Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_01764147571092109256330.0
SPRG_063541475788488042400.0
H257_06305147571099110035460.0
H310_09212147571113111934810.0
PYAP_17746147571169116821100.0
PHYRA_95901147571075111919890.0
PYU1_G0017341475780079219800.0
PYIW_187931475799779619780.0
PYIR_1345314757118680419720.0
PHALS_06477147571166114519670.0
PHYSO_32115714757118079017020.0
PITG_1845714757117079316900.0
PPTG_1712814757117779816640.0
PHYCA_344751475769273414800.0
CCA18898147571147110614760.0
CCI45122147571105113214720.0
PYAR_13581147577303196883e-76
PHYKE_8394147574282654991e-53
SPRG_1926553622200571010.009
SDRG_116725362219344890.22
PYIR_1876848001146105860.49
PYU1_G0053634800989103850.74
H257_165881421110654840.94
PYAP_152029463198750830.97
H310_005661240231326114821.6
SPRG_1827513299436748792.4
SDRG_1218010813116249802.7
SDRG_093341240231289108793.5
PYAR_216311627357830783.6
PYIW_131624800116698784.2
H257_011741240231103175775.1
PPTG_1465018692787204775.4
PYAR_20859946311156127775.4
PITG_1563712613203693776.5
SPRG_00007823570938767.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_01764

Length=1092
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_01764                                                            2174       0.0  
SPRG_06354                                                            1637       0.0  
H257_06305                                                            1370       0.0  
H310_09212                                                            1345       0.0  
PYAP_17746                                                            817        0.0  
PHYRA_95901                                                           770        0.0  
PYU1_G001734                                                          767        0.0  
PYIW_18793                                                            766        0.0  
PYIR_13453                                                            764        0.0  
PHALS_06477                                                           762        0.0  
PHYSO_321157                                                          660        0.0  
PITG_18457                                                            655        0.0  
PPTG_17128                                                            645        0.0  
PHYCA_34475                                                           574        0.0  
CCA18898                                                              573        0.0  
CCI45122                                                              571        0.0  
PYAR_13581                                                            269        3e-76
PHYKE_8394                                                            196        1e-53
SPRG_19265                                                            43.5       0.009
SDRG_11672                                                            38.9       0.22 
PYIR_18768                                                            37.7       0.49 
PYU1_G005363                                                          37.4       0.74 
H257_16588                                                            37.0       0.94 
PYAP_15202                                                            36.6       0.97 
H310_00566                                                            36.2       1.6  
SPRG_18275                                                            35.0       2.4  
SDRG_12180                                                            35.4       2.7  
SDRG_09334                                                            35.0       3.5  
PYAR_21631                                                            34.7       3.6  
PYIW_13162                                                            34.7       4.2  
H257_01174                                                            34.3       5.1  
PPTG_14650                                                            34.3       5.4  
PYAR_20859                                                            34.3       5.4  
PITG_15637                                                            34.3       6.5  
SPRG_00007                                                            33.9       7.5  

>SDRG_01764
Length=1092

 Score = 2174 bits (5633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1092/1092 (100%), Positives = 1092/1092 (100%), Gaps = 0/1092 (0%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60
             MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV
Sbjct  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60

Query  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLDDHRTRSSPVER  120
             LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLDDHRTRSSPVER
Sbjct  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLDDHRTRSSPVER  120

Query  121   LRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLE  180
             LRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLE
Sbjct  121   LRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLE  180

Query  181   DDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQPYMNSSSF  240
             DDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQPYMNSSSF
Sbjct  181   DDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQPYMNSSSF  240

Query  241   NVASLKldlappptepdptpltRLAVARNKKSAVATVQLTFPGAKDEgdvvpvedpttdd  300
             NVASLKLDLAPPPTEPDPTPLTRLAVARNKKSAVATVQLTFPGAKDEGDVVPVEDPTTDD
Sbjct  241   NVASLKLDLAPPPTEPDPTPLTRLAVARNKKSAVATVQLTFPGAKDEGDVVPVEDPTTDD  300

Query  301   gpIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWG  360
             GPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWG
Sbjct  301   GPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWG  360

Query  361   SVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMAR  420
             SVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMAR
Sbjct  361   SVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMAR  420

Query  421   PGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKL  480
             PGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKL
Sbjct  421   PGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKL  480

Query  481   RLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMA  540
             RLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMA
Sbjct  481   RLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMA  540

Query  541   RLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFS  600
             RLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFS
Sbjct  541   RLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFS  600

Query  601   LATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTR  660
             LATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTR
Sbjct  601   LATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTR  660

Query  661   SGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASI  720
             SGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASI
Sbjct  661   SGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASI  720

Query  721   DMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTW  780
             DMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTW
Sbjct  721   DMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTW  780

Query  781   QHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQSVGAVY  840
             QHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQSVGAVY
Sbjct  781   QHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQSVGAVY  840

Query  841   PSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLL  900
             PSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLL
Sbjct  841   PSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLL  900

Query  901   PCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILSES  960
             PCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILSES
Sbjct  901   PCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILSES  960

Query  961   PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  1020
             PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA
Sbjct  961   PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTA  1020

Query  1021  GVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRSRHDD  1080
             GVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRSRHDD
Sbjct  1021  GVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNFAAVLGAIRSRHDD  1080

Query  1081  MVKRAKKARTST  1092
             MVKRAKKARTST
Sbjct  1081  MVKRAKKARTST  1092

>SPRG_06354
Length=884

 Score = 1637 bits (4240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 813/880 (92%), Positives = 832/880 (95%), Gaps = 2/880 (0%)

Query  214   IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKldlappptepdptpltRLAVARNKKSA  273
             +QNSKLRLYDRSEQPVKSQPYMNSS FNVASLKLDLAPPPTEPD  P TR AVAR +KS 
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKST  60

Query  274   VATVQLTFPGAKDEgdvvpvedpttddgp-IEPTDTIDELRNNVEKIRGYNDLLDTYSLH  332
             VATVQL+FPGAKDE       +    D   IEPTDTIDELRNNVEKIRGYNDLLDTYSLH
Sbjct  61    VATVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLH  120

Query  333   QFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIA  392
             QFIIRKGQTL+ETPEFISFKRITEDLWGSVSMAIRELETLL++YSVPLAYIDGQKLLKIA
Sbjct  121   QFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIA  180

Query  393   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLR  452
             AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKG D RHAAAI++QSVYRMH TRR LR
Sbjct  181   AMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMHRTRRLLR  240

Query  453   QHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVV  512
             QHHGHSYA+HIQRVYRTYK VK+IQVKLRLAREADARTWETQMT FHANWDKIKMQRRVV
Sbjct  241   QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV  300

Query  513   VHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLL  572
             VHVPSFSAEER RLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELS DIQKYMMRLL
Sbjct  301   VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL  360

Query  573   QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  632
             QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG
Sbjct  361   QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  420

Query  633   PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLA  692
             PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIP+GAHDIYDEDELILSLA
Sbjct  421   PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA  480

Query  693   KLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEG  752
             KLTAANLHQGMWLIKLDADPSDTGLA+IDMHALECVNKVR EKRAMKNDEYYSQPNIKEG
Sbjct  481   KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG  540

Query  753   IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  812
             IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE
Sbjct  541   IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  600

Query  813   PSGGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASI  872
             PSGGVH+TSAQEQLM  KNKHQSVGAVYP T VPYAAIRGASLAVAQAMYASGIIGYASI
Sbjct  601   PSGGVHVTSAQEQLMHVKNKHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASI  660

Query  873   DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQ  932
             DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLP 
Sbjct  661   DYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPL  720

Query  933   PAPHPSPATGQLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFF  992
             PAP PS   G  P TETQLAVEKIL ES  ++ +G ERAYIAHEYIFHPNMATLQYAVFF
Sbjct  721   PAPRPSSLAGP-PATETQLAVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFF  779

Query  993   NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV  1052
             NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV
Sbjct  780   NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV  839

Query  1053  QPAPDALTGERLGNFAAVLGAIRSRHDDMVKRAKKARTST  1092
             QPAPDALTGERLGNFAAVLGAIR RHDDMVKRAKKAR++T
Sbjct  840   QPAPDALTGERLGNFAAVLGAIRLRHDDMVKRAKKARSNT  879

>H257_06305
Length=1099

 Score = 1370 bits (3546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/1100 (61%), Positives = 846/1100 (77%), Gaps = 19/1100 (2%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60
             MD+L QQYH EDVGRILLQAQDELR+MRE+V   NN+D++ + AILERAE DLR+KAEIV
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNVDVNEINAILERAEADLRAKAEIV  60

Query  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLDDHRTRSSPVER  120
             LNGVVNN+MK LP IEAPGG + S+SKFSSKLA++RELA  M RD S +     +SP  R
Sbjct  61    LNGVVNNSMKMLPAIEAPGG-KTSLSKFSSKLAQKRELAATMTRDSSYEP----ASPTYR  115

Query  121   LRQQ---LGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDPLAPVP  177
                +    G P+ P+ERDR PG+RP+GR ++ G L+KKK T P RLLPK+NR DP AP P
Sbjct  116   QEDREPRFGGPIEPMERDRAPGRRPVGRIIKAGSLVKKKTTKPHRLLPKMNRTDPTAPSP  175

Query  178   DLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQPYMNS  237
             DL ++DA+ GV NLV RGF+P S D++ AFTHG  +IQNS++++YDR+ QPVKS PY N 
Sbjct  176   DLVEEDARGGVHNLVTRGFLPPSVDVTPAFTHGTSVIQNSRVKIYDRASQPVKSMPYTNP  235

Query  238   SSFNVASLKldlappptepdptpltRLAVARN-KKSAVATVQLTFPGAKDE---gdvvpv  293
             S FN+ASLK D++  P    P+P+  +    +  K  V  + ++F          +    
Sbjct  236   SGFNMASLKFDMSTTPATSTPSPVAAVVSGGDVSKMVVTPIDISFDAPSSSHPPVEQPKG  295

Query  294   edpttddgpIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKR  353
                  DD     + TI  LR NVEKIRGYN+LLDTYSLHQFIIRKG+TL++TPEFISF+R
Sbjct  296   GATGGDDTNGGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQR  355

Query  354   ITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDE  413
              TEDLWGSVS +I+ELET+L +YSVPLAY+DGQKL+KIAAMDA +R  +ELL+C+LN+DE
Sbjct  356   TTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDE  415

Query  414   VTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSV  473
             V++ M RPGQR+KG      A +L+QSV+RM LT++RL+ HHG+  A+ IQR+YR+Y+  
Sbjct  416   VSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAVIQRIYRSYRCF  475

Query  474   KEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAI  533
              ++Q +L+L READ R W+ QM  F ANWD +KMQRRVVVHVPSF++++RTRL MDNF+I
Sbjct  476   SQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSI  535

Query  534   RQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAE  593
             RQNLQMAR+CAIADPNVD+IYISPFELS DIQ+Y +RLLQLGG+ DP +R+RMLHPEN +
Sbjct  536   RQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVD  595

Query  594   RFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDR  653
             RFPEHFSL T+LLYSPHCLKKIKR+VRGK AYIV G VGPEDKRLAI LQ+PLLGMDPD+
Sbjct  596   RFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDK  655

Query  654   ALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPS  713
             ALLYGTRSG KR+F  ADVNIP GAHDIYDEDELI SL+KL AA++ Q  WL+K+DAD S
Sbjct  656   ALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQS  715

Query  714   DTGLASIDMHALECVNKVRTEKRAMKN--DEYYSQPNIKEGIVRAIVAELSEQ-FHRLIS  770
             DTG+ASI++  ++ V KVR EKR MK+   EY+ QP++++ ++R+I  EL+E  F   I+
Sbjct  716   DTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANIT  775

Query  771   PCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAK  830
             PCFPDVY +W  +RPV  R+G VIEAYP KVL++VRANVFIEPSGGVH+TSA +  M   
Sbjct  776   PCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPA  835

Query  831   NKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPP  890
             NKH    A++P T+VPY AIRGASLA+A +M+  GIIGYASIDY++F D KT+ G  G P
Sbjct  836   NKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVG-GGRP  894

Query  891   HLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQL-PVTET  949
               RLWA+Q++P LT TA+SFV+F FLSC+  +  TG+  L   AP P  A+  + P+T+ 
Sbjct  895   RQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHLQVAAPPPIAASATVAPITQA  954

Query  950   QLAVEKILSESPRSSNV--GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKS  1007
             Q AVE ILS  P +  V  GPER Y+  +YI+HPNMATL ++ FFN CR++GVSFDLQ++
Sbjct  955   QKAVETILSARPPNGAVVCGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRA  1014

Query  1008  IGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGERLGNF  1067
             IGAAF+LADSLTAGV+GL+CIGE+DKEA R+ R A+ELIGDQVGVQ  PD+L+GERLGNF
Sbjct  1015  IGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGERLGNF  1074

Query  1068  AAVLGAIRSRHDDMVKRAKK  1087
               +L  +R++ DD   R K+
Sbjct  1075  PHLLAIVRNKSDDPADRRKR  1094

>H310_09212
Length=1113

 Score = 1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/1119 (59%), Positives = 837/1119 (75%), Gaps = 39/1119 (3%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILERAELDLRSKAEIV  60
             M++L QQYH EDVGRILLQAQDELR+MRE+V  +NN+D++ + AILERAE DLR+KAEIV
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNLDVNQIHAILERAEADLRAKAEIV  60

Query  61    LNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMARDGSLD--------DHR  112
             LNGVVNN+MK LP I+APGG Q  +SKFSSKLA++R+LA  MAR+ + +        D  
Sbjct  61    LNGVVNNSMKMLPAIDAPGG-QRYLSKFSSKLAQKRDLAATMARENTYEPGSPTYGHDTS  119

Query  113   TRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQRLLPKVNRIDP  172
              R  P       L  P+ P+ERDR PG+RP+GR ++ G L+K K T P+R+LPK+NR+DP
Sbjct  120   YREHP------SLSGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTKPRRILPKMNRLDP  173

Query  173   LAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSKLRLYDRSEQPVKSQ  232
              AP P L DDDA+ GV NL+ RGF+P S D++ AFTHG  +IQN+++++YDR+ QPVKS 
Sbjct  174   TAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAFTHGTSVIQNTRVKIYDRASQPVKSM  233

Query  233   PYMNSSSFNVASLKldlappptepdptpltRLA--VARNKKSAVATVQLTFPGAKDEgd-  289
             PY N S FN+ASLK D+  P               +  +K S    + +TF G  +    
Sbjct  234   PYTNPSGFNMASLKFDMVTPTPPTVANVPINQGGDIPPSKTSIPTPIDITFDGHANNAVP  293

Query  290   ------------vvpvedpttddgpIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIR  337
                                  D      + +I  LR NVEKIRGYN+LLDTYSLHQFIIR
Sbjct  294   FRPEQPKGGNDPSGKDCASADDGAGGNDSTSIHNLRRNVEKIRGYNELLDTYSLHQFIIR  353

Query  338   KGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAV  397
             KG+TLA+TPEFISF+R TEDLWGSVS +I+ELE +L NYSVPLAY+DGQKL+KIAAMD  
Sbjct  354   KGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGT  413

Query  398   SRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQHHGH  457
             +R   ELL+C+LN+DEV++ M RPGQRFKG+     AA+LLQSV+RM++T++RL+ HHG+
Sbjct  414   ARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRLKNHHGN  473

Query  458   SYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPS  517
               A+ IQR+YR+Y+   ++Q +L+  READ R W+ QM  F ANWD IKMQRRVVVHVPS
Sbjct  474   EDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPS  533

Query  518   FSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGV  577
             FS+EERTRL M+NF+I+QNLQMAR+CAIADPNVD+IYISPFELS DIQKY +RLLQLGG+
Sbjct  534   FSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGI  593

Query  578   ADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKR  637
             ADP +R+RMLHPEN +RFPEHFSL T+LLYSPHCLKKIKR+VRGK+AYIV G VGPEDKR
Sbjct  594   ADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKR  653

Query  638   LAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAA  697
             LAI LQLPLLGMDPD+ALLYGTRSG KR+F  ADVNIP GAHDIYDEDELI SL+KL AA
Sbjct  654   LAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAA  713

Query  698   NLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKND--EYYSQPNIKEGIVR  755
             ++ Q  WLIK+DAD S+TG+AS+++  ++ V K R EKR MK+   EY+ QP++++ ++R
Sbjct  714   DIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLR  773

Query  756   AIVAELSEQ-FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPS  814
             ++ +EL+E  F   ++PCFP++Y +W  MRP+  R+G VIEAYP KVL+ VR N+FIEPS
Sbjct  774   SVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPS  833

Query  815   GGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDY  874
             GGVH+TSA +  M   NKH    AV+P ++VPY AIRGASLA+A +M+  GIIGYASIDY
Sbjct  834   GGVHITSAHDVFMCPVNKHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDY  893

Query  875   VAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLP-QP  933
             ++F D K +   +G P  RLWA+Q++P LT TA+SFV+F FLSC+  +  TG+S L   P
Sbjct  894   ISFADPKAM--VSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAP  951

Query  934   APHPSPATGQLPVTETQLAVEKILSESPRSSN---VGPERAYIAHEYIFHPNMATLQYAV  990
             AP  + +T   P+T TQ  +  ILS    ++     GPER Y+  +YI+HPNMATLQ+A 
Sbjct  952   APVATLSTANAPITPTQQEIATILSPPSSAAAASVCGPERTYMVLDYIYHPNMATLQFAT  1011

Query  991   FFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQV  1050
             FFN CR+HGVSFDLQ++IGAA++LADSLTAGVVGL+CIGESDKEA R+ R A+ELIGDQV
Sbjct  1012  FFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQV  1071

Query  1051  GVQPAPDALTGERLGNFAAVLGAIRSRHDDMVKRAKKAR  1089
             GVQ  P++L+GERLGNF  +L  +R++ DD     ++ R
Sbjct  1072  GVQALPNSLSGERLGNFPHLLAIVRNKSDDPAAADRRKR  1110

>PYAP_17746
Length=1169

 Score = 817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/1168 (40%), Positives = 685/1168 (59%), Gaps = 118/1168 (10%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQ-----------VLTSNNIDIDALQAILERA  49
             M++L Q++HVEDVGRILLQ QD+LR +REQ           V+ SNN   + ++ IL+RA
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAE-IEEILQRA  59

Query  50    ELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQP----SVSKFSSKLAKQRELADAMARD  105
             E +LR KAE+VL+ +V     +    +  GG  P         + +  ++ EL D  + D
Sbjct  60    EDELRMKAELVLSNIVTAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELHDGGSYD  119

Query  106   GSLDDHRTRSSPVERLRQQLGQPVV--------PVERDRPPGKRPIGRTMQVGRLIKKKV  157
               LD        +E  RQ+  +  V           R R  G  P   T   G+++K K 
Sbjct  120   --LD--------IEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTP---THAHGKVVKHKT  166

Query  158   TGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF-------THG  210
             T   RLLP VN+ DP AP P L   DAK+GVL+L+NRGF+P + DL+ AF       + G
Sbjct  167   TSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQG  226

Query  211   D--GIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKldlappptepdptpltRLAVAR  268
             +   +IQN  ++L+ R EQPV++  Y +  +FN+A+LK D+A   T         +  A 
Sbjct  227   NPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNT---------VTAAE  277

Query  269   NKK------------SAVATVQLTFPGAKDEgdvvpvedpttd-----------------  299
             N+              A+ TV ++F   K E         +                   
Sbjct  278   NRSIEPHDESEALPLRAMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLERED  337

Query  300   --dgpIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITED  357
                   E  +++++LRNNVEKIRGYN+LLD YSLHQFII KG+ L +TPEF SFKR+ ++
Sbjct  338   LDVTADEAANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQE  397

Query  358   LWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTF  417
             +WGS+   I+ LE LL  Y VPLAYIDGQ+L+ +A+M+    S  ELLTCV+N D+V + 
Sbjct  398   IWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASL  457

Query  418   MARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQ-HHGHSYASHIQRVYRTYKSVKEI  476
             + RPGQR+KG+D +  AA  LQ+ +RM L R R R+     S A  IQ+ +R+Y   + +
Sbjct  458   IRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSL  517

Query  477   QVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQN  536
             + +L   RE     W+ ++    + W  I+ QRRVV+HV S S +ERTRL+M+NF+++QN
Sbjct  518   RRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQN  577

Query  537   LQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFP  596
             LQ++RL  + D NV+++Y++PFELS ++ +Y ++LLQL G+A+ H+RVR++ PE+A +FP
Sbjct  578   LQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFP  637

Query  597   EHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLG-MDPDRAL  655
             +HFSLAT L+YSP+C+++I+R V+GKEAY+V G  GPED+RLA+ LQ+P+LG  DP   L
Sbjct  638   QHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSIL  697

Query  656   LYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDT  715
                TRSG+KR F +ADVN+P G +DIYD DEL+ SLAKL  ++L+Q +WL+KLDADP  T
Sbjct  698   PLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGT  757

Query  716   GLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPD  775
             G A +D+  +  +  +R EKR     EY+ QP I++ I RA++ EL  +   L+ P  P+
Sbjct  758   GTAILDVSLMTTLRDIRREKRP---PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPE  814

Query  776   VYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQL-----MQAK  830
             ++ +W+     +   G V+EA P  V   +R N+FIEPSG VH+ S  + L       ++
Sbjct  815   IFASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQ  874

Query  831   NKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGP  889
              + +    V+P T VP+ AI GAS AV + +Y      GYAS+D    L +        P
Sbjct  875   RQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVD----LQLSQEESLTSP  930

Query  890   PHL-RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTE  948
                 RLWA+ L P LT +A +F  F  L    L+ ATGR  L      P       P ++
Sbjct  931   HKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTARESTP-------PESD  983

Query  949   TQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSI  1008
             + L V  ++    R   +G  R+Y   EY+FHPN++ + Y  FF+ CR+HGV FD+++ +
Sbjct  984   SAL-VSSVIGTLDR---IGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCV  1039

Query  1009  GAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQP--APDALTGERL--  1064
             G+ F+LADSLTAG+ G+L  GES  +A++  R A E+IG +VG Q   + D+  G  +  
Sbjct  1040  GSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQL  1099

Query  1065  -GNFAAVLGAIRSRHDDMVKRAKKARTS  1091
              GNFA +LG +R R     ++ K+ R +
Sbjct  1100  SGNFAEILGLLRHRLSLEKEKEKRDRAT  1127

>PHYRA_95901
Length=1075

 Score = 770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/1119 (40%), Positives = 645/1119 (58%), Gaps = 105/1119 (9%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43
             M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44    AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRE-LADAM  102
             AIL++ E++LR+KAE+VL G+VN++          G   P V+  +    + R    DA 
Sbjct  61    AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVAAPPSTRHRSGYGDA-  119

Query  103   ARDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPG----KRPIGRTMQVGRLIKKKVT  158
                         S P+E  R+Q     V V +   P     +R +G  +Q GRL++KK T
Sbjct  120   -----------SSIPIEFFREQFHNSSVEVRQSLMPSPQHWQRHLG--IQHGRLLRKKTT  166

Query  159   GPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDGIIQNSK  218
                RLLP VN++DP AP P+L ++DAK GVLNLV R         S     G G+++   
Sbjct  167   QHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR---------SSGTKDGSGVMKQRA  217

Query  219   LRLYDRSEQPVKSQPYMNSSSFNVASLKldlappptepdptpltRLAVARNKKSAVATVQ  278
              R+YDRSEQP ++ P+  S+ +N+A+LK DL    T  +      +    N++     + 
Sbjct  218   TRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDDME--GNREHIDGEIS  275

Query  279   LTFPGAKDEgdvvpvedpttddgpIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRK  338
                 G  D                 +    ++EL  NV+KIRGYNDLLD YSLHQF+I K
Sbjct  276   DEDQGGADNDK--------------DEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIHK  321

Query  339   GQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVS  398
             G+++ +TPEF+SF+R+ ++LWGSV  A+R LETLL  Y VPLAY+DGQ+LL +AA     
Sbjct  322   GRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLAATGQPR  381

Query  399   RSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRR-LRQHHGH  457
              SKSELL C++N ++V + + RPGQR+KG D +  AA  +Q+  RM   RRR +R     
Sbjct  382   FSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASD  441

Query  458   SYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPS  517
               A+ IQ  +R+Y     ++ +LR  R      WE +M      W +I  +RRVVVHVPS
Sbjct  442   ISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRVVVHVPS  501

Query  518   FSAEERTRLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYISPFELSADIQKYMMRLLQLG  575
              S +E +RL+ +NFA++QNLQ+ R+CA A D +VD+ +Y+SPFEL+AD+ +Y ++LLQLG
Sbjct  502   LSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLG  561

Query  576   GVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPED  635
             G+AD   RV+++ PE A RFP+HFSL+++LLYSPHCL++I+ Y  GKEAY+V G  G ED
Sbjct  562   GLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAED  621

Query  636   KRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLT  695
             +RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P G +++YDE EL  +LAKL 
Sbjct  622   QRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLA  681

Query  696   AANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVR  755
              A++ Q  WL+KLD DP   G A +D+  ++ + ++R EKR     EY+ QP  ++   +
Sbjct  682   VAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKR---TPEYWRQPGPRDAAAK  738

Query  756   AIVAELSEQ--FHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVL-----------  802
              ++AEL       RL +P   +++P W+     +   G VIEA PP  +           
Sbjct  739   LVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLV  798

Query  803   --ARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQSVGAVYPSTTVPYAAIRGASLAVAQA  860
               A VRAN+F+ P G   L S+   L       ++V   +P T  P+ A++GA  A  + 
Sbjct  799   EPAYVRANLFVYPDGKNVLASSGGGL-----NRKTVAFTFPQTAAPHEAVQGACDATGKL  853

Query  861   MYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCAT  920
             +  + + GY S+D+V F D K  NG  G P  RLWAL + P LT +A SF  F  L+   
Sbjct  854   LVETSVWGYVSLDFVVFQDEK--NG--GSP--RLWALAVHPFLTDSAASFACFHLLARGA  907

Query  921   LDAATGRSFL-PQPAPHPSPATGQLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYIF  979
                A   S +   P    S     L + E  L          +++  G  R ++   Y+F
Sbjct  908   YRVAASNSMVNANPGRSGSGGAADLLLREASLT---------KAALAGAPRCFVVCSYVF  958

Query  980   HPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLT  1039
             HP++ T+QY+ FF+ CR+HGV FD+++++G  F+LADSLTAGV G+L +GE+ + A+   
Sbjct  959   HPHVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFL  1018

Query  1040  RAALELIGDQVG--VQPAPDALTGERLGNFAAVLGAIRS  1076
             R ALE+IG +VG  ++ A       R GNFA VL A+R+
Sbjct  1019  RTALEVIGREVGATIEMATSRPVSTRNGNFAQVLSAVRA  1057

>PYU1_G001734
Length=800

 Score = 767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/792 (46%), Positives = 528/792 (67%), Gaps = 35/792 (4%)

Query  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368
             +D+LR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WG V   I+ 
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428
             LETLL  Y VPLAY+DGQ+L+ +A+M+  S SK +LL+C++N D+V + + RPGQR+KG+
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  429   DSRHAAAILLQSVYRMHLTRRRLRQHHGH-SYASHIQRVYRTYKSVKEIQVKLRLAREAD  487
             D +  AAI +Q+V+RM   +++  ++  H S    IQ+V+R Y S ++++ KL+  R+  
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIAD  547
                WE +M      W +IK  RRV++HVPS S +ER R+  DNFA++QNLQ++RLC I D
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  548   PNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLY  607
              NVD++Y+SPFEL++++ +Y M+LLQLGG+ADP +RV+++ PE A RFP HFSL T+LLY
Sbjct  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  608   SPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLF  667
             SPHCL++I+R V+GKEAY+V G  G EDKRLA+ L +P+LGMDP   L   T+SG+KR F
Sbjct  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  668   TQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALEC  727
              +ADVN+P G +DIYDEDELI SLAKL  +++ Q +WL+K+D DP  TG A +D   +  
Sbjct  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  728   VNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVV  787
             + ++R EK   K+ EY+ QP  ++   R I+AEL     +L++P  P+VYPTWQ     +
Sbjct  421   LREIRREK---KSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAI  477

Query  788   NRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQS--VGAVYPSTTV  845
              + G VIEA P  ++  +RAN+F+EPSG VH++S Q+ ++   + H+    G  +P TT 
Sbjct  478   AQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTA  537

Query  846   PYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL-RLWALQLLPCLT  904
             PY AIRGAS+A+ + +    + GY+S+DY+ F + KT        H+ RLWA+ L P LT
Sbjct  538   PYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT--------HVPRLWAMALHPYLT  589

Query  905   PTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQL-AVEKILSESPRS  963
              +A +F +F  L+   L+  TG+  LP PA    P++        +L A     + S  S
Sbjct  590   DSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATS  649

Query  964   SNV----------------GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKS  1007
             +N+                G +R Y  +EYIFHPN++T+QY+ FF+ CR+HGV FD+++ 
Sbjct  650   ANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERC  709

Query  1008  IGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGE---RL  1064
              G  F+LADSLTAGV G++C G++   A+   R ALE+IG +VG Q   D L G      
Sbjct  710   FGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCES  769

Query  1065  GNFAAVLGAIRS  1076
             GNFA VL  +R+
Sbjct  770   GNFAEVLTVVRT  781

>PYIW_18793
Length=997

 Score = 766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/796 (47%), Positives = 529/796 (66%), Gaps = 39/796 (5%)

Query  307   DTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAI  366
             + +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WGSV   I
Sbjct  197   NAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVI  256

Query  367   RELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFK  426
             + LE LL  Y VPLAY+DGQ+L+ +AAM+  S SK +LL+C++N D+V + + RPGQR+K
Sbjct  257   KALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYK  316

Query  427   GEDSRHAAAILLQSVYRMHLTRR---RLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLA  483
             G+D +  AA+ +Q+ +RM   ++   R R H     A  IQRV+R Y S  +++ +++  
Sbjct  317   GKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVA--IQRVWRVYASHDDLKRRIKSQ  374

Query  484   READARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLC  543
             R+     WE +M     +W +IK  RRVV+HVPSFS +ER RL+ DNF+++QNLQ++RLC
Sbjct  375   RDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLC  434

Query  544   AIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  603
              + D NVD++Y+SPFEL+ D+ +Y M+LLQLGG+ADP +RV+++ PE+A RFP HFSL T
Sbjct  435   GLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTT  494

Query  604   ILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGA  663
             +LLYSPHCL++I+RY++ KEAY+V G  GPEDKRLA+ L +P+LGMDP  AL   T+SG 
Sbjct  495   LLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGG  554

Query  664   KRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMH  723
             KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K+D DP  TG A +D+ 
Sbjct  555   KRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVS  614

Query  724   ALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHM  783
              +  + ++R EKR+    EY+ QP  ++   R I+AEL      L++P  P++YP+WQ  
Sbjct  615   TMVALREIRREKRS---PEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPSWQDY  671

Query  784   RPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKN----------KH  833
                + + G V+EA P  V+  VRAN+F+EPSG VH++S Q+ L+ +            +H
Sbjct  672   ADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRH  731

Query  834   QSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLR  893
             +SVG  +P T  PY AIRGAS A+ + +    + GYASID++ F + K+          R
Sbjct  732   KSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-------R  784

Query  894   LWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLP-----VTE  948
             LWA+ L P LT +A +F  F  L+   L+  +G  +LP  A   S +  QL         
Sbjct  785   LWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLP-AATVTSASLVQLQSSSAAFAS  843

Query  949   TQLAVEKILSESPRSS-----NVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFD  1003
                A + +L E+  S       VG +  Y+  EYIFHPN++T+QY+ FF+ CR+HGV FD
Sbjct  844   GASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFD  903

Query  1004  LQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALT--G  1061
             +++ +G+ F+LADSLTAGV GL+C  ++   A+   R ALE++G +VG Q   D  T  G
Sbjct  904   VERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFTSGG  963

Query  1062  E-RLGNFAAVLGAIRS  1076
             E   GNFA VL AIR+
Sbjct  964   EAETGNFADVLAAIRA  979

 Score = 110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 66/87 (76%), Gaps = 3/87 (3%)

Query  162  RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF--THGDGIIQNSKL  219
            RLLP VN+ DP AP P+L + DAK G+L+LVNRGF+P   DL+ AF  +HG GIIQN K 
Sbjct  6    RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64

Query  220  RLYDRSEQPVKSQPYMNSSSFNVASLK  246
            R+YDR EQP+++ P+ N S FN+A+LK
Sbjct  65   RIYDRQEQPIRAVPHTNPSGFNIATLK  91

>PYIR_13453
Length=1186

 Score = 764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/804 (46%), Positives = 533/804 (66%), Gaps = 44/804 (5%)

Query  306   TDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMA  365
             T  +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WGSV   
Sbjct  376   TSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEV  435

Query  366   IRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRF  425
             IR LE LL  Y VPLAYIDGQ+L+ +AAM+  + SK +LL+C++N D+V + + RPGQR+
Sbjct  436   IRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRY  495

Query  426   KGEDSRHAAAILLQSVYRMHLTRRRLRQ--HHGHSYASHIQRVYRTYKSVKEIQVKLRLA  483
             KG+D +  AAI +Q+ +RM   +++  +  HH  S  + IQRV+R + S + ++ KL+  
Sbjct  496   KGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVT-IQRVWRAFASHESLKRKLKFQ  554

Query  484   READARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLC  543
             R      WE +M     +W  IK  RRVV+HVPS S +ER+R++ DNF+++QN+Q++RLC
Sbjct  555   RAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC  614

Query  544   AIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  603
              + DPNVD++Y+SPFEL+AD+ +Y M+LLQLGG+ADP +RV++++PE A RFP HFSL T
Sbjct  615   GLIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTT  674

Query  604   ILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGA  663
             +LLYSPHCL++I+RY+R KEAY+V G  G EDKRLA+ L +P+LGMDP  AL   T+SG+
Sbjct  675   LLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGS  734

Query  664   KRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMH  723
             KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K+D DP  TG A +D+ 
Sbjct  735   KRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVS  794

Query  724   ALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHM  783
              +  + ++R EK   K+ EY+ QP+ ++   RAI+AEL      L++P  P+VYP+WQ  
Sbjct  795   TMTVLREIRREK---KSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEF  851

Query  784   RPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKN------------  831
                +++ G V+EA P  V+  VRAN+FIEPSG VH++S Q+ +  + N            
Sbjct  852   VDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKA  911

Query  832   ---KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888
                + ++VG  +P T  PY AIRGAS A+ + +    + GY+SIDY+ F + KT      
Sbjct  912   GAYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA---  968

Query  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPAT-------  941
                 RLWA+ L P LT +A +F  F  L+   L+A++G   LP  A  PS ++       
Sbjct  969   ----RLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSLKPS  1024

Query  942   -GQLPVTETQLAVEKILSESPRSSNV-----GPERAYIAHEYIFHPNMATLQYAVFFNMC  995
               +        A + ++ E+  S  V     G +R Y+  EYIFHPN++T+QY+ FF+ C
Sbjct  1025  HSRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTC  1084

Query  996   RVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPA  1055
             R+HGV FD+++ +G+ F+LADSLTAGV G++C  +S   A+   R ALE+IG +VG Q  
Sbjct  1085  RLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQAL  1144

Query  1056  PDALTG---ERLGNFAAVLGAIRS  1076
              D   G      GNFA VL  IR+
Sbjct  1145  MDEFMGGGESETGNFADVLAVIRA  1168

 Score = 189 bits (480),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 158/269 (59%), Gaps = 36/269 (13%)

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNI---------------DIDALQAI  45
            MD+  QQ+HVEDVGRILLQ Q++LR MREQ+  ++                 D+ A Q I
Sbjct  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI  60

Query  46   LERAELDLRSKAEIVLNGVVNNTMKT--LPVIEAPGGGQPS----VSKFSSKLAKQRELA  99
            L+RAE+++R+KAE+VLNG VN + +   LP + +   G  S    + +  + L   R  +
Sbjct  61   LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARLRQNVTSLTAARRNS  120

Query  100  DAMARDGSLDDHRTR-SSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVT  158
               + +  LD  R R  +P       +  PV+P          P+ R  + G+L+KKK+ 
Sbjct  121  RLASDEPDLDYFRARFHNPAVEF---VSSPVLP---------SPVQRITK-GQLVKKKMA  167

Query  159  GPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDG-IIQNS  217
               RLLP VN+ DP AP P+L + DAK G+L+LVNRGF+P  ADL+ AF +  G II+NS
Sbjct  168  QNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIKNS  227

Query  218  KLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
            K R+YDR EQP++S P  N S FNVASLK
Sbjct  228  KTRIYDRQEQPIRSMPSTNPSGFNVASLK  256

>PHALS_06477
Length=1166

 Score = 762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/1145 (38%), Positives = 644/1145 (56%), Gaps = 82/1145 (7%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43
             M+++ Q YHVEDVGR+LL+ Q++LR MREQ+  +                  N ++ A  
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  44    AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103
             A+L++ E +LR+KAE+VLNG++N++              P+VS  +    K R   D+ A
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAAPSPIKHRR-GDSRA  134

Query  104   RD-GSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVTGPQR  162
              + G ++     S+ +E  RQQ     V + +          R     R ++KK T   R
Sbjct  135   DEFGHINRIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENW-RRKSGARRVRKKTTQHYR  193

Query  163   LLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF------THGDG--II  214
             LLP VN+ DP  P PDL ++DA  G+LNLV RGF+P  ADL+ AF      ++G G   +
Sbjct  194   LLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGCAL  253

Query  215   QNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKldlappptepdptpltRLAVAR----NK  270
             ++    +YDRS++  +  P + S  FN+A LK D     T          A       N 
Sbjct  254   KHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTPSSAPKPNHSATVSASMPNT  313

Query  271   K--SAVATVQ----------LTFPGAKDEgdvvpvedpttddgpIEPTDTIDELRN----  314
             K  S + TV           +  P  ++E           D    E +D  D +++    
Sbjct  314   KFSSIMQTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSFEDQEDEEGSDDSDIIKDEGFS  373

Query  315   ------NVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368
                   NV KIR YNDL+D YSLHQ +I KG+ + +TPEF SF+R+  DLWGSV   +R 
Sbjct  374   TKDLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRA  433

Query  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428
             LE +L  Y VPLA++DGQ+L+ +A+ +    S+ ELL+C++N ++V + + RPGQR+ G 
Sbjct  434   LEAILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGR  493

Query  429   DSRHAAAILLQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREAD  487
             D +H AA  +Q+  RM +   R ++    +  A  IQ  +R Y     ++ +LR  R   
Sbjct  494   DRKHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEK  553

Query  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-  546
             A  WE +M  F + W +I  +RR+VVHVPS S  E +RLN +NFA++QNLQ+ R+CA A 
Sbjct  554   AAKWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAAL  613

Query  547   DPNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605
             D  VD+ +Y+SP+EL+AD+ +Y  +LLQL G AD   RV+ ++PE A RFP HFSL++++
Sbjct  614   DLQVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLI  673

Query  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665
             LYSP+CL++I+ Y  G EAY+V G  GPED+RLAI L LP+LG  P +AL   TRSG KR
Sbjct  674   LYSPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKR  733

Query  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725
             L  QAD+N+P G +++YDE E+ ++LAKL  A++ Q  WLIKLD DP   G A +D+ ++
Sbjct  734   LLIQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSM  793

Query  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783
             + + ++  EKR     EY+ QP  ++      + E     +  RL +P   ++YPTW+  
Sbjct  794   QAMRELHREKR---TPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREY  850

Query  784   RPVVNRIGAVIEAYPPKVLA-------RVRANVFIEPSGGVHLTSAQEQLMQAKN--KHQ  834
                +   G VIEA PP   A        +RAN+F++P+G VH+TS Q  L   +     +
Sbjct  851   AAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRK  910

Query  835   SVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRL  894
             S    +P T  P+AAI+GA  AV + +  + + GY S+D+V F D+K+         +RL
Sbjct  911   SEIFAFPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAA------VRL  964

Query  895   WALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVE  954
             WAL + P LT +A +F  F  L+   LDA +G   +P      +  T +   +    A++
Sbjct  965   WALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQ--SGNHDAMD  1022

Query  955   KILSESPRSSNV--GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAF  1012
              +L E+  +  +  G  R Y+   Y+FHPN+   QY  FF  CR+HGV FD+ +++G  F
Sbjct  1023  LLLREASLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLF  1082

Query  1013  VLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGER-LGNFAAVL  1071
             +LADSLTAGV G+L IGE+ ++A+   R ALE+IG + G      + +    LGNFA VL
Sbjct  1083  LLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRSVLGNFADVL  1142

Query  1072  GAIRS  1076
               +R+
Sbjct  1143  STVRA  1147

>PHYSO_321157
Length=1180

 Score = 660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/790 (43%), Positives = 488/790 (62%), Gaps = 36/790 (5%)

Query  312   LRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELET  371
             L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+ ++LWGSV  A+R LET
Sbjct  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALET  443

Query  372   LLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSR  431
             LL  Y VPLAY DGQ+LL +A+      SK ELL+C++N ++V   + RPGQR+KG D +
Sbjct  444   LLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503

Query  432   HAAAILLQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADART  490
               AA  +Q+  RM   RRR +R       A+ IQ  +R +     ++ +LR  R      
Sbjct  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDN  563

Query  491   WETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPN  549
             WE +M      W +I  +RRVVVHVPS S +E +RL+ +NFA++QNLQ+ R+CA A D N
Sbjct  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623

Query  550   VDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYS  608
             VD+ +Y++PFEL+AD+  Y ++LLQLGG+AD   RV+++ PE A RFP HFSL+++LLYS
Sbjct  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683

Query  609   PHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFT  668
             PHCL++I+ Y  GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL  
Sbjct  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLI  743

Query  669   QADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECV  728
             +ADVN+P G +++YDE EL  +LAKL  A++ Q  WL+KLD DP   G A +D+  ++ +
Sbjct  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803

Query  729   NKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQ--FHRLISPCFPDVYPTWQHMRPV  786
              ++R EK   K  EY+ QP  ++   + ++AEL       RL +P   +++P+W+     
Sbjct  804   RELRREK---KTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEA  860

Query  787   VNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAKN-K  832
             ++  G V+EA PP                A VRAN+FI+P G VH+TS Q  L       
Sbjct  861   ISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLN  920

Query  833   HQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL  892
              ++V   +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+     G P  
Sbjct  921   RKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKS----GGAP--  974

Query  893   RLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLA  952
             RLWAL + P LT +A SF  F  L+   LDA++G   +   A + + A      +     
Sbjct  975   RLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRM--AAANSTLAAVNSGRSGGGGT  1032

Query  953   VEKILSESP--RSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGA  1010
              + +L E+   + +  G  R Y+   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G 
Sbjct  1033  TDLLLREASLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGT  1092

Query  1011  AFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGERLGN  1066
              F+L DSLTAGV G+L +GE+   A+   R ALE+IG + G    +  +P      R GN
Sbjct  1093  LFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGN  1152

Query  1067  FAAVLGAIRS  1076
             FA VL A+R+
Sbjct  1153  FAQVLSAVRA  1162

 Score = 167 bits (424),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 101/273 (37%), Positives = 151/273 (55%), Gaps = 30/273 (11%)

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43
            M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103
            AIL++ E +LR+KAE+VLNG+VN++          G   P+V+  +    + R      A
Sbjct  61   AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAAPPSTRHR---SGYA  117

Query  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQV--GRLIKKKVTGPQ  161
            +          S P+E  R+Q     V V +   P    + R + +  GRL++KK T   
Sbjct  118  KPRVAKSMDASSIPMEFFREQFRNSSVEVRQTLMPSPLHLQRHLGIHHGRLMRKKTTQHC  177

Query  162  RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFT--------HGDGI  213
            RLLP VN++DP AP P+L ++DAK GVLNLV RGF+P  ADL+ AF          G G+
Sbjct  178  RLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSGGGV  237

Query  214  IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
            ++    R++DRSEQ V+  P+  S+ +N+A+LK
Sbjct  238  MKQRATRIHDRSEQSVRPTPFTQSTGYNLAALK  270

>PITG_18457
Length=1170

 Score = 655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/793 (43%), Positives = 495/793 (62%), Gaps = 38/793 (5%)

Query  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368
             +++L  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEF+SF+R+T++LWGSV  A+R 
Sbjct  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRA  430

Query  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428
             LETLL  Y VPLAY+DGQ+LL +A       SK ELL+C++N D+V + + RPGQR+KG 
Sbjct  431   LETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490

Query  429   DSRHAAAILLQSVYRMHLTRRRLRQHHGHSY-ASHIQRVYRTYKSVKEIQVKLRLAREAD  487
             D +  AA  +++  RM L RRR  +     + AS IQ  +R Y     ++ +LR      
Sbjct  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550

Query  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-  546
                WE +M    ++W +I  +RRVVVHVPS S +E +RL  +NFAI+QNLQ+ R+CA A 
Sbjct  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610

Query  547   DPNVDVI-YISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605
             D NV+++ Y+SPFEL++D+ +Y ++LLQLGG+ D   RV+++ PE   RFP HFSL+++L
Sbjct  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670

Query  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665
             LYSPHCL++I+ Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KR
Sbjct  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKR  730

Query  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725
             L  +ADVN+P G +++YDE E+  +LAKL  A++ Q  WLIKLD DP D G A +D+  +
Sbjct  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790

Query  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783
             + + ++R EKR     EY+ QP  ++   + I+AEL       R+ +P   +++P W+  
Sbjct  791   QAMRELRREKR---TPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREF  847

Query  784   RPVVNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAK  830
                V   G V+EA PP  +             A VRAN+F++P G VH++S Q  L    
Sbjct  848   IDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGG  907

Query  831   N--KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888
                  ++V   +P T  PY AI+GA  A  + +  + + GY S+D+V F D K+ +    
Sbjct  908   GGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAP--  965

Query  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTE  948
                 RLWAL + P LT +A SF  F  L+   LD  +G   + + A            +E
Sbjct  966   ----RLWALAVHPFLTDSATSFACFHLLARGVLDTNSG---VYRVANKSLTTANSGRKSE  1018

Query  949   TQLAVEKILSES--PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQK  1006
             +  A + +L E+   +SS VG  R ++A  Y+FHP++ T+QY  FF+ CR+HGV FD+++
Sbjct  1019  SGSATDLLLREALLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVER  1078

Query  1007  SIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDALTGE  1062
             ++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+IG + G    V  +P      
Sbjct  1079  TLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSVAS  1138

Query  1063  RLGNFAAVLGAIR  1075
             R GNFA +L AIR
Sbjct  1139  RSGNFAQILSAIR  1151

 Score = 170 bits (431),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 154/269 (57%), Gaps = 28/269 (10%)

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQV-------------LTSNNI----DIDALQ  43
            MD++ QQ+HVEDVGR+LLQ Q++LR MREQ+             +  N I    ++ A  
Sbjct  1    MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103
            AIL++ E +LR+KAE+VLNG+VN++          G   P+V+  ++     R   D   
Sbjct  61   AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAAAPSIMHRSGYDKAN  120

Query  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRP-PGKRPIGRTMQVGRLIKKKVTGPQR  162
            +   +D     S PVE  R+Q     V + +  P P +R  G  +  GRL++KK T   R
Sbjct  121  KPRQMD---ASSIPVEFFREQFRNNSVEIRQSLPEPWERHFG--IHHGRLMRKKTTQHCR  175

Query  163  LLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF-----THGDGIIQNS  217
            LLP VN+ DP  P P+L ++DAK GVLNLV RGF+P  ADL+  F       G G+++  
Sbjct  176  LLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGVMKQR  235

Query  218  KLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
              R+Y+RSEQ V+S P+  S+ +N+ASLK
Sbjct  236  ATRIYNRSEQVVRSTPFTQSTGYNLASLK  264

>PPTG_17128
Length=1177

 Score = 645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/798 (44%), Positives = 490/798 (61%), Gaps = 48/798 (6%)

Query  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368
             ++EL  NV+KIRGYN+LLD YSLHQF+I KG+T+ +TPEFISF+R+ ++LWGSV  A+R 
Sbjct  380   MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRA  439

Query  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428
             LE LL  Y VPLAY+DGQ+LL +A       SK ELL+C++N D++ + + RPGQR+KG 
Sbjct  440   LEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499

Query  429   DSRHAAAILLQSVYRMHLTRRRLRQHHGHSY-ASHIQRVYRTYKSVKEIQVKLRLAREAD  487
             D +  AA  +Q+  RM L RRR  +       A+ IQ  +R Y     ++ +LR  R   
Sbjct  500   DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREK  559

Query  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-  546
                WE +M    + W +I  +RRVVVHVPS S +E  RL+ +NFA++QNLQ+ R+CA+A 
Sbjct  560   LEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619

Query  547   DPNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATIL  605
             D NVD+ +Y+SPFEL+AD+ +Y ++LLQLGG+ D   RV+ + PE + RFP HFSL+++L
Sbjct  620   DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679

Query  606   LYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKR  665
             LYSPHCL++I+ Y  GKEAY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KR
Sbjct  680   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKR  739

Query  666   LFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHAL  725
             L  +ADVN+P G +++YDE EL  +LAKL  A++ Q  WLIKLD DP   G A +D+  +
Sbjct  740   LLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNI  799

Query  726   ECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHM  783
             + + ++R EKR     EY+ QP  ++   + I+AEL       RL +P   +++PTW+  
Sbjct  800   QAMRELRREKR---TPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDY  856

Query  784   RPVVNRIGAVIEAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAK  830
                V   G VIEA PP  +             A VRAN+F++P G VH+TS Q  L    
Sbjct  857   IDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGG  916

Query  831   N--KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888
                  ++V   +P T  P+ AI+GA  A  + +  + + GY S+D+V F D K+     G
Sbjct  917   GGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKS----NG  972

Query  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG------RSFLPQPAPHPSPATG  942
              P  RLWAL + P LT +A SF  F  L+   LD  +G      +S       + S  T 
Sbjct  973   AP--RLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNGSGCTT  1030

Query  943   QLPVTETQLAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSF  1002
              L + E  LA         + S  G  R ++   Y+FHP++ T+QY  FF+ CR+HGV F
Sbjct  1031  DLLLREASLA---------KDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCF  1081

Query  1003  DLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVG----VQPAPDA  1058
             D+++++G  F+LADSLTAGV G+L IGE+ + A+   R ALE+IG + G    +  +P  
Sbjct  1082  DVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPSR  1141

Query  1059  LTGERLGNFAAVLGAIRS  1076
                 R GNFA VL A+R+
Sbjct  1142  PVSGRSGNFAQVLSAVRA  1159

 Score = 177 bits (448),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 108/273 (40%), Positives = 154/273 (56%), Gaps = 30/273 (11%)

Query  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTS-----------------NNIDIDALQ  43
            M+++ QQ HVEDVGR+LLQ Q++LR MREQ+  +                    ++ A  
Sbjct  1    MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  44   AILERAELDLRSKAEIVLNGVVNNTMKTLPVIEAPGGGQPSVSKFSSKLAKQRELADAMA  103
            AIL++ E +LRSKAE+VLNG+VN++          G   P+V+  +    K R   +   
Sbjct  61   AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQSGNFLPAVTVAALPSTKHRSGYNGAN  120

Query  104  RDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQV--GRLIKKKVTGPQ  161
            +   +D     S P+E  R+Q     V + +   P   P  R   V  GRL++KK T   
Sbjct  121  KPRQMD---ASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQHC  177

Query  162  RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF------THGD--GI  213
            RLLP VN++DP AP P+L ++DAK GVLNLV RGF+P  ADL+ AF      ++G   GI
Sbjct  178  RLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGGI  237

Query  214  IQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLK  246
            ++    R+YDRSEQ V+S P+  S+ +N+ASLK
Sbjct  238  MKQRATRIYDRSEQAVRSTPFTQSTGYNLASLK  270

>PHYCA_34475
Length=692

 Score = 574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/734 (42%), Positives = 436/734 (59%), Gaps = 62/734 (8%)

Query  320   RGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSVP  379
             RGYN+LLD YSLHQF+I KG+T+ +TPEFISF R+ ++LWGSV  A+R LETLL +Y VP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  380   LAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILLQ  439
             LAY+DGQ+LL +AA      SK ELL+C++N ++V   + RPGQR+KG D +  AA  +Q
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  440   S-VYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAF  498
             + V      RR  R       A+ IQ  +R Y     ++ +LR  R      WE +M   
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  499   HANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-DPNVDV-IYIS  556
              + W +I   RRVVVHVPS S +E +RL+ +N A+RQNLQ+ R+CA A D  VD+ +Y+S
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  557   PFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIK  616
             PFEL+ D+ +Y ++LLQLGG+AD   RV++L PE A RFP HFSL+++LLYSPHCL++I+
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  617   RYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPF  676
              Y  GKEAY+V G  G ED+RLA+ L LP+LG  P +AL   TRSG KRL  +ADVN+P 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  677   GAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKR  736
             G +++YDE EL  +LAKL  A++ Q  WL KLD DP   G A +D+  ++ + ++R EKR
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  737   AMKNDEYYSQPNIKEGIVRAIVAELSE--QFHRLISPCFPDVYPTWQHMRPVVNRIGAVI  794
                  EY+ QP  ++   + ++ EL       RL  P   D++P+W      +   G VI
Sbjct  421   ---TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVI  477

Query  795   EAYPPKVL-------------ARVRANVFIEPSGGVHLTSAQEQLMQAKN--KHQSVGAV  839
             EA P   +             A +RAN+F++P G VH+TS    L         ++V   
Sbjct  478   EAVPLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFT  537

Query  840   YPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  899
             +P T  P+ A++GA  A  + +  + + GY S+D+V F D K+ NG       RLWAL +
Sbjct  538   FPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKS-NGAP-----RLWALAV  591

Query  900   LPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILSE  959
              P LT +A SF  F  L+   LDA +G                                 
Sbjct  592   HPFLTDSAASFACFHLLARGVLDANSGVY-------------------------------  620

Query  960   SPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLT  1019
               R +     R ++   Y+FHP++ T+QY  FF+ CR+HGV FD+++++G  F+LADSLT
Sbjct  621   --RMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLT  678

Query  1020  AGVVGLLCIGESDK  1033
             AGV G+L IGE+ +
Sbjct  679   AGVFGVLSIGETTE  692

>CCA18898
Length=1147

 Score = 573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/1106 (33%), Positives = 574/1106 (52%), Gaps = 104/1106 (9%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQV-----------------------LTSNN-  36
             M+++ Q+YH EDVGRILLQ Q ELR++R ++                       L + N 
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  37    -IDIDALQAILERAELDLRSKAEIVLNGVVN--NTMKT-LPVIEAPGGGQPSVSKFSSK-  91
               D++ L  IL+RAE ++++K +++  G  N    M+T LP + +P     + +K  S  
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPPRQVSTTTKSLSDQ  145

Query  92    -LAKQRELADAMARD--GSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQ  148
               + Q    D   +    + DD++   S       Q  + + P        KRP  + + 
Sbjct  146   IFSTQESKVDGTRKQLTAAKDDYKCSPS------MQQSELISP--------KRPT-QGLL  190

Query  149   VGRLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFT  208
               +  KK+     + LP V           L D  ++         G    S ++S + T
Sbjct  191   TSKASKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHFLNSRHGSPLNSIEISQS-T  249

Query  209   HGDGIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKld-----------lappptepd  257
             +   ++Q +  +L++R E+P+++ P  ++ S ++ SLK D                 +  
Sbjct  250   YDRALMQRTA-QLHNRLEEPIRTTPCTSTISHDITSLKFDFSAPTILQSPGKVQIHEQVT  308

Query  258   ptpltRLAVARNKKSAVATVQLTFPGAKDEgdvvpvedpttddgpIEPTDTIDELRNNVE  317
                   L     + S          G +++   +      +    I       ++  + E
Sbjct  309   HFNDQALGECNCRLSTNQVSMALINGFREDNSKLSPSRDHSKKMGIPKVIKSTKINTDTE  368

Query  318   KIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYS  377
               +G N     +++HQ I+ + ++     +F SF+    D+W +V   +  LE LL  Y 
Sbjct  369   SHKGNNSSNHDFTIHQGIVDRRRS-----DFKSFQCFANDVWNNVEEVVTTLERLLSVYF  423

Query  378   VPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAIL  437
             +P+A+I+GQ++L ++  +    +  +LL+CV N  EV   + +PGQRF+G +    AA+ 
Sbjct  424   IPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMA  483

Query  438   LQSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMT  496
             +QS  RM   RR  L     H     IQ+ +R Y + K  ++K+   RE     +   M 
Sbjct  484   VQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMR  543

Query  497   AFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYIS  556
             +F +NWDKI+ QRR V+H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI 
Sbjct  544   SFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYIC  603

Query  557   PFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIK  616
             PFEL+ DI +Y M+LLQL G++D  +R++++ PENA RFP HFSL+ ++L SPH +K++ 
Sbjct  604   PFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLS  663

Query  617   RYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPF  676
             RY+RG+ AY+V G  G EDKRLA  L++P+LG+DP +     T SG KR F + + N   
Sbjct  664   RYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLP  723

Query  677   GAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKR  736
             G+ D+YDE+ELI SLAKL AAN HQ   ++KLD DP  TG A +D+  L+ +  +R   R
Sbjct  724   GSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTR  783

Query  737   AMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEA  796
              +   +Y+ QP I+  ++R IV E+      L+    P+VYP+W+     +   G VIE 
Sbjct  784   TL---DYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEV  840

Query  797   YPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQ-------------------SVG  837
              P      VRAN+FIEPS  V ++S QE  +  +N H+                   ++G
Sbjct  841   CPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMRTIG  899

Query  838   AVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWAL  897
               +P T + +  ++ ASL + QA+   GI GY S+D++  LD +T N         L+A+
Sbjct  900   FTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKI-------LYAM  952

Query  898   QLLPCLTPTAMSFVLFTFLS-CATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKI  956
              L P LT +A SF LF FLS     ++ TG   LP+ A      T   P + +  A + +
Sbjct  953   ALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPR-AITSHGVTSDTPSSSSLSATDLM  1011

Query  957   LSESPRSSNVG------PERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGA  1010
             + E+  S  V       P R+Y+  EY+ +PN+ATL Y  FF  CR  GV FD+++ IG 
Sbjct  1012  IREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGT  1071

Query  1011  AFVLADSLTAGVVGLLCIGESDKEAV  1036
              F+LADSLTAGV+G++CI ++ K A+
Sbjct  1072  VFLLADSLTAGVLGIMCISDTRKNAL  1097

>CCI45122
Length=1105

 Score = 571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/1132 (33%), Positives = 592/1132 (52%), Gaps = 123/1132 (11%)

Query  1     MDRLAQQYHVEDVGRILLQAQDELRNMREQV-----------------------LTSNN-  36
             MD L Q++H ED+GRILLQ Q ELR +R ++                       + S N 
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  37    -IDIDALQAILERAELDLRSKAEIVLNGVVNNTMKT---LPVIEAPGGGQPSV--SKFSS  90
               D++ LQ IL+RAE ++++K +++  GV +   KT   LP + +P    PS   S    
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFVASPPRQIPSSANSSLER  120

Query  91    KLAKQRELADAMARDGSLDDHRTRSSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVG  150
             K + Q    D + +       + +  P     +Q  + + P        KRP  + +   
Sbjct  121   KSSFQELSVDLIRKQLHSVKEKYKCLPT----KQHSELISP--------KRPT-QGLLTS  167

Query  151   RLIKKKVTGPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHG  210
             +  KK+     R LP V R               + G  +  +R  I    + S   +  
Sbjct  168   KPSKKRYNASLRSLPTVQR--------------GEAGDFSSASRDQI---GEASNTLSVN  210

Query  211   DGIIQNSKLRLYDRSEQPVKSQPYMNSSSFNVASLKldlappptep---dptpltRLAV-  266
             D ++      L++R E+P+K+ PY  + S N+ S+K D   P ++          ++ + 
Sbjct  211   DRVLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPTSQSPCGKMQTQEKIVLT  270

Query  267   ----ARNKKSAVATVQLTF-PGA---KDEgdvvpvedpttddgpIEPTDTIDELRNNVEK  318
                 ++ +  A+   Q++  PG    +D+    P  DP+   G I+    I    N+V K
Sbjct  271   NDLQSKQRNGALLANQISLSPGGGCREDDSRFSPGRDPSKKIGIIKAITPI--FLNDVTK  328

Query  319   IRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLINYSV  378
                  ++  TY    F+I +G    + PEF +F+RI   +W SV + +  L  +L  Y +
Sbjct  329   -SLVGEISKTYD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFI  384

Query  379   PLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAILL  438
             P+AYI+GQ++L +A  D V  +  +L++C+ N DEV   +++PGQRF+G +    A I L
Sbjct  385   PIAYINGQRILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIAL  444

Query  439   QSVYRMHLTRRR-LRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTA  497
             QS  RM + R+R L   + +   + IQR +R + + K  ++K+   RE     +   M +
Sbjct  445   QSFIRMAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRS  504

Query  498   FHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIADPNVDVIYISP  557
             F +NWDKI+MQRR ++H+PS S + R R+  + F+I+QNLQ+ RLCA+ D NV++IYI P
Sbjct  505   FCSNWDKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICP  564

Query  558   FELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKR  617
             FEL+ DI +Y M+LLQLGG++D  +R++++ PENA RFP HFSL++++LYSP  L ++ R
Sbjct  565   FELTDDIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSR  624

Query  618   YVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPFG  677
              +RG+ AY+V G  G EDKR+A  L +P+LG+D  ++L   T SG+KR F +A+VN    
Sbjct  625   CIRGRNAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPA  684

Query  678   AHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALECVNKVRTEKRA  737
               D+YDE+ELI SLAKL A++ HQ   +++LD DP  TG+A +D+  L+ V +VR   + 
Sbjct  685   CIDLYDENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKT  744

Query  738   MKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAY  797
             +   E + QP I+  ++R +V E+       I    P+++P+ +     +   G +IE  
Sbjct  745   L---ESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELS  801

Query  798   PPKVLARVRANVFIEPSGGVHLTSAQE-----------------QLMQAK-NKHQSVGAV  839
             P K    VRAN+FIEPS  V ++S  E                  L +A   K ++ G  
Sbjct  802   PKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVT  861

Query  840   YPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQL  899
             +P T + +  ++ ASLA+ QA+   GI GY S+D+V  LD +T           L+A  L
Sbjct  862   FPQTLIDHEVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKT-------LYATGL  914

Query  900   LPCLTPTAMSFVLFTFLS-CATLDAATGRSFLPQPAPHPSPATGQLPVTETQLAVEKILS  958
              P LT TA SF LF  LS   + ++ TG   LPQ      P  G      + L+   ++ 
Sbjct  915   QPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEV----PLVGVQNDPPSSLSATDLMI  970

Query  959   ESPRSSNV-------GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAA  1011
                R S +        P R Y   EY+ +P +ATL  + FF  CR  GV FD ++  G  
Sbjct  971   REARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTV  1030

Query  1012  FVLADSLTAGVVGLLCIGESDKEAVRLTRAALELI----GDQVGVQPAPDAL  1059
             F+LADSLTAGV G++CI ++ K A+   RAA+E I    G ++ V  + D +
Sbjct  1031  FLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTKMSVSKSSDGM  1082

>PYAR_13581
Length=730

 Score = 269 bits (688),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/319 (46%), Positives = 199/319 (62%), Gaps = 32/319 (10%)

Query  307  DTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAI  366
            + +D+LR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF SFKR+ +++WG+V   I
Sbjct  79   NAMDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVI  138

Query  367  RELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFK  426
            R LE LL  Y +                   S   S LL+CV+N D+V + + RPGQR+K
Sbjct  139  RALEALLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYK  180

Query  427  GEDSRHAAAILLQSVYRM--HLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAR  484
            G+D +  AA  LQ+ +RM  H  R R     G S A+ IQ  +R + + + ++ +L L R
Sbjct  181  GKDRKRRAATTLQAFFRMLFHRNRFRRVCRRGAS-ATRIQTTWRKFAAQQSLRRELTLRR  239

Query  485  EADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCA  544
                R W+ QM    + W +I  QRRVVVHVPS S +E  R+++D+FA++QNLQ+ARL A
Sbjct  240  AEQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAA  299

Query  545  IADPNVD-VIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  603
            + D  V+ V+Y+SPFEL  D+           GVA+   RV+++ PE+A  FP HFSLAT
Sbjct  300  VVDATVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLAT  350

Query  604  ILLYSPH-CLKKIKRYVRG  621
             LLYSPH  L+K+ R  R 
Sbjct  351  QLLYSPHLTLEKLGRCSRA  369

 Score = 114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 102/380 (27%), Positives = 153/380 (40%), Gaps = 92/380 (24%)

Query  718   ASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVY  777
             A +D+ AL  + ++R   RA K   Y+ QP I++ + RA++ EL      L  PC  + +
Sbjct  389   ALLDVSALTTLREIR---RAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERF  445

Query  778   PTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVH-----LTSAQEQLMQAKNK  832
             P W+     + R G VIEA P +V   VR N+F+ P+   H     + S QE L +A   
Sbjct  446   PDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL-RASAG  504

Query  833   HQSVGAVYPSTTVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPH  891
                +    P T VP+ A+ GA+ A+ + +       GYAS+D                  
Sbjct  505   RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVD------------------  546

Query  892   LRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQL  951
                  LQL                      D  +G   LP PA   S      P T   L
Sbjct  547   -----LQL--------------------CRDETSGLYLLPSPAVDTSAPLS--PATPLVL  579

Query  952   AVEKILSES--PRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIG  1009
                 +L+ S  P +S     R +++ ++  HPN+ T+  A FF  CR  GV FD+     
Sbjct  580   QEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVT----  635

Query  1010  AAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ-PAPDALTGERLGNFA  1068
                                    + A++  R A E++  +VG   P+ D       GNF 
Sbjct  636   -----------------------RRAMQYLRTAFEVLAREVGSSTPSSD-------GNFG  665

Query  1069  AVLGAIRSRHDDMVKRAKKA  1088
              VL  +R R     +R K+A
Sbjct  666   DVLALLRHRVGVEKEREKEA  685

>PHYKE_8394
Length=428

 Score = 196 bits (499),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 111/265 (42%), Positives = 155/265 (58%), Gaps = 40/265 (15%)

Query  489  RTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIA-D  547
            R  + +M    AN DKI+               E      +NFA++QNLQ+ R+CA A D
Sbjct  150  RDEDAEMEELGANVDKIR------------GYNELLDAYTENFAVQQNLQLTRICAAALD  197

Query  548  PNVDV-IYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILL  606
             NVD+ +Y+SPFEL+AD+ +Y ++LLQLGG+AD   RV+++ PE A RFP          
Sbjct  198  SNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT---------  248

Query  607  YSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRL  666
                          GK+AY+V G  G ED+RLAI L LP+LG  P +AL   TRSG KRL
Sbjct  249  --------------GKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRL  294

Query  667  FTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALE  726
              +ADVN+P G +++YD+ EL  +LAKL   ++ Q  WL+KLD DP   G A ID+  ++
Sbjct  295  LIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQ  354

Query  727  CVNKVRTEKRAMKNDEYYSQPNIKE  751
             + ++R EKRA    EY+ QP  ++
Sbjct  355  AMRELRREKRA---PEYWRQPGPRD  376

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query  1   MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNIDIDALQAILE---RAELDLRSKA  57
           M+++ QQ+HVEDVGR+LLQ Q++LR MREQ+  +          +     + E++LR+KA
Sbjct  1   MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANASPMRHSTVKTEMELRAKA  60

Query  58  EIVLNGVVNNT  68
           E+VLNG+VN++
Sbjct  61  ELVLNGMVNSS  71

 Score = 35.0 bits (79),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)

Query  309  IDELRNNVEKIRGYNDLLDTYS  330
            ++EL  NV+KIRGYN+LLD Y+
Sbjct  156  MEELGANVDKIRGYNELLDAYT  177

>SPRG_19265
Length=2200

 Score = 43.5 bits (101),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 1/57 (2%)

Query  413   EVTTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRRRLRQ-HHGHSYASHIQRVYR  468
             +  +F AR     K E ++H AA+ +Q  Y+ H+ RRRLR     H  A H+QRVYR
Sbjct  1452  QYKSFWARFDAETKAERAKHLAALAIQRAYKGHVCRRRLRALKLEHKTALHLQRVYR  1508

>SDRG_11672
Length=2193

 Score = 38.9 bits (89),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 1/44 (2%)

Query  426   KGEDSRHAAAILLQSVYRMHLTRRRLRQHH-GHSYASHIQRVYR  468
             K E +R+ AA+ +Q  Y+ H+ RRRLR     H  A H+QRVYR
Sbjct  1474  KAERARYLAAVAIQRTYKGHVYRRRLRALKVEHKTALHLQRVYR  1517

>PYIR_18768
Length=1146

 Score = 37.7 bits (86),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 54/105 (51%), Gaps = 8/105 (8%)

Query  370  ETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGED  429
            E++L++Y    A +D Q++ +       S+ + E L   +   +V   + +    F   +
Sbjct  717  ESVLLSY----ATVDIQRVFR--GFQFRSQLRREKLIQSVQQRQVDHILGQLQANFIVRE  770

Query  430  SRHAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVK  474
             R  +A+ +Q +++ +  R RLR+ H    A+HIQRV+R Y+  K
Sbjct  771  CRRKSAVSIQRIFKGYAYRNRLRRWHID--ATHIQRVFRGYRGRK  813

>PYU1_G005363
Length=989

 Score = 37.4 bits (85),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 8/103 (8%)

Query  372  LLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSR  431
            +LI+Y    A ID Q++ +       S+ + E L   +   +V   +A+    F   + R
Sbjct  617  VLISY----AAIDLQRVFR--GFRFRSQMRRERLIQSIQQRQVDNMLAQLQANFLFRERR  670

Query  432  HAAAILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVK  474
              +AI +Q +Y+    R RLR+ H    A+ IQRV+R Y+  K
Sbjct  671  RLSAIAIQRIYKGFAHRNRLRRWHLE--ATQIQRVFRGYRGRK  711

>H257_16588
Length=1106

 Score = 37.0 bits (84),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 4/54 (7%)

Query  434  AAILLQSVYRMHLTRRRLRQ-HHGHSYASHIQRVYRTYKS---VKEIQVKLRLA  483
            AA++LQ VYR+H   R LR+    H +A  IQRVYR Y +   V+E+ V + LA
Sbjct  386  AAMMLQRVYRIHCVARTLRRLLASHRHALTIQRVYRGYVARVFVQELFVVMSLA  439

>PYAP_15202
Length=987

 Score = 36.6 bits (83),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query  431  RHAAAILLQSVYRMHLTRRRLRQHHG----HSYASHIQRVYRTYKSVKEI  476
            RHAAA  +Q + R+++ RR L++H      H  AS IQ +YR  K  +EI
Sbjct  513  RHAAATRIQCLARLYIARRLLKEHQQERKRHVAASRIQALYRGRKVRREI  562

>H310_00566
Length=1326

 Score = 36.2 bits (82),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 52/114 (46%), Gaps = 12/114 (11%)

Query  383  IDGQKLLKIA-AMDAVSR-----SKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAI  436
            IDG++  K+A AM   +R     S ++L   +          AR     + +  R  AAI
Sbjct  847  IDGRRKFKLAKAMRDANRVEEAASATQLQALMRGRQARKVAAARRQAELEEQAQRQHAAI  906

Query  437  LLQSVYRMHLTRRRLRQHHG-----HSYASHIQRVYRTYKSVKEIQVKLRLARE  485
             LQ +YR  + RR+ RQ        H  A+ +Q  +R  +  + I   LR+ARE
Sbjct  907  RLQCMYRQRIARRKFRQRLNHLAELHRAATKMQCAWRARQG-RSIMGALRMARE  959

>SPRG_18275
Length=367

 Score = 35.0 bits (79),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 1/48 (2%)

Query  436  ILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLA  483
            ILLQS++R    R  LRQH  ++ A  +QR +RTYK+ K   ++LR A
Sbjct  33   ILLQSLWRGRHARSALRQHQLYTSAVVLQRNWRTYKAQKAY-LRLRAA  79

>SDRG_12180
Length=1162

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  435  AILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLA  483
             ILLQS++R    R  L QH  ++ A  +QR +RTYK+ K   ++LR A
Sbjct  809  CILLQSLWRGRHARSALHQHKLYTSAVVLQRNWRTYKAQKSY-LRLRAA  856

>SDRG_09334
Length=1289

 Score = 35.0 bits (79),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 18/108 (17%)

Query  433  AAAILLQSVYRMHLTRRRL---RQHHG--HSYASHIQRVYRTYKSVKEIQVKLRLA---R  484
            AAAI LQS YR  L RR+L   R+H    H  A  +Q V+R  +    + V LR+A   R
Sbjct  884  AAAITLQSQYRQRLARRQLAARREHLALFHHSAMKMQSVWRARQGRNFLGV-LRMAQRRR  942

Query  485  EADA------RTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRL  526
            + DA      R W  + T     W+   ++ R  +H    +A +R  L
Sbjct  943  DEDAAATYIQRQWRDRKTFLQRVWE---LELRRQLHTQQGTAAKRLSL  987

>PYAR_21631
Length=578

 Score = 34.7 bits (78),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  640  IRLQLPLLGMDPDRALLYGTRSGAKRLFTQ  669
            ++  +PL G DPDR   +G  +GAK +F Q
Sbjct  193  VKHHIPLFGGDPDRITAFGESAGAKSVFAQ  222

>PYIW_13162
Length=1166

 Score = 34.7 bits (78),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 48/98 (49%), Gaps = 4/98 (4%)

Query  377  SVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAI  436
            S+  A ID Q++ +       S+ + E L   +   ++   + +    F   + R  +AI
Sbjct  703  SLSFAAIDIQRVFR--GFRFRSQLRREKLIQSIQQRQIDHMLNQLQANFVVRECRRKSAI  760

Query  437  LLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVK  474
             +Q +++ +  R  LR+ H    A+HIQRV+R Y+  K
Sbjct  761  AIQRIFKGYAHRNLLRRWHIE--ATHIQRVFRGYRGRK  796

>H257_01174
Length=1103

 Score = 34.3 bits (77),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 67/175 (38%), Gaps = 33/175 (19%)

Query  383   IDGQKLLKIA-AMDAVSR-----SKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAAAI  436
             IDG++  K+A AM    R     S ++L + +          AR       E  R  AAI
Sbjct  854   IDGRRKFKLAKAMREADRQEETASATQLQSLMRGRQARKVAAARRQAELDREVQRQHAAI  913

Query  437   LLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQV------------KLRLAR  484
              LQ +YR  + RR+ R        + + R+  TY++  ++Q              LR+AR
Sbjct  914   RLQCMYRQRIARRKFR--------ARLDRLAETYRAATKMQCAWRARQGRSIMGALRMAR  965

Query  485   EADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQM  539
               D R  E   T     W K     RV      + AE R   N+        LQ+
Sbjct  966   --DRREHEAAATLVQLRWKK-----RVAYKSRVWEAEMRRSGNVARRGAASRLQL  1013

>PPTG_14650
Length=2787

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 80/204 (39%), Gaps = 45/204 (22%)

Query  358   LWGSVSMA---IRELETLLINYSVPLAYIDGQKLLKI---------------AAMDAVSR  399
             +WG+V  A   IR  +  +  +++   Y DG+KL+ +                A  AV R
Sbjct  2438  VWGAVGRARALIRSFDEAI--HTLEPRYEDGEKLIGVKAEVNRALHSLLDLLLAQSAVVR  2495

Query  400   SKSELLTCVLN---------VDEVTTFMARPGQRFKGEDSRHA--AAILLQSVYRMHLTR  448
                 L T +              V  F+ +   R + +  R    AA+ +Q  +R HL R
Sbjct  2496  YLKHLETEITRERKQLYDNPATTVQCFVRQAQARMELKKRRREFRAALAIQCAFRQHLAR  2555

Query  449   RRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQ  508
             RR+        A  +QR YR          K + A+ +  R + TQ+ +   N+      
Sbjct  2556  RRVLFMKWTRAAIKVQRAYRR---------KRQRAKGSRPRRFSTQLLSTSQNFGTTTRS  2606

Query  509   RRVVVHVPSFSAEERTRLNMDNFA  532
               VVV+V     +E  R +M +F 
Sbjct  2607  PSVVVNV-----DEAWRTDMSSFG  2625

>PYAR_20859
Length=1156

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (45%), Gaps = 30/127 (24%)

Query  428  EDSRHAAAILLQSVYRMHLTRR---RLRQHH------GHSYASHIQRVYRTYKSVKEIQV  478
            E  R  AA L+Q + R +L+RR   R+R+ H       ++ A+ IQ+VYR +++    ++
Sbjct  758  ERHRTKAATLIQKIMRGYLSRRLLVRMREQHRAELAMQNAAATQIQKVYRGHRARLGTEL  817

Query  479  KLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLN---MDNFAIRQ  535
            KL   +E                  K KM++R  + + +     + R     M    +R 
Sbjct  818  KLLALKE------------------KNKMRKRAAIQIQTLVRHRQARFTVARMREQKLRG  859

Query  536  NLQMARL  542
             + +ARL
Sbjct  860  LVALARL  866

>PITG_15637
Length=2036

 Score = 34.3 bits (77),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 22/93 (24%)

Query  428   EDSRHAAAILLQSVYRMHLTRRRL---------------RQHHGHSYAS--HIQRVYRTY  470
             E   H AA  +QSVYR++ + ++L               RQ +  +  S   IQR  R++
Sbjct  1501  ESVEHRAATRIQSVYRLYASHKQLLAATFIQAAFRGFITRQQYAKASTSVLVIQRALRSW  1560

Query  471   KSVKEIQVKLRLAREAD-----ARTWETQMTAF  498
             ++V + +  LRL R A+     AR W ++   F
Sbjct  1561  RAVTKFRRALRLHRAAESIQKLARGWSSRRRRF  1593

>SPRG_00007
Length=709

 Score = 33.9 bits (76),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 0/38 (0%)

Query  435  AILLQSVYRMHLTRRRLRQHHGHSYASHIQRVYRTYKS  472
            AI +Q+ +RMH+ RRR  Q+     A  +QR +R Y++
Sbjct  316  AICIQAQWRMHVCRRRYLQNPRQVSARRLQRAWRRYQA  353

Lambda      K        H        a         alpha
   0.320    0.134    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 92064316050

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40