

Query  133  TALLGHRAAS  142
            T  L H++ S
Sbjct  143  TTPLRHKSHS  152

>PHYSO_343629
Length=977

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  7    DFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSY  43
            D      EGYVTKRGH++++W+ R+  L+G+ +  ++
Sbjct  123  DLPIVEWEGYVTKRGHLVRNWKMRFFTLEGNLVSCTW  159

>H257_01309
Length=895

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK-PKEKGSFILAEIEKHDYS  72
            EGY+ K+G ++K W++R+ V DG TL  SYF +      DK P        A ++    S
Sbjct  48   EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHTNL----DKTPSAIIPLETATVQDGGTS  101

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            +   G + Y    +          +CV  E +    QWL +   A+ +
Sbjct  102  ERWNGPRIYVTDTISGV------VYCVSGEDSTSVLQWLVILQRAVQR  143

>SDRG_02135
Length=306

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 25/33 (76%), Gaps = 2/33 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
           EGY+ K+GHV+K+WRRRY  L   +L  +Y+DS
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>PYIW_21526
Length=963

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 49/111 (44%), Gaps = 13/111 (12%)

Query  12   SC--EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKH  69
            SC  EGY+ K+G  +K W+RR+ V D  TL  +Y+ ++   K  KP          ++  
Sbjct  34   SCMKEGYLQKKGQRLKGWKRRWFVCDARTL--AYYINR---KDRKPNAVIPLEGCTVQDG  88

Query  70   DYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
              S+     + Y   L   A G  Y   C+  E  +   QWL V  NA  K
Sbjct  89   GLSETWNSPRIY---LTDAASGVMY---CLSAEDGEAVAQWLTVLRNAATK  133

>PYIR_16780
Length=1352

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query  14   EGYVTKRGHVMK--SWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILA----EIE  67
            EG++ K G   +  SW++R+ V+D  T  +SY D  T  +   P    S + A    EI 
Sbjct  641  EGWLQKVGFSARFTSWKKRWFVVDQSTCTLSYADDPTAPRKIIPLRYCSIMPADEMNEIS  700

Query  68   KHDYSDEGGG--VKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
             H   ++G    V+ + FK+    P +  +++ +  ET +++ +W+   H
Sbjct  701  THAPVNKGTRKLVQSWCFKV---RPQNSSRDYIMRAETKQEREEWMLAIH  747

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 16/110 (15%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK------TIYKSDKPK-EKGSFIL  63
            T   G++ K+G   +S++RRYM L+G  L  SY+  K       + + DK   E+G+  L
Sbjct  158  TFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKPEKHGIPLSREDKKAYERGNIDL  215

Query  64   AEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
              +      +     +PYG  LV  A     + + +  E+ +D  +WL+V
Sbjct  216  ERVSSLQPMESKS--EPYGIHLVTTA-----RTWVIAAESEQDYHRWLKV  258

>HYAP_13688
Length=1036

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 55/132 (42%), Gaps = 20/132 (15%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHD--  70
            CEG+V K G   K W++RYM L    L+         Y+   P E+   + AE+   D  
Sbjct  244  CEGWVEKLGQRSKVWKKRYMSLASGMLE---------YRKG-PIEQ---LSAELCVTDVR  290

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQ  130
            YS         GF         G    CV  E+ +D  +W+    +A+GK   PQA    
Sbjct  291  YSSRYSNALVIGFGSSKSPSDRG--TICVRTESTRDLDEWMRALCDAVGK---PQAEGFS  345

Query  131  RATALLGHRAAS  142
            R ++ L  +  S
Sbjct  346  RQSSSLARKRGS  357

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 35/69 (51%), Gaps = 5/69 (7%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS-D  73
           G+  KRG  ++SW+ RY VL G  L V Y  +K+    D   E+G   +  +   DYS D
Sbjct  10  GWGAKRGSKVRSWKNRYFVLRGREL-VYYSGAKSDGSGDGVDERGRLKVVNV---DYSPD  65

Query  74  EGGGVKPYG  82
              G+  YG
Sbjct  66  RKNGLLIYG  74

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYF  44
            C G++ K G  +KSW+RRY  L G   K+SY+
Sbjct  698  CVGWLRKEGGNVKSWKRRYFTLYG--AKLSYY  727

 Score = 31.6 bits (70),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%)

Query  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            +   S  G++ K+G   K+W+RRY VL+   L  S
Sbjct  502  YDDNSFCGWLLKKGQNFKTWKRRYFVLERSRLAYS  536

>CCI43456
Length=126

 Score = 39.7 bits (91),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 6/54 (11%)

Query  2   NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKP  55
           NL +   +  + EG +TKR   MK WR+RY +L G+ L   YF SK+  K+D P
Sbjct  9   NLSIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL---YF-SKS--KNDAP  56

>H257_16349
Length=262

 Score = 41.2 bits (95),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 21/100 (21%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +G+V KRG   +SW+RR+ VL  + L  +Y+D   I    +P++ G  +L        S 
Sbjct  175  KGWVEKRGSRFRSWKRRFFVLRDNIL--AYYD---INLEGQPQKGGDVVL--------SI  221

Query  74   EGGGVKPYG--FKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E   VKP G  FK+         +    + E A D  +WL
Sbjct  222  ENSTVKPNGLEFKMSSG------RTLVGFTEEANDHARWL  255

>PYU1_G011261
Length=1328

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 53/120 (44%), Gaps = 31/120 (26%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            + T   G++ K+G   +S++RRYM L+G  L          Y   KP++K    L+  EK
Sbjct  163  ESTFISGFLRKKGEKNRSFKRRYMELNGTVLS---------YYKKKPEKKSGIPLSAAEK  213

Query  69   HDYSDEGGGV---------------KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
              Y  E G +               +P+G  LV  A     + + +  E+ +D  +WL+V
Sbjct  214  KAY--ERGSIDLDRVSSLQPMENKSEPFGIHLVTTA-----RTWVIAAESDQDYQRWLKV  266

>PYIW_19873
Length=185

 Score = 40.4 bits (93),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKE-----KGSFILAE---  65
            EG++ K+GHV+++ + RY VL   TL  SYF +K   K  KP       KG   LA    
Sbjct  56   EGFLVKKGHVLRTQKERYFVLRAHTL--SYFRAKWGEKKGKPAMLPSSLKGVLELAPSDI  113

Query  66   IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNA  117
            +    +SD+      +  + +  A G  YK   + V  A+++ +W++    A
Sbjct  114  VTPAPHSDQW-----FRIQKLPDAGGKSYK-LDLKVANAEERQEWIDAIRGA  159

>SPRG_01860
Length=674

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 52/125 (42%), Gaps = 27/125 (22%)

Query  2    NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
            N D T  K    EGY+ K+G ++K W++R+ V DG +L  SY      Y S K K+  + 
Sbjct  15   NYDPTYMK----EGYLQKKGQLLKGWKKRWFVCDGRSL--SY------YISSKDKKPNAV  62

Query  62   ILAEIEKHDYSDEGGGVKPYGFKLVGHAP------GHGYKEFCVYVETAKDQTQWLEVAH  115
            I           E   V+  G     H+P      G     +C+  E     + WL V  
Sbjct  63   I---------PLESASVQDGGLSETWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLT  113

Query  116  NALGK  120
             A+ +
Sbjct  114  KAVAR  118

>PYVX_13261
Length=1382

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query  14   EGYVTKRGHV--MKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
            EG++ K G+   +  WR+R+ VLD  T  +SY D +T  +   P    S ++A+     Y
Sbjct  666  EGWLHKVGNFSSLTRWRKRWFVLDQSTCTLSYADDETSPRKLIPLRNCSVLIADTMNQKY  725

Query  72   SDE--GGGVK----PYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
            +      G +     + FK+    P    +++ +  ET +++ +W+   H
Sbjct  726  TTAPVNKGTRKERQTWCFKV---RPQSSSRDYIISAETKQEREEWMFAIH  772

>HYAP_11712
Length=558

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (48%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  + L++ YF S   +  ++   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDF--ERRTIRGKIPFSSVHAWD-------GKPNGFQFY  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              A  H ++   VY ETA DQ +WLEV    +
Sbjct  93   TPA-DHCFR---VYTETAADQLKWLEVMQKCI  120

>PHYKE_4911
Length=46

 Score = 37.0 bits (84),  Expect = 0.006, Method: Composition-based stats.
 Identities = 15/37 (41%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYK  51
           G+V K+G ++K+W++R+MVL G  L  +Y+D+  + K
Sbjct  9   GWVYKQGSLVKNWKKRFMVLRGRQL--TYYDTAKMMK  43

>H257_01308
Length=897

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 49/105 (47%), Gaps = 11/105 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SY+ +K         EK    +  +E     D
Sbjct  24   EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTKL--------EKKPNAVIPLESATVQD  73

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             GG  + +    +    G     +C+  +     +QWL+V   A+
Sbjct  74   -GGTSETWNSPRIYLTDGTSGTMYCLSGDEGDVVSQWLDVLDRAV  117

>PHALS_06636
Length=2386

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 52/120 (43%), Gaps = 7/120 (6%)

Query  2     NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLK--VSYFDSKTIYKSDKPKEKG  59
             +LD+        EGY+ KRGH + S R+RY VL  + L   V++ DSK           G
Sbjct  1085  SLDVPSDANILMEGYLMKRGHKIPSMRKRYCVLVRNELSYYVTHDDSKNPNSGATTNRLG  1144

Query  60    SFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
              F +  +     SD  G    + +K          K F     +AKD+ +W++  H+ + 
Sbjct  1145  FFHVDIV-----SDWHGKTSTHTYKHAMELETKDGKTFFCAASSAKDKQKWIDAFHHGIA  1199

>H257_09823
Length=654

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (58%), Gaps = 5/52 (10%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD---SKTIYKSDKPKEKGSFIL  63
            G++ K GHV K+W+RR+ VLDG  L+  YF      T  KS   K KG  +L
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLL  314

>PYU1_G003229
Length=810

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 25/31 (81%), Gaps = 2/31 (6%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFD  45
            G++ K+GH MKSW+RR+ V++G T  ++YF+
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  9   KQTSCE--GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT  48
           K T C+  G+ +K+G ++KSW+RRY VL G  L   YF  ++
Sbjct  23  KSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERS  62

 Score = 37.7 bits (86),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 28/59 (47%), Gaps = 15/59 (25%)

Query  3    LDLTDFKQTS-------CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK  54
            L   DF + S       C G++ K G  +K+W+ RY  L G TL        T +KSDK
Sbjct  685  LPYMDFSRASLDDSLPGCSGWLRKEGSTVKNWKLRYFTLKGTTL--------TYFKSDK  735

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 7/56 (13%)

Query  8    FKQTS-CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
            F +T+ CEG++ KRG    +W++R+  L+G   ++ Y DS      + PK +GS +
Sbjct  254  FNETNMCEGWLYKRGQRSTAWKKRFFTLNG--FQLQYQDS----PGENPKGEGSVV  303

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVS  42
            +G++ K+G   K+W+RRY VLDG  L  S
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKLSYS  548

 Score = 32.3 bits (72),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +G++ K G   K+W++R+M L+G  +K
Sbjct  147  QGWLFKEGQNFKTWKKRFMTLEGRVIK  173

>SDRG_08236
Length=864

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 23/113 (20%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++K W++R+ V DG +L  SY      Y S K K+  + I           
Sbjct  23   EGYLQKKGQLLKGWKKRWFVCDGRSL--SY------YISSKDKKPNAVI---------PL  65

Query  74   EGGGVKPYGFKLVGHAP------GHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            E   V+  G     H+P      G     +C+  E     + WL V   A+ +
Sbjct  66   ESASVQDGGLSETWHSPRIYLTDGTSGTMYCLSAEEKGVASDWLSVLTKAVAR  118

>CCA25510
Length=1139

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            GY+ K+G   KSWRRRY +L  D   ++Y+ SK
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  229

>HYAP_13757
Length=262

 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 58/141 (41%), Gaps = 32/141 (23%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD-------  53
            M + + D K     G++ KRGH  K+W++R+ +L+G  L  +Y+    +   D       
Sbjct  1    MKIPMQDLKGAVFYGWLWKRGHTFKTWKKRFFLLNGAAL--TYYKQCCVITWDILGGGIR  58

Query  54   --KPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETA--KDQTQ  109
                  +G   +A+ E  D +  G  +     +L             +YV+    + +TQ
Sbjct  59   CLDLPVRGGLRVAQAEASDLTSFGLRITSSSGRL-------------LYVQAGDLESRTQ  105

Query  110  WLEVAHNALGKNVAPQASADQ  130
            WL+   +      APQ  A Q
Sbjct  106  WLKALKD------APQRRAAQ  120

>HYAP_11713
Length=417

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (48%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  + L++ YF S  +   ++   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYANELQIVYFLS--LEDFERRTIRGKIPFSSVHAWD-------GKPNGFQFY  92

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
              A  H ++   VY ETA DQ +WLEV    +
Sbjct  93   TPA-DHCFR---VYTETAADQLKWLEVMQKCI  120

>HYAP_13690
Length=377

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            KQ +  G++ K G  +KSW+RRY VL G  L  SYF+S+
Sbjct  132  KQVTHTGWLKKEGARVKSWKRRYFVLRGSVL--SYFNSE  168

>PYAP_24144
Length=1022

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 57/115 (50%), Gaps = 15/115 (13%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            K  + EGY+ K+  ++  WR  Y VL+GDTL  +Y++S+  +  +      + ++  I+ 
Sbjct  309  KGIAFEGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESREDFILN------ARLIGRIQV  360

Query  69   HDYSDE---GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                D+       KP+GF+++      G++   +   TA ++ QW     +A+ K
Sbjct  361  QGVDDDNLPAATGKPHGFRVL----TEGHRIHHLGSRTAFEKDQWKRAIKSAIAK  411

>PITG_14197
Length=349

 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
            MN+ + + K ++  G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD
Sbjct  90   MNIPIQELKGSAFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  140

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 43/100 (43%), Gaps = 13/100 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            +GY+  RG ++ SW++R+M L    L V    S+T   SD  +    F +    +    D
Sbjct  259  QGYLHLRGGLLPSWKKRFMTLTDGHLTVR--RSRTQRSSDPQEADKPFDVISAVRWSGHD  316

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
             G  +     +L  H      KE  VY +   D + WLE 
Sbjct  317  NGLCI-----RLENH------KELYVYADHDVDASMWLEA  345

>PYVX_22589
Length=1375

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 56/114 (49%), Gaps = 17/114 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +  S EGY+ K+  ++ +W+  Y VL+ DTL  +YF+S+  + S+      S ++  ++ 
Sbjct  276  RSISFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESREDFISN------SKLIGRVQI  327

Query  69   HDYSDEGGGVKPYGFKLV--GHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
                D+  G K  GF++V  GH   H      +   TA ++ QW      A+ K
Sbjct  328  QAVEDDDMG-KSNGFRIVTEGHHVNH------LSSRTAFEKDQWKRAIAIAISK  374

>CCA19118
Length=125

 Score = 38.5 bits (88),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query  2   NLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKP  55
           NL     +  + EG +TKR   MK WR+RY +L G+ L   YF SK+  K+D P
Sbjct  8   NLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL---YF-SKS--KNDAP  55

>H310_04842
Length=1081

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (45%), Gaps = 16/114 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEI--EKHDY  71
            EG V K+G  +  W  RY+VLDG  L+  Y+  +   +  K   +G  IL  +  E H  
Sbjct  118  EGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARLGK-HLRGKLILTHVSPEIHKK  174

Query  72   SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQ  125
             +    V+  G K+           F +  +T  ++  W+E+   A+ +  APQ
Sbjct  175  KEHTFAVETTGRKM-----------FFMSCDTELEKDMWVEMIQAAISEAAAPQ  217

>PYVX_19030
Length=556

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+  D L++ Y+   T+   +K   +G    + + K D        KP GF+  
Sbjct  40   WKKRYCVIHKDVLQIVYY--LTLEDFEKGAIRGKIPFSSVHKWD-------GKPNGFQF-  89

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P +  K F VY ET ++QT+W++   + +
Sbjct  90   -YTPYN--KCFRVYTETPEEQTRWVDAMQSLI  118

>PHYCA_509385
Length=557

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (47%), Gaps = 13/92 (14%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W++RY V+    L++ YF S   +  +K   +G    + +   D        KP GF+  
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDF--EKRAIRGKIPFSSVHAWD-------GKPNGFQF-  91

Query  87   GHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
             + P      F VY ETA+DQ +W+E   N +
Sbjct  92   -YTPSDNC--FRVYTETAEDQAKWIETMQNCI  120

>HYAP_09511
Length=1295

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 51/102 (50%), Gaps = 13/102 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY++K+  V+ SW+  Y VL+ DT+  ++++++  + S+  K  G   L  IE  D   
Sbjct  243  EGYLSKKSDVLVSWKATYCVLEEDTM--AFYETREDFISNM-KLIGRIQLQAIEDEDAD-  298

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
                 KP GF+L+      G +   +   TA ++ QW    H
Sbjct  299  -----KPNGFRLI----AEGNRINHLSSRTAFEKEQWKRAIH  331

>H257_06698
Length=1199

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 18/109 (17%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY++K+G ++ +W+  Y VL+G TL +  +DS+  + +D    K   IL E+     +D
Sbjct  257  EGYLSKKGDLLAAWKSCYCVLEGLTLAI--YDSREDFMADV-GLKVRVILLEV-----ND  308

Query  74   EGGGVKPYGF--KLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            +    KP+GF  K  GH   H      +   TA ++ QW+      L K
Sbjct  309  DVA--KPHGFAIKTEGHKTQH------LASRTAFEKEQWIRAIRLQLVK  349

>PHYSO_315255
Length=1301

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 61/126 (48%), Gaps = 15/126 (12%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68
            +  + EGY++K+  V+ SW+  Y VL+ DTL  ++++++  + S+  K  G   L  IE 
Sbjct  221  RDIAFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNT-KLIGRIQLQGIEH  277

Query  69   HDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASA  128
             D        KP GF+++  A G+          TA ++ QW      A+ K  AP+ + 
Sbjct  278  EDMG------KPNGFRVI--AEGNHINHLS--SRTAFEKEQWKRAISIAISK--APEVTR  325

Query  129  DQRATA  134
               A A
Sbjct  326  PYVAFA  331

>HYAP_02230
Length=1195

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 78/186 (42%), Gaps = 30/186 (16%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G +TK+G   ++W+ R+ +L  D   + YF S+     DK +  G   + E +       
Sbjct  157  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSE-----DKLELLGEIAITE-DTIVLDRS  210

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL----EVAHNALGKNVAPQASADQ  130
            GGG  P+ F++   A         +  E+   Q +W+    E+A        +   S   
Sbjct  211  GGGTAPFRFQIRSDA-----HTLLLEAESRDSQKRWMDSCQELADAIRASKFSVNTSVSS  265

Query  131  RATALLGHRA----ASGFL-------TSAPVQLRNVNKTKEELLRKAIVTLEHAR--TVG  177
             + AL   R+    A G         TSA  Q  NV++T+  ++ +  V L   R  TVG
Sbjct  266  LSGALESRRSSVVKAVGMTRLTDVGETSASSQ--NVDETENSVVDETDVCLRRPRRLTVG  323

Query  178  DNTVSE  183
            D+  ++
Sbjct  324  DSLTTQ  329

>SPRG_06061
Length=1159

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 48/98 (49%), Gaps = 13/98 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++ +W+  Y VL+G TL V  +D++  + +D   +    +LA        D
Sbjct  224  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YDTREDFIADVGLKVRMLLLA-------VD  274

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G K  GF +     GH  +       TA ++ QW+
Sbjct  275  EENGAKANGFSI--RTEGHKVQHMA--SRTAFERDQWI  308

>SDRG_00080
Length=298

 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTL  39
           GYV K+G  +K+W+RRYMVL  DTL
Sbjct  75  GYVRKQGSFVKNWKRRYMVLHDDTL  99

>PHYRA_83071
Length=2300

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 50/117 (43%), Gaps = 19/117 (16%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             EGY+ KRGH + S R+RY VL G+ L  SYF    +   D     G    A + K   + 
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNEL--SYF----VTHDDSKNPGGGATTAPLGKFRVAV  1185

Query  74    EGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWLEVAHN--ALGKN  121
              G     +  K   H+  HG        K F     TAK++  W++      AL +N
Sbjct  1186  VGD----WHGKTATHSYEHGMELETSDGKTFFCAASTAKEKQLWVDAIRRGIALARN  1238

 Score = 31.6 bits (70),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (48%), Gaps = 7/67 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+  +  +  S  RRY VL G+TL   +     + K D P   G   +AE+ + D   
Sbjct  289  EGYLLCQHPMRTSMHRRYYVLTGNTLCWYHDQDAFVNKMDAP--SGVLHVAEVAEWD---  343

Query  74   EGGGVKP  80
              G VKP
Sbjct  344  --GKVKP  348

>PPTG_11714
Length=2444

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 68/159 (43%), Gaps = 34/159 (21%)

Query  4     DLTDFKQTSCEGYVTKRGHVMKS-WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFI  62
             D TD  QT  +GY+  R H + S WR R++VL+G TL V + ++  + +  KP+    F 
Sbjct  2016  DNTDTTQT--KGYLRVRHHNLGSIWRERFVVLEGSTLTV-FSENCQLDEEGKPR----FP  2068

Query  63    LAEIEKHD-------------YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQ  109
                +EKH+                 G G+K  GF+         Y EF     TA+D  +
Sbjct  2069  DLAVEKHELVGVEKWHPVFTSLGRSGSGLKGTGFR--AETSSGVYLEFI--ATTAEDAFK  2124

Query  110   WLEVAHNALGKNVAPQASADQRATALLGHRAASGFLTSA  148
             W         K+    A+  + ATA +   A   F+  A
Sbjct  2125  W---------KSAITAATTKESATATVSRDATLPFIPGA  2154

 Score = 38.5 bits (88),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 46/101 (46%), Gaps = 7/101 (7%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLK--VSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
             EGY+ KRGH + S R+RY VL G+ L   V++ DSK           G+F +  +     
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNELTYYVTHDDSKNPGGGATTNPLGNFRVEIV-----  1197

Query  72    SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
              D  G    + ++          K F     TAK++ QW++
Sbjct  1198  GDWHGKTATHTYEHAMELETTDGKTFFCAAATAKEKQQWVD  1238

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 58/157 (37%), Gaps = 31/157 (20%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+  +  +  +  RRY VL G+TL         ++K D P   G   +AE+ + D   
Sbjct  310  EGYLLCQHPMRTTMHRRYYVLTGNTLCWYADQDAFVHKMDAP--SGVLHVAEVSEWD---  364

Query  74   EGGGVK----------PYGFKLVGHAPGHGYKEFCVY----------VETAKDQTQWLEV  113
              G VK          P+      H+       F V               K+Q  W+  
Sbjct  365  --GKVKPTSPIRRLVVPFSSSPKAHSNEAYPNAFAVLTVEGKTLRCSAPLKKNQEDWIAA  422

Query  114  AHNALGKNVAPQASADQRATALLGHRAASGFLTSAPV  150
             H  +G  + P +    RA A   HR +   L S PV
Sbjct  423  LH--VGLTMPPLSP--HRARAAKSHRNSFDLLASIPV  455

>SDRG_08800
Length=881

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query  2   NLDLTDFKQ-TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
           NL+  D +     EG+V+K+GH++++W+ RY  L+ + L  SY++SK
Sbjct  53  NLESLDLQSGFEWEGFVSKKGHLVRNWKLRYFTLESNLL--SYYESK  97

>H310_06449
Length=1361

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 51/122 (42%), Gaps = 19/122 (16%)

Query  2    NLDLTDFKQTS---C---EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKP  55
            NLD+ DF  T    C    G++ KRGH   +W+RR+ VL  D  K+ YF      K ++ 
Sbjct  85   NLDV-DFSCTPGSPCIVHAGWLIKRGHNWHTWKRRWFVLTSDA-KLEYFK-----KPNRK  137

Query  56   KEKGSFILAE-IEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVA  114
            K KG   L + I +  + D       Y F +       G+       ET  D   W+   
Sbjct  138  KSKGKVDLNDGIVQVQFVDVHHVEHMYAFSIT-----KGFYTLLCSCETGDDADTWVRNL  192

Query  115  HN  116
             N
Sbjct  193  RN  194

>H310_06378
Length=837

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
           EG+V K+GH++++W+ RY  L+G+ L  SY+++K
Sbjct  59  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  90

>PHYSO_529931
Length=2211

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 52/121 (43%), Gaps = 27/121 (22%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYF----DSKTIYKSDKPKEKGSFILAEIEKH  69
             EGY+ KRGH + S R+RY VL G+ L  SYF    DSK           G+F + E+   
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNEL--SYFVTHDDSKNPGGGATTNPLGNFRV-EV---  1042

Query  70    DYSDEGGGVKPYGFKLVGHAPGHGY-------KEFCVYVETAKDQTQWLEVAHN--ALGK  120
                     V  +  K   H   HG        K F     +AK++ QW++      AL +
Sbjct  1043  --------VGDWHGKTAAHTYEHGMELETTDGKTFFCAASSAKEKQQWVDAFRRGIALAR  1094

Query  121   N  121
             N
Sbjct  1095  N  1095

>PHYSO_489872
Length=1240

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 25/101 (25%), Positives = 47/101 (47%), Gaps = 11/101 (11%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G +TK+G   ++W+ R+ +L  D   + YF S+     DK +  G   + E +       
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSE-----DKLELLGEIPITE-DTIVLDRS  207

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
            GGG  P+ F++   A     +   +  E+ ++Q +W+E   
Sbjct  208  GGGHAPFRFQIRTDA-----QTLLLEAESRENQKRWIEACQ  243

>H257_13567
Length=836

 Score = 40.0 bits (92),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 27/34 (79%), Gaps = 2/34 (6%)

Query  14  EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
           EG+V K+GH++++W+ RY  L+G+ L  SY+++K
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETK  92

>PYAP_16297
Length=2466

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 7/106 (7%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             EGY+ KRGH++ S R+RY +L  + L  +Y+ +    ++ + +  GSF + EI    +  
Sbjct  1168  EGYLVKRGHLVPSMRKRYCMLVKNVL--TYYLTHEDSRNTEIQPLGSFRV-EIVSDWHGK  1224

Query  74    EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                    YG +L  H    G   FC    + +++ QW+   H+ + 
Sbjct  1225  TTTQTYEYGMELETH---DGKTFFCAAF-SNEEKVQWMRAFHHGIA  1266

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 11/110 (10%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+  +    +++Y VL G  LK+  FD+   Y S + ++     +      D+  
Sbjct  513  EGYLVKKSSLFPVMKKKYCVLRG--LKLGIFDTHEAYGSSRQRDVEHEDILVCGVSDWDG  570

Query  74   EGGGVK-PYGFKLVGHAPGHGYKEFCVYVETAKD--QTQWLEVAHNALGK  120
             G  +   YGF++      H  +   +    A D  + +W+   H AL K
Sbjct  571  HGALLHYNYGFQI------HTVRHQMIQCSAANDNEKEKWMSGIHEALLK  614

>PYVX_21654
Length=855

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 54/115 (47%), Gaps = 7/115 (6%)

Query  27   WRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLV  86
            W R Y VLD     +S++ S+T +  D+   +G+     + +      GG    YGF++ 
Sbjct  580  WERYYFVLDRLDGALSFYISET-HAKDRTFVRGTSRPVSVSEGIPVHVGGQRTVYGFQI-  637

Query  87   GHAPGHGYKEFCVYVETAKDQTQWL-EVAHNALGKNVAPQASADQRATALLGHRA  140
             +  GHG   F V V++   +  WL E+  +    N  PQ SA Q+  +L+   A
Sbjct  638  -NTQGHG--SFMVLVDSIDSRLTWLTEIVASVAAAN-PPQGSASQKRLSLVNDDA  688

>SPRG_05449
Length=723

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query  2   NLDLTDFKQ-TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
           NL+  D +     EG+V+K+GH++++W+ RY  L+ + L  SY++SK
Sbjct  53  NLESLDLQSGFEWEGFVSKKGHLVRNWKLRYFTLESNLL--SYYESK  97

>PHYKE_38
Length=227

 Score = 38.9 bits (89),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (43%), Gaps = 28/129 (22%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD-------  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD       
Sbjct  2    MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGCAL--TYYTQCCVIASDVLGGGTQ  59

Query  54   --KPKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQ---T  108
                  +G   +A+ E  D       +  +G K+        Y    +YV+ A DQ    
Sbjct  60   CMDLPVRGGLRVAKAELSD-------MTSFGLKIT------SYSGRVLYVQ-AGDQDSRM  105

Query  109  QWLEVAHNA  117
            QWL+V   A
Sbjct  106  QWLKVLKEA  114

>H310_09363
Length=1954

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 8/53 (15%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSF  61
            K+TSC GY+ KRG V  + +RRYM+L  + L          YK++    KG F
Sbjct  842  KRTSCAGYLMKRGEVNVTMQRRYMILQDNEL--------VYYKTNPELNKGWF  886

>PHYCA_504712
Length=208

 Score = 38.9 bits (89),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 19/107 (18%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS  72
            C G++ K G  +K+W+RRY  L G TL   YF      KSD      SF +  +      
Sbjct  85   CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYF------KSDNGALLRSFTVCHV------  130

Query  73   DEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG  119
                 V     +L         ++  V  ET  D  +WL+  H A+ 
Sbjct  131  -----VTLRTRRLCLEITTEVGRKLLVASETQADLDRWLDHLHRAIA  172

>PYU1_G009178
Length=336

 Score = 39.3 bits (90),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 28/128 (22%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK------  54
            MN+ + + K T+  G++ K+G   K+W++R+ +L G  L  +Y+    +  SD       
Sbjct  78   MNIPMQELKGTAYYGWLWKKGSSFKTWKKRFFLLHGRAL--TYYTQTCVIASDALGTQCL  135

Query  55   --PKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQ---TQ  109
              P + G      +++ + SDE      YG K V    G       ++++ A DQ    Q
Sbjct  136  DVPAKGG----LRVQRVELSDE----TKYGLK-VTSTSGR-----ILHIQ-AGDQDARMQ  180

Query  110  WLEVAHNA  117
            WLEV   A
Sbjct  181  WLEVLEEA  188

>PHYSO_320361
Length=344

 Score = 39.3 bits (90),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD
Sbjct  86   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  136

>PHALS_11367
Length=1329

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 53/107 (50%), Gaps = 13/107 (12%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY++K+  V+ SW+  Y VL+ DTL  ++++++  + S+      S ++  I+     D
Sbjct  259  EGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISN------SKLIGRIQLQAIED  310

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK  120
            E  G KP GF +     GH      +   TA ++ QW      A+ K
Sbjct  311  EEMG-KPNGFCVTAEG-GHVSH---MSSRTAFEKEQWKRAISIAISK  352

>HYAP_09304
Length=1144

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            GY+ K+G   KSWRRR+ +L  D   +SY+ S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>SDRG_12776
Length=1184

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 48/98 (49%), Gaps = 13/98 (13%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G ++ +W+  Y VL+G TL V  ++S+  + +D   +    +LA        D
Sbjct  228  EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YESREDFIADVGLKVRMLLLA-------VD  278

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL  111
            E  G K  GF +     GH  +       TA ++ QW+
Sbjct  279  EENGAKANGFSI--RTEGHKVQHMA--SRTAFERDQWI  312

>CCI43793
Length=1117

 Score = 39.7 bits (91),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK  47
            GY+ K+G   KSWRRR+ +L  D   ++Y+ SK
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASK  207

>PPTG_19471
Length=348

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD
Sbjct  89   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  139

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (47%), Gaps = 19/103 (18%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIY---KSDKPKEKGSFILAEIEKHD  70
            +GY+  RG ++ SW++R+M L    L V    ++ +    ++DKP E    +++ +    
Sbjct  258  QGYLHVRGGLLPSWKKRFMTLTDGHLTVRRRRTQRLSDPQEADKPFE----VISAVR---  310

Query  71   YSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEV  113
            +S    G+     +L  H      KE  VY +   D + WLE 
Sbjct  311  WSGHDNGL---CIRLENH------KELYVYADHDADASMWLEA  344

>PYVX_14593
Length=964

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT  48
            K   C G++ K+G    SW+RRY  L G TLK  Y+ S+T
Sbjct  604  KLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKSET  641

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  13   CEGYVTKRGHVMKSWRRRYMVL  34
            CEG++ KRG   K+W+ RY  L
Sbjct  254  CEGWLEKRGARSKTWKSRYFFL  275

>SDRG_05128
Length=512

 Score = 39.3 bits (90),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (45%), Gaps = 15/125 (12%)

Query  14   EGYVTKRGH-VMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPK---EKGSFILAEIEKH  69
            EGY+ K+   + + W RR+  +D  TL ++YF S    K D+ +    +GSF L+ I   
Sbjct  376  EGYLEKKSSSIFRGWERRWFKVDTRTLVMTYFHS----KEDQMRGFAPRGSFALSRITHL  431

Query  70   DYSDEGGGVKPYGFKLV----GHAPGHGYKEFCVYVETAKDQTQWLEVA--HNALGKNVA  123
                   G + Y F +V      A  H  + F +  E+  D   W++    + A  +  +
Sbjct  432  VTHTHLRGNR-YAFDIVVDLGTRANPHATRTFELRCESEADLKYWVDTIEKYQAFSRRTS  490

Query  124  PQASA  128
              A+A
Sbjct  491  SNATA  495

>CCA26890
Length=1530

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 32/55 (58%), Gaps = 5/55 (9%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKS---DKPKEKGSFILAEI  66
            GY+ KRG   KS+RRRYM L+G+ L  SY+  K   KS   +K   +GS  L  +
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENV  349

>PYAP_19753
Length=1340

 Score = 39.3 bits (90),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (49%), Gaps = 18/105 (17%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK------TIYKSDKPK-EKGSFILAEIE  67
            GY+ KRG   +S++RRYM L+G TL  SY+  K       + + DK   E+GS  L  + 
Sbjct  160  GYLRKRGEHNRSYKRRYMELNGATL--SYYKKKPEKNGIPLSRDDKKSYERGSIDLDRVS  217

Query  68   KHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
                 D     +P+G  LV        + + +  E+ +D  +WL+
Sbjct  218  SIQPIDS----EPFGMHLVTTT-----RTWAISAESEQDFLRWLK  253

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 51/108 (47%), Gaps = 10/108 (9%)

Query  15   GYVTKRGHV-MKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAE--IEKHDY  71
            G++ K G      WRRR+  LD  +  +SY + +   K   P +  S ++A+   EK+  
Sbjct  636  GWLQKLGFSRWTKWRRRWFELDQGSCSLSYAEDENAPKKHIPLKFCSLMVADEMNEKYTT  695

Query  72   SDEGGGVK----PYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAH  115
            +    G +     + FK+    P +  +++ +  ET +++ +W+   H
Sbjct  696  APVNKGTRKERQTWCFKV---RPQNSSRDYIISAETKQEREEWMLAIH  740

>PHYRA_83696
Length=337

 Score = 38.9 bits (89),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSD  53
            MN+   D K     G++ KRG   K+W++R+ +L+G  L  +Y+    +  SD
Sbjct  79   MNIPTQDLKGAVFYGWLWKRGQSFKTWKKRFFLLNGAAL--TYYTQCCVIASD  129

>CCI45857
Length=905

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 57/141 (40%), Gaps = 22/141 (16%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+ K+G  +K W++R+ V DG TL  SY+ +    K  +P    S     ++    S+
Sbjct  40   EGYLQKKGQRLKGWKQRWFVCDGRTL--SYYITS---KDRRPNAIISLDGCTVQDGGMSE  94

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK-----------NV  122
                 + Y   L   A G  Y   C+  E A     WL V   A+ +             
Sbjct  95   TWQSPRIY---LTDRATGILY---CLSSEDAPVVIDWLHVLRKAVTRLSTETHTTQTDKR  148

Query  123  APQASADQRATALLGHRAASG  143
             PQ+ A    T +L  R+  G
Sbjct  149  LPQSVAFDEDTKILSLRSDGG  169

>H310_02133
Length=970

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 36/77 (47%), Gaps = 11/77 (14%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYS-  72
            EGY+ KRG  +  W    +VLDG  L++SYFD        +P    SF++A      +S 
Sbjct  31   EGYLRKRGDWLPRWDYYLVVLDG--LRLSYFDQLEGSTPARPHTP-SFLVANHTTSSHSA  87

Query  73   -------DEGGGVKPYG  82
                      GGVKP G
Sbjct  88   SLPAKVRGSSGGVKPRG  104

>SPRG_16312
Length=261

 Score = 38.5 bits (88),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (46%), Gaps = 1/72 (1%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            GYV K+G  +K+W+RR+MVL  DTL   Y   + + K        S   A    H    +
Sbjct  43   GYVRKQGSFVKNWKRRFMVLHDDTL-FYYVSERAMAKPRGFFRVTSVAYAPDLPHGLIAD  101

Query  75   GGGVKPYGFKLV  86
            G G +   F L 
Sbjct  102  GTGTRRLRFTLA  113

>PHYKE_5588
Length=751

 Score = 39.3 bits (90),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTI  49
            C G++ K G  +K+W+RRY  L G TL   YF S  +
Sbjct  441  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNV  475

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            CEG++ KRG     W+RRY  L G TL+
Sbjct  252  CEGWLYKRGQRSTEWQRRYFKLKGFTLQ  279

 Score = 32.7 bits (73),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (48%), Gaps = 10/48 (21%)

Query  11   TSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEK  58
             S +G++ K G   K+W+RRYM L            +TI    KP EK
Sbjct  136  VSMQGWLLKEGQNFKTWKRRYMTL----------RDRTIQYHAKPNEK  173

>PHYRA_76931
Length=1212

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 63/148 (43%), Gaps = 22/148 (15%)

Query  15   GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSDE  74
            G +TK+G   ++W+ R+ +L  D   + YF S+     DK +  G   + E +       
Sbjct  152  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSE-----DKLELLGEIPITE-DTIILDRS  205

Query  75   GGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVAPQASADQ-RAT  133
            GGG  P+ F++   A     +   +  E+ ++Q +W++            Q  AD  RA+
Sbjct  206  GGGHAPFRFQIRTEA-----QTLLLEAESRENQKRWIDSC----------QELADAIRAS  250

Query  134  ALLGHRAASGFLTSAPVQLRNVNKTKEE  161
                  + S F       LR +N+  EE
Sbjct  251  KFSVTTSMSSFSMDGRSSLRYMNRHTEE  278

>SPRG_08326
Length=501

 Score = 38.9 bits (89),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (45%), Gaps = 15/125 (12%)

Query  14   EGYVTKRGH-VMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPK---EKGSFILAEIEKH  69
            EGY+ K+   + + W RR+  +D  TL ++YF S    K D+ +    +GSF L+ I  H
Sbjct  368  EGYLEKKSSSIFRGWERRWFKVDTRTLVLTYFHS----KEDQMRGFAPRGSFALSRI-TH  422

Query  70   DYSDEGGGVKPYGFKLV----GHAPGHGYKEFCVYVETAKDQTQWLEVA--HNALGKNVA  123
              +        Y F +V      A  H  + F +  E+  D   W++    + A  +  +
Sbjct  423  LVTHAHLRGNRYAFDIVVDLGTRANPHATRTFELRCESEADLKYWVDTIEKYQAFSRRTS  482

Query  124  PQASA  128
              A+A
Sbjct  483  SNAAA  487

>PITG_11578
Length=2131

 Score = 39.3 bits (90),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 46/101 (46%), Gaps = 7/101 (7%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLK--VSYFDSKTIYKSDKPKEKGSFILAEIEKHDY  71
             EGY+ KRGH + S R+RY VL G+ L   V++ DSK           G+F +  +     
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNELTYYVTHDDSKNPGGGATTNPLGNFRVEIV-----  1006

Query  72    SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLE  112
              D  G    + ++          K F     TAK++ QW++
Sbjct  1007  GDWHGKTATHTYEHAMELETTDGKTFFCAASTAKEKQQWVD  1047

 Score = 32.0 bits (71),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 57/157 (36%), Gaps = 31/157 (20%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+  +  +  +  RRY VL G+TL         ++K D P   G   +AE+ + D   
Sbjct  310  EGYLLCQHPMRTTMHRRYYVLTGNTLCWYADQDAFVHKMDAP--SGVLHVAEVSEWD---  364

Query  74   EGGGVK----------PYGFKLVGHAPGHGYKEFCVY----------VETAKDQTQWLEV  113
              G VK          P+      H+       F V               K+Q  W+  
Sbjct  365  --GKVKPTSPIRRLVVPFSSSAKAHSNEQNPNAFAVLTVEGKTLRCSAPLKKNQEDWIAA  422

Query  114  AHNALGKNVAPQASADQRATALLGHRAASGFLTSAPV  150
             H  +G  + P +    RA A    R +   L S PV
Sbjct  423  LH--VGLTMPPLSP--HRARAAKSRRDSFDLLASTPV  455

>PHYSO_484541
Length=911

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDS  46
            C G++ K G  +K+W+RRY  L G TL   YF S
Sbjct  781  CSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  812

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  15  GYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKT  48
           G+  K+G ++KSW+RRY VL G  L   YF  ++
Sbjct  46  GWGLKQGSIIKSWKRRYFVLKGREL--IYFAERS  77

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            +G++ K G   K+W+RRYM L G T++
Sbjct  160  KGWLMKEGQNFKTWKRRYMTLTGRTIQ  186

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  13   CEGYVTKRGHVMKSWRRRYMVLDGDTLK  40
            CEG++ KRG     W+RRY  L G  L+
Sbjct  273  CEGWLYKRGQRSTEWQRRYFRLKGYKLQ  300

>PYIW_25250
Length=245

 Score = 38.1 bits (87),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 56/127 (44%), Gaps = 26/127 (20%)

Query  1    MNLDLTDFKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDK------  54
            MN+   D K T   G++ K+G   K+W++R+ +L G  L  +Y+    +  +D       
Sbjct  84   MNIPTQDLKGTVYYGWLWKKGSSFKTWKKRFFLLHGRAL--TYYTQCCVIATDSLGTQCL  141

Query  55   -PKEKGSFILAEIEKHDYSDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQT---QW  110
                KG   +A +E    +        YG K V  + G       +Y++ A DQ    QW
Sbjct  142  DVTAKGGLRVAGVELTSETK-------YGLK-VTSSSGR-----VLYIQ-AGDQAARMQW  187

Query  111  LEVAHNA  117
            LEV  +A
Sbjct  188  LEVLDDA  194

>CCA19033
Length=1883

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 47/108 (44%), Gaps = 9/108 (8%)

Query  14    EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
             EGY+ KRGH + S R+RY VL      + YF++K    S    + G   L E +  +  D
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDADS---FQYGLKALGEFQIGNVCD  1077

Query  74    EGGGVKPYGFK---LVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118
               G      +K    V    G  Y  FC    +  ++  W+   H+A+
Sbjct  1078  WNGRTLTQTYKNGMQVEACDGRVY--FCA-ASSENERESWIRAFHHAI  1122

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 52/193 (27%), Positives = 78/193 (40%), Gaps = 37/193 (19%)

Query  14   EGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEKHDYSD  73
            EGY+TK+ H     +RRY VL G T+ + Y  ++  YKS     K   +L  ++ HD   
Sbjct  108  EGYLTKKSHRFAQMQRRYCVLKG-TMLLCYL-TQDEYKSHIVPRK---VLEVVDVHDRGH  162

Query  74   EGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWL------------------EVAH  115
                V+  G        G  Y  FC    +  +Q +W+                  E A 
Sbjct  163  SSFEVEQLG--------GRTY--FCT-CTSDSNQAKWMNAMKEALEEPDRIAQEEIEEAQ  211

Query  116  NALGKNVAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHART  175
              L K    Q  A ++AT  +  R A GF T + V++    +  + L  K   TL+H  T
Sbjct  212  RFLFKEENDQREAVEQATEAI--RMAQGF-TQSVVEIDLETQEMKLLQAKVEETLQHTET  268

Query  176  VGDNTVSEMGHNA  188
            +  N+      NA
Sbjct  269  LYRNSTQNGFKNA  281

Lambda      K        H        a         alpha
   0.313    0.129    0.363    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 21572263215

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40