Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
SDRG_017631475873673636510.0
SPRG_063551475871371733400.0
PYIR_13418147587475747119e-82
HYAP_07104147587215826837e-78
PHYRA_81098147587415726522e-73
PHYCA_511415147587444186348e-71
PITG_18458147587474206303e-70
PPTG_17129147587454186163e-68
PHYSO_348903147587664146077e-67
PYU1_G001733147587324146058e-67
PYIW_19969147587334126041e-66
PHYKE_83951475814204185933e-63
CCI44111147585765775661e-62
CCA22843147585864185592e-61
PHALS_06476147587263845371e-57
PYAP_17763147587944135287e-56
PYAR_13571147586664045061e-53
PYVX_23590147586894174497e-46
PYVX_215131382114462111901e-13
SPRG_1903013355510003161883e-13
H257_0193413355510222871864e-13
SDRG_079831335559911961865e-13
PHYSO_4705331382110843351703e-11
SPRG_126211382110032961694e-11
PITG_172501382110463301651e-10
H310_082921382110071761651e-10
SDRG_045751382110031761632e-10
PPTG_113651382111063341606e-10
PYU1_G002110138219993991508e-09
H257_117731382110261771472e-08
PYIR_141071382111762121401e-07
PYAR_14788138217951511354e-07
PYIW_157171382111212131312e-06
PYAP_222301382111161441274e-06
PYU1_G00954315640140861870.28
PYIR_13773156401486195830.81
H310_095889898280138800.99
PYIW_1720869019846762.1
PHYRA_738071645948173782.6
SPRG_08282126277125052773.5
PYIW_2082415640143559773.6
SDRG_0974813658375080764.5
SDRG_0024410451876106756.0
SPRG_1461413009699355756.5
PYU1_G01437669019845726.8
SDRG_0974913241999255756.9
PPTG_010291645939173756.9
CCI4133369019643727.5
CCA2177369019643727.5
H257_06450128696125924747.7
SDRG_094801052456552738.7
H310_03690122778216677748.8
SPRG_080531052456352739.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= SDRG_01763

Length=736
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

SDRG_01763                                                            1410       0.0  
SPRG_06355                                                            1291       0.0  
PYIR_13418                                                            278        9e-82
HYAP_07104                                                            267        7e-78
PHYRA_81098                                                           255        2e-73
PHYCA_511415                                                          248        8e-71
PITG_18458                                                            247        3e-70
PPTG_17129                                                            241        3e-68
PHYSO_348903                                                          238        7e-67
PYU1_G001733                                                          237        8e-67
PYIW_19969                                                            237        1e-66
PHYKE_8395                                                            233        3e-63
CCI44111                                                              222        1e-62
CCA22843                                                              219        2e-61
PHALS_06476                                                           211        1e-57
PYAP_17763                                                            207        7e-56
PYAR_13571                                                            199        1e-53
PYVX_23590                                                            177        7e-46
PYVX_21513                                                            77.8       1e-13
SPRG_19030                                                            77.0       3e-13
H257_01934                                                            76.3       4e-13
SDRG_07983                                                            76.3       5e-13
PHYSO_470533                                                          70.1       3e-11
SPRG_12621                                                            69.7       4e-11
PITG_17250                                                            68.2       1e-10
H310_08292                                                            68.2       1e-10
SDRG_04575                                                            67.4       2e-10
PPTG_11365                                                            66.2       6e-10
PYU1_G002110                                                          62.4       8e-09
H257_11773                                                            61.2       2e-08
PYIR_14107                                                            58.5       1e-07
PYAR_14788                                                            56.6       4e-07
PYIW_15717                                                            55.1       2e-06
PYAP_22230                                                            53.5       4e-06
PYU1_G009543                                                          38.1       0.28 
PYIR_13773                                                            36.6       0.81 
H310_09588                                                            35.4       0.99 
PYIW_17208                                                            33.9       2.1  
PHYRA_73807                                                           34.7       2.6  
SPRG_08282                                                            34.3       3.5  
PYIW_20824                                                            34.3       3.6  
SDRG_09748                                                            33.9       4.5  
SDRG_00244                                                            33.5       6.0  
SPRG_14614                                                            33.5       6.5  
PYU1_G014376                                                          32.3       6.8  
SDRG_09749                                                            33.5       6.9  
PPTG_01029                                                            33.5       6.9  
CCI41333                                                              32.3       7.5  
CCA21773                                                              32.3       7.5  
H257_06450                                                            33.1       7.7  
SDRG_09480                                                            32.7       8.7  
H310_03690                                                            33.1       8.8  
SPRG_08053                                                            32.7       9.6  

>SDRG_01763
Length=736

 Score = 1410 bits (3651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 736/736 (100%), Positives = 736/736 (100%), Gaps = 0/736 (0%)

Query  1    MALRSCARVESAASVHHLHIASFLQQRRHAHAMAKFFRRSSSKMGGLRGDDVTASMPRER  60
            MALRSCARVESAASVHHLHIASFLQQRRHAHAMAKFFRRSSSKMGGLRGDDVTASMPRER
Sbjct  1    MALRSCARVESAASVHHLHIASFLQQRRHAHAMAKFFRRSSSKMGGLRGDDVTASMPRER  60

Query  61   VTLSGVTASAVTASNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGSVRESTRRA  120
            VTLSGVTASAVTASNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGSVRESTRRA
Sbjct  61   VTLSGVTASAVTASNYSSYQLDTLHETVASMNKQLDEYKRETIARLDHVEGSVRESTRRA  120

Query  121  ISNQATNHIVPAKAYRDEPTGFENTsdapapsmamdaaVDEMKRHVDGIRRDVMMELHTT  180
            ISNQATNHIVPAKAYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTT
Sbjct  121  ISNQATNHIVPAKAYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTT  180

Query  181  KYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRTEDRKLSVMSDATVSSEADSEDS  240
            KYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRTEDRKLSVMSDATVSSEADSEDS
Sbjct  181  KYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRTEDRKLSVMSDATVSSEADSEDS  240

Query  241  THEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFRESTRAssklsressklsressklsr  300
            THEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFRESTRASSKLSRESSKLSRESSKLSR
Sbjct  241  THEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFRESTRASSKLSRESSKLSRESSKLSR  300

Query  301  essklsresskllfresTRQPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAI  360
            ESSKLSRESSKLLFRESTRQPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAI
Sbjct  301  ESSKLSRESSKLLFRESTRQPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAI  360

Query  361  NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSA  420
            NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSA
Sbjct  361  NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSA  420

Query  421  ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVL  480
            ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVL
Sbjct  421  ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVL  480

Query  481  DAVDEDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPF  540
            DAVDEDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPF
Sbjct  481  DAVDEDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPF  540

Query  541  AADCTIAVQSVMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELP  600
            AADCTIAVQSVMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELP
Sbjct  541  AADCTIAVQSVMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELP  600

Query  601  KTLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKL  660
            KTLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKL
Sbjct  601  KTLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKL  660

Query  661  GQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKG  720
            GQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKG
Sbjct  661  GQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKG  720

Query  721  NVPYKPSKKPKVTFDV  736
            NVPYKPSKKPKVTFDV
Sbjct  721  NVPYKPSKKPKVTFDV  736

>SPRG_06355
Length=713

 Score = 1291 bits (3340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 671/717 (94%), Positives = 688/717 (96%), Gaps = 11/717 (2%)

Query  20   IASFLQQRRHAHAMAKFFRRSSSKMGGLRGDDVTASMPRERVTLSGVTASAVTASNYSSY  79
            + SFLQ RRHAHAMAKFFRRS+SKM  LRGDDVTASMPRERVTLSGVTASA+TASNYSSY
Sbjct  8    LQSFLQPRRHAHAMAKFFRRSASKMS-LRGDDVTASMPRERVTLSGVTASAITASNYSSY  66

Query  80   QLDTLHETVASMNKQLDEYKRETIARLDHVEGSVRESTRRAISNQATNHIVPAKAYRDEP  139
            QLDTLHETVASMNKQLDEYKRETIARLDHVEG+VR+STRRAISNQATNHIVPAKAYRDEP
Sbjct  67   QLDTLHETVASMNKQLDEYKRETIARLDHVEGTVRDSTRRAISNQATNHIVPAKAYRDEP  126

Query  140  TGFENTsdapapsmamdaaVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV  199
            TGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV
Sbjct  127  TGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLV  186

Query  200  DAMHQQSTPRAVATPLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPA  259
            DAMHQQ  PRA ATPLLRTEDRKLSVMSDATVSSEADSE ST EEPEVFEPNPKVPYLPA
Sbjct  187  DAMHQQ--PRAAATPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPA  244

Query  260  ASRTPSPPKRESTVFRESTRAssklsressklsressklsressklsresskllfresTR  319
            ASRTPSPPKRESTV RES RASSKLSRESSKLSRESSK+SRESSKL RES        TR
Sbjct  245  ASRTPSPPKRESTVVRESIRASSKLSRESSKLSRESSKISRESSKLFRES--------TR  296

Query  320  QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL  379
            QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL
Sbjct  297  QPIKDQALTQPWENVLNQHLPFLNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVL  356

Query  380  NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAILMSLAHQISCKLPDYQQQ  439
            NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHA SAILMSLAHQISCKLPD+QQQ
Sbjct  357  NVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATSAILMSLAHQISCKLPDFQQQ  416

Query  440  LVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLA  499
            LVRLNL YLIQEPDP+VLATKLLIEPLRSMPAPLESQVIVLDAVDED STPG NLISLLA
Sbjct  417  LVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLA  476

Query  500  DVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDD  559
            DVALEFPSWVLFLLSSR V+SVLKALP HDVLHFHMEHRPFAADCTIAVQS+MDKHGLDD
Sbjct  477  DVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDD  536

Query  560  KNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKYGKGR  619
            KNILFLLKAKSQGSFLYLQFVDQAF+MIHSEIDAGMILELPKTL+EIYDQVFEEKYGKGR
Sbjct  537  KNILFLLKAKSQGSFLYLQFVDQAFAMIHSEIDAGMILELPKTLYEIYDQVFEEKYGKGR  596

Query  620  RRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVD  679
            RRVWQKVQ VLEAIVGAAT+SHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIV VD
Sbjct  597  RRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVD  656

Query  680  EDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKGNVPYKPSKKPKVTFDV  736
            E+TGVYRLQSKGLFDYLVDT+RSQEV HINVERG+HYLTKGNVPYKPSKKPKVTFD+
Sbjct  657  EETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTKGNVPYKPSKKPKVTFDI  713

>PYIR_13418
Length=747

 Score = 278 bits (711),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 180/574 (31%), Positives = 295/574 (51%), Gaps = 74/574 (13%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRT  218
            + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +          +R+
Sbjct  176  LSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKG---------VRS  226

Query  219  EDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFREST  278
             D      S A V +EA  E S+ E             L   SRT +    ++T  R +T
Sbjct  227  LD-----ASGAAVGAEAQPELSSDE-------------LDTISRTTALYTSKATKERRAT  268

Query  279  RAssklsressklsressklsressklsresskllfresTRQPIKDQALTQPW-ENVLNQ  337
            R  S      +                               P+ D AL+ P  ++ +++
Sbjct  269  REDSAPVLVRASSRLTQLA-----------------------PVADDALSTPLLQHQIDE  305

Query  338  HLPFLNT----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLL  393
              P +      Q  A    PS+R WAI ++ +W           +L +VG  G+GKSTL 
Sbjct  306  MFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLT  365

Query  394  SHLVSNYPEQIMASHFVRYD--ERHAPSAILMSLAHQISCKLPDYQQQLVRLNLPYLIQE  451
              L   + + ++A H   +D   + +P  +L+SL +Q+   LP ++ QL RLNL Y+++E
Sbjct  366  GALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEE  425

Query  452  PDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFPSWVLF  511
             DP+VLA K+L++PL ++  PL ++V V D +D+  S    +L+  LA +  E P+WV  
Sbjct  426  TDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGV  485

Query  512  LLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDDKNI---LFLLKA  568
             ++S+    +   L    +L F  ++  +  D  I +  ++      DK++     +LK 
Sbjct  486  FITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN--FSDKDVPQAREILKR  543

Query  569  KSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEIYDQVFEEKYGKGRRRVW  623
            KS G+F +L F  QA S    E D G I      +LP++++EIY+++FE+K+GKGR R+W
Sbjct  544  KSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIW  603

Query  624  QKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDEDTG  683
            +KVQ +LE IV AA+  +       +TE+  Q  F L + D+  I R+F DI+ V+   G
Sbjct  604  KKVQPLLELIVTAASGPY-----ALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNH--G  656

Query  684  VYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
             YR+++  LF++LVD  R+ E  +++V  G++ L
Sbjct  657  TYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690

>HYAP_07104
Length=721

 Score = 267 bits (683),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 178/582 (31%), Positives = 291/582 (50%), Gaps = 88/582 (15%)

Query  161  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTP------RAVATP  214
            E+K+ V  IR+ V+ ELH T+YD+LKE+ +L+GA+ QL       +T       R+V+ P
Sbjct  155  EVKQEVAAIRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP  214

Query  215  LLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVF  274
            L  + DR       +T++S A  +         ++P P     PAA              
Sbjct  215  L-SSADRGALTRQTSTMTSSATRDRLAASRVNTYKPPP-----PAA--------------  254

Query  275  RESTRAssklsressklsressklsressklsresskllfresTRQPIKDQALTQPWENV  334
            R S R +                                       P+ D AL+ P  +V
Sbjct  255  RASVRLTQLA------------------------------------PVADSALSTPLSSV  278

Query  335  -LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGK  389
             +N   P ++        A  + P +RTWA+ +  +W +         +L VVG  G+GK
Sbjct  279  QMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGK  338

Query  390  STLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPDYQQQLVRLNLPY  447
            S     +   Y  Q++A+H  ++D +   +P  +L+S+ HQ+   LP ++ QL RLNL Y
Sbjct  339  SAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKY  398

Query  448  LIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGAN-LISLLADVALEF  505
            +++E DP++LA+K+L++PL ++  P++   +++D +D+ +V   G N L+  LA +  + 
Sbjct  399  VLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQL  458

Query  506  PSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDD-KNILF  564
            PSW+  ++SS+    + K LP   VL F  ++  F AD +  V  +      +D +    
Sbjct  459  PSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKE  518

Query  565  LLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEIYDQVFEEKYGKGR  619
            +LK KS G+F YL+F  QA S + S    G++      ELP+TL++IY ++FE+K+G GR
Sbjct  519  VLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGR  578

Query  620  RRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVT  677
             RVW K + VL+  +GA        A P+  VTE   Q  F+L   DL L+ RSF D+V 
Sbjct  579  ARVWSKAEQVLQLAIGA-------TAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVA  631

Query  678  VDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
            V    G+YR+++  L  +L D AR++E  + N++  +  L K
Sbjct  632  VKH--GIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRK  671

>PHYRA_81098
Length=741

 Score = 255 bits (652),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 175/572 (31%), Positives = 276/572 (48%), Gaps = 84/572 (15%)

Query  168  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRTEDRKLSVMS  227
             IRR+VM ELH T+YD+LKE+ +L+GA+ QL  A  Q  +P A  +    +    LS   
Sbjct  162  AIRREVMNELHVTRYDVLKELALLKGAIAQL--AATQHLSPAASVSSTESSSSDPLSADE  219

Query  228  DATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFRESTRAssklsre  287
             A ++ +  ++ S+     +      +       +TP P  R S    +           
Sbjct  220  RAALTRQTSTKTSSATRERLAASRANI------HKTPPPAARASVRLTQLA---------  264

Query  288  ssklsressklsressklsresskllfresTRQPIKDQALTQPWE-NVLNQHLPFLNTQR  346
                                             P+ D AL+ P     +N   P ++   
Sbjct  265  ---------------------------------PVADNALSTPLTPQQINDMFPLIDFTS  291

Query  347  P----AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPE  402
                 A  + P +RTWA+ +  +W           +L VVG  G GKS  L  +   +  
Sbjct  292  ELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRG  351

Query  403  QIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIVLATK  460
             ++A+H  ++D +   +P  +L+S+ HQ+   LP ++ QL RLNL Y+++E DP VLA K
Sbjct  352  NLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGK  411

Query  461  LLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GAN-LISLLADVALEFPSWVLFLLSSRLV  518
            +L++PL +M  P+ +  +++D +D+  + P G N L+   A V    PSWV F++SS+  
Sbjct  412  VLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFMVSSKPS  471

Query  519  ESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM----DKHGLDDKNILFLLKAKSQGSF  574
              + K LP   VL F  ++  F +D +  V+ V     D    + K +   LK KS G+F
Sbjct  472  SKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKV---LKQKSGGNF  528

Query  575  LYLQFVDQAFS---MIHSEIDAGMIL----ELPKTLHEIYDQVFEEKYGKGRRRVWQKVQ  627
             YL+F  QA S   M  +  +  + L    ELP+TL++IY ++FE+K+G+GR RVW K +
Sbjct  529  AYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAK  588

Query  628  AVLEAIVGAATISHEKNACPF--VTESDVQHIFKLGQPDLALIARSFEDIVTVDEDTGVY  685
             +L+ IVGAA       A P+  VTE   +  F L   DL ++  SF D+V V    G Y
Sbjct  589  PLLQLIVGAA-------AGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRH--GAY  639

Query  686  RLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
            R++S  L  +L D ARS+E  +  ++  I  L
Sbjct  640  RIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671

>PHYCA_511415
Length=744

 Score = 248 bits (634),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 143/418 (34%), Positives = 230/418 (55%), Gaps = 28/418 (7%)

Query  321  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  +  +N+  P ++        A  + P +RTWA+ +  +W         
Sbjct  271  PVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGT  330

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L VVG  G GKS  L  +   +   ++A+H  ++D +   +P  +L+S+ HQ+   L
Sbjct  331  DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  390

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GA  492
            P ++ QL RLNL Y+++E DPI+LA K+L++PL +M  P+ +  +++D +D+  + P G 
Sbjct  391  PLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGR  450

Query  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
            N L+   A V  + PSW+ FL+SS+    + K LP   VL F  ++  F AD +  V  +
Sbjct  451  NELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDI  510

Query  552  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTL  603
                  DD      +LK KS G+F YL+F  QA S            +  G++ ELP+TL
Sbjct  511  ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETL  570

Query  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661
            ++IY ++FE+K+G+GR RVW K + +L+ +VGAA+        P+  VTE   +  FKL 
Sbjct  571  YDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAS-------GPYSPVTEEQAKEHFKLT  623

Query  662  QPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
              DL ++ RSF D+V V    G YR++S  L  +L D ARS+E  + +++  +H L K
Sbjct  624  AEDLRMLRRSFVDLVAVKH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRK  679

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203
            V E+K  V  IRR+VM ELH T+YD+LKE+T+L+GA+ QL  A H
Sbjct  161  VLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQH  205

>PITG_18458
Length=747

 Score = 247 bits (630),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 230/420 (55%), Gaps = 32/420 (8%)

Query  321  PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P     +N+  P +++       A  + P TRTWA+ +  +W         
Sbjct  270  PVADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGN  329

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L VVG  G GKST    +   +   ++A+H  ++D +   +P  +L+S+ HQ+   L
Sbjct  330  DTLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSL  389

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGA  492
            P ++ QL RLNL Y+++E DP +LA K+L++PL ++  P+ +  I++D +D+  V + G 
Sbjct  390  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGR  449

Query  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
            N L+ L A V  + PSWV FL+SS+    + K LP   VL F  ++  F AD +  V  +
Sbjct  450  NELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDI  509

Query  552  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG---------MILELPK  601
                  DD      +LK KS G+F YL+F  QA S  H  I A          ++ ELP+
Sbjct  510  ARNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALS--HPGIAAASKEGAVPLEVLHELPE  567

Query  602  TLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFK  659
            TL++IY ++FE+K+G+GR RVW K + +L+ +VGAA       A P+  VTE   +  F 
Sbjct  568  TLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAA-------AGPYSPVTEEQAKEHFN  620

Query  660  LGQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
            L   DL ++ RSF D+V+V    G YR++S  L  +L D ARS+E  + +V+  +  L K
Sbjct  621  LTTEDLRMLRRSFVDLVSVKH--GSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRK  678

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  159  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH  203

>PPTG_17129
Length=745

 Score = 241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 142/418 (34%), Positives = 225/418 (54%), Gaps = 28/418 (7%)

Query  321  PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P     +N+  P ++        A  + P TRTWA+ +  +W         
Sbjct  274  PVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGN  333

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L VVG  G GKS     +   +   ++A+H  ++D +   +P  +L+S+ HQ+   L
Sbjct  334  DTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  393

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVST-PGA  492
            P ++ QL RLNL Y+++E DP +LA K+L++PL +M  P+ +  +++D +D+  +   G 
Sbjct  394  PSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGR  453

Query  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
            N L+   A V  + PSWV FL+SS+    + K LP   VL F  ++  F AD +  V  +
Sbjct  454  NELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDI  513

Query  552  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMIL----ELPKTL  603
                  DD      +LK KS G+F YL+F  QA S   M  +  +  + L    ELP+TL
Sbjct  514  ARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETL  573

Query  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661
            ++IY ++FE+K+G+GR RVW K + +L+ IVGAA       A P+  +TE   +  FK  
Sbjct  574  YDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAA-------AGPYSPMTEEQAKEHFKFT  626

Query  662  QPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
              DL ++ RSF D+V V    G YR++S  L  +L D ARS+E  + +++  +  L K
Sbjct  627  AEDLRMLRRSFVDLVAVKH--GAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRK  682

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GA+ QL    H
Sbjct  163  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQH  207

>PHYSO_348903
Length=766

 Score = 238 bits (607),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 136/414 (33%), Positives = 223/414 (54%), Gaps = 24/414 (6%)

Query  321  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  +  +N+  P ++        A  + P +RTWA+ +  +W      T  
Sbjct  292  PVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGS  351

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L VVG  G GKS     +   +   ++A+H  ++D +    P  +L+S+ HQI    
Sbjct  352  DILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNY  411

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVSTPGA  492
            P ++ QL RLNL Y+++E DP++LA K+L++PL ++  P+++  +++D +D+      G 
Sbjct  412  PPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGR  471

Query  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
            N L+   A +  + P+WV FLLSS+    + K LP   VL F  E+  F AD    V+ +
Sbjct  472  NELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDI  531

Query  552  MDKHGLDD-KNILFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTL  603
                  DD      +LK KS G+F YL+F  QA S            +  G++ +LP+TL
Sbjct  532  ARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETL  591

Query  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQP  663
            ++IY ++FE+K+G+GR RVW K + +L+ +VGAA+  +       VTE   +  F L   
Sbjct  592  YDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSP-----VTEEQAREHFNLTAE  646

Query  664  DLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
            DL ++ RSF D+V V    G YR++S  L  +L D ARS+E  + +++  +  L
Sbjct  647  DLRMLRRSFVDLVAVRH--GSYRIESSALCAWLSDPARSEEQFYFSIDDALQAL  698

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMH  203
            V E+K  V  IRR+VM ELH T+YD+LKE+ +L+GAV QL  A H
Sbjct  181  VLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQH  225

>PYU1_G001733
Length=732

 Score = 237 bits (605),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/414 (31%), Positives = 233/414 (56%), Gaps = 24/414 (6%)

Query  321  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  ++ ++   P ++     Q  A +  P++R WA  ++  W         
Sbjct  270  PVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGG  329

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L +VG  G+GKSTL+  L   + + I+A H  ++D +   +P  +L+SL +Q+   L
Sbjct  330  DNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANL  389

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN  493
            P ++ QL RLNL Y+++E DP+VLA K+L++PL ++  PL ++V+++D +D+  S    +
Sbjct  390  PLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRND  449

Query  494  LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMD  553
            L+  LA +  EFP+W+   ++S+    +   L    +L F  ++  +  D  I +  ++ 
Sbjct  450  LLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDII-  508

Query  554  KHGLDDKNI---LFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG-----MILELPKTLHE  605
                 DK++     +LK KS G+F +L F  QA S    E + G     ++ +LP++++E
Sbjct  509  -GNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYE  567

Query  606  IYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDL  665
            IYD++FE+K+GKG  R+W+KVQ +L+ IV AA+  +       +TE   Q  F L + D+
Sbjct  568  IYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPY-----ALITEEQAQEQFSLSRDDI  622

Query  666  ALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
             +I R+F DI+ V    G YR+++  ++++LVD  RS E  ++N+   +  L +
Sbjct  623  RMIRRAFTDIIDVRH--GTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 36/46 (78%), Gaps = 0/46 (0%)

Query  161  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQS  206
            EMK+ +  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  + 
Sbjct  161  EMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKG  206

>PYIW_19969
Length=733

 Score = 237 bits (604),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 133/412 (32%), Positives = 230/412 (56%), Gaps = 24/412 (6%)

Query  321  PIKDQALTQPW-ENVLNQHLPFLNTQRPAMEML----PSTRTWAINQYIKWAQDAGPTNE  375
            P+ D+AL+ P  ++ +++  P +      + +      S+R WA+ ++ +W         
Sbjct  274  PVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGV  333

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
              +L +VG  G+GKSTL   L   + + I+A H   +D +   +P  +L+SL +Q+   L
Sbjct  334  DNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNL  393

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN  493
            P ++ QL RLNL Y+++E DP+VLA KLL++PL ++  P+ ++V ++D +D+  S    +
Sbjct  394  PLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRND  453

Query  494  LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMD  553
            L+  LA +  E P+W+   ++S+    +   L    +L F  ++  +  D  I +  ++ 
Sbjct  454  LLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDII-  512

Query  554  KHGLDDKNI---LFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMI-----LELPKTLHE  605
                 DK++     +LK KS G+F +L F  QA S    E D G I      +LP++++E
Sbjct  513  -GSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYE  571

Query  606  IYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDL  665
            IY+++FE+K+GKGR R+W+KVQ +LE IV AA+  +       +TE+  Q  F L + D+
Sbjct  572  IYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPY-----ALITETQAQEQFALSKEDI  626

Query  666  ALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
              I RSF DI+ V    G YR+++  LF++LVD  R+ E  +++V  G+  L
Sbjct  627  RTIRRSFVDIIDVRH--GTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQS  206
            + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  + 
Sbjct  179  LSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG  226

>PHYKE_8395
Length=1420

 Score = 233 bits (593),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/418 (33%), Positives = 223/418 (53%), Gaps = 28/418 (7%)

Query  321   PIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
             P+ D AL+ P     +N+  P ++        A  ++P TRTWA+ +  +W         
Sbjct  939   PVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGN  998

Query  376   SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKL  433
               VL VVG  G GKS     +   +   ++A+H  ++D +    P  +L+S  HQ+   L
Sbjct  999   DTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNL  1058

Query  434   PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTP-GA  492
             P ++ QL RLNL Y+++E DP +LA K+ ++PL ++  P+ +  ++++ +D+  + P G 
Sbjct  1059  PPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGR  1118

Query  493   N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
             N L+  L+ +  + PSWV F++SS+      K LP   VL F  ++  F +D +  V  +
Sbjct  1119  NELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDI  1178

Query  552   MDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMILE----LPKTL  603
                   +D      +LK KS G+F YL+F  QA S   M  +  +  + LE    LP++L
Sbjct  1179  ARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSL  1238

Query  604   HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661
              +IY ++FE+K+G+GR R+W K + +L+ IVGAA       A P+  VTE   +  F   
Sbjct  1239  FDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAA-------AGPYSPVTEGQAKEHFGFT  1291

Query  662   QPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
               DL ++ RSF D+V V    G YRL+S  L  +L D ARS+E  +++V+  +  L K
Sbjct  1292  TEDLRMLRRSFVDLVEVKH--GAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRK  1347

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDA  201
            + E+K  V  IRR+VM ELH T+YD+LKE+T+L+GAV QL  A
Sbjct  830  LQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAA  872

>CCI44111
Length=576

 Score = 222 bits (566),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/577 (27%), Positives = 287/577 (50%), Gaps = 79/577 (14%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVATPLLRT  218
            +  M++ +  +R++++  +  T+YD+LKE+  L+G V  +            + +P+   
Sbjct  60   IKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATM---------SIKIDSPI---  107

Query  219  EDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTVFREST  278
             + K++ ++  T +  A SE +   E       P    + +     +    +S++ RES 
Sbjct  108  -NAKINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESG  166

Query  279  RAssklsressklsressklsressklsresskllfresTRQPIKDQALTQPW-ENVLNQ  337
                                                   T   + +  L++P  ++ +++
Sbjct  167  -------------------------------------LPTLMTMDEANLSKPLSKDEIDE  189

Query  338  HLPFLNT----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLL  393
              P ++     +  A+++   TR WA++   KW Q        RVL +VG  GAGKSTL 
Sbjct  190  MFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLA  249

Query  394  SHLVSNYPEQIMASHFVRYDERHAPSA--ILMSLAHQISCKLPDYQQQLVRLNLPYLIQE  451
             ++   +   + A HF ++D +   S+  +++SL  Q + KL  Y++QL RLNL Y++ E
Sbjct  250  GYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILAE  309

Query  452  PDPIVLATKLLIEPLRSMPAPLESQVIVL-DAVDED-VSTPGANLISLLADVALEFPSWV  509
             +P+V+ATKLLI+PLR++P    +   VL D +D+  V     +L+ LL+ +   FPSW+
Sbjct  310  SNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWI  369

Query  510  LFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM----DKHGLDDKNILFL  565
             F+++S+   +    L  + V+H    +  F  D  I +++++     KH  +  +IL  
Sbjct  370  GFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILM-  428

Query  566  LKAKSQGSFLYLQFVDQAFS--MIHSE---IDAGMILELPKTLHEIYDQVFEEKYGKGRR  620
               KS G+ LYLQF+++A S  ++H E   +   ++ ELP+++ EI   +F++K+G+G +
Sbjct  429  --RKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQ  486

Query  621  RVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDE  680
            RVW+  + +LE IV AA   +     P V ES ++  F+L + +  +I R+F DI+    
Sbjct  487  RVWKNAKPILEVIVAAAAGPY-----PLVGESQIKQQFELRENEWRMINRAFTDIIHCGT  541

Query  681  DTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
            D   YR+ +  L+D+LV   RSQ   H+N +    +L
Sbjct  542  DG--YRIINSSLYDWLVVEKRSQHF-HLNPQAVFKFL  575

>CCA22843
Length=586

 Score = 219 bits (559),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 238/418 (57%), Gaps = 29/418 (7%)

Query  318  TRQPIKDQALTQPWE-NVLNQHLP----FLNTQRPAMEMLPSTRTWAINQYIKWAQDAGP  372
            T  P+ +  L++P + +  ++  P    F + +  A+++   TR WA+++  +W +    
Sbjct  179  TSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFK  238

Query  373  TNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSA--ILMSLAHQIS  430
            +    +L ++G  G+GKSTL  ++   +  ++ A HF ++D +   S+  +++SL  Q +
Sbjct  239  SENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFA  298

Query  431  CKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVL-DAVDED-VS  488
             K P Y++QL  LNL Y+++E +P+V+A KLLIEPLR++P    ++  VL D +D+  V 
Sbjct  299  SKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVE  358

Query  489  TPGANLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAV  548
                +L+ L++ +   FPS + F+++S+   +      +  ++H H  +  F  D  I +
Sbjct  359  NESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILM  418

Query  549  Q-SVMD---KHGLDDKNILFLLKAKSQGSFLYLQFVDQAFS--MIHSE---IDAGMILEL  599
            + S+++   KH  +  +IL     KS G+ LYLQF ++A S  ++H E   +   ++ EL
Sbjct  419  ENSILNFEPKHTNEACDILM---RKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDEL  475

Query  600  PKTLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFK  659
            P ++ +I+  +FE+K+G+G +RVW+ V+ +LEAIV AA  SH     P V E  ++  F+
Sbjct  476  PDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSH-----PLVGERQIKQRFQ  530

Query  660  LGQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717
            LG+ +  ++ RSF DI+     T  YR+ +  LF +L+   RSQ   +I+ + GI +L
Sbjct  531  LGKEEWRMMKRSFTDIICC--GTEGYRIITSSLFAWLIVENRSQHF-YIDPKAGIKFL  585

 Score = 35.0 bits (79),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 29/44 (66%), Gaps = 0/44 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAM  202
            + +M+  +  +R++++  + +T+YDL+KE+  L+G V  + + +
Sbjct  67   IQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGL  110

>PHALS_06476
Length=726

 Score = 211 bits (537),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/384 (32%), Positives = 202/384 (53%), Gaps = 26/384 (7%)

Query  321  PIKDQALTQPWENV-LNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  +  +N+  P ++        A  + P +R+WA+ +  +W         
Sbjct  273  PVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGN  332

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHA--PSAILMSLAHQISCKL  433
              +L VVG  G+GKS     +   +   ++A+H  ++D +    P  +L+S+ HQ+   L
Sbjct  333  DTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNL  392

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVS-TPGA  492
            P ++ QL RLNL Y+++E DP +LA K+LI+PL ++  P  S  I++D +D+  + + G 
Sbjct  393  PLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGR  452

Query  493  N-LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSV  551
            N L+  ++ +    PSWV FL+SS+    + K LP   VL F  ++  F AD +  V+ +
Sbjct  453  NELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDI  512

Query  552  MDKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFS-------MIHSEIDAGMILELPKTL  603
                  DD      +L  KS G+F YL+F  QA S         +  +   ++ ELP+TL
Sbjct  513  SQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETL  572

Query  604  HEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPF--VTESDVQHIFKLG  661
            ++IY ++FE+K+G+G  R W K + +L+ IVGAA       A P+  VTE   +    L 
Sbjct  573  YDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAA-------AGPYSLVTEEQAKKQLDLN  625

Query  662  QPDLALIARSFEDIVTVDEDTGVY  685
              DL ++ RSF DIV V  +   Y
Sbjct  626  ADDLRMLRRSFVDIVAVKHEEQFY  649

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)

Query  159  VDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQL  198
            V ++K  V  IRR+VM ELH T+YD+LKE+T+L+GA+ QL
Sbjct  161  VLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQL  200

>PYAP_17763
Length=794

 Score = 207 bits (528),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/413 (30%), Positives = 217/413 (53%), Gaps = 21/413 (5%)

Query  321  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  +  ++   P ++     Q  +      +R W  ++  +W         
Sbjct  305  PVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGA  364

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKL  433
              VL +VG AG+GK+   + +   Y +Q++A HF ++D +   +P  +L+SL +Q++  L
Sbjct  365  DVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSL  424

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN  493
            P ++ QL RLNL Y+++E D   L+ K+LI+PL ++  PL  + +V DA+D+  +  G N
Sbjct  425  PMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYN  484

Query  494  -LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM  552
             L   L+ +  E P W+ FL+SS+       ++P   VL F  ++  +  D    +  + 
Sbjct  485  DLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIA  544

Query  553  DK-HGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEI  606
               H  D      +LK KS G++ YL+F  QA S    E  +G +      +LP++L+EI
Sbjct  545  AVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEI  604

Query  607  YDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLA  666
            Y+++FE+K+GKGR RVW+K   VL+ I  AA+  + +     +TE ++       + ++ 
Sbjct  605  YEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQ-----ITEQNIMDSLSYTKDEVR  659

Query  667  LIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
            ++ R+F DI+++    G Y + S  ++D+L D  R  E   I+V   +  L K
Sbjct  660  MLRRAFIDIISIRH--GTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRK  710

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)

Query  161  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQ  204
            EMK+ +  I+R++M E+H T+YD+LKE+TML+G +MQLV  + Q
Sbjct  189  EMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQ  232

>PYAR_13571
Length=666

 Score = 199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 120/404 (30%), Positives = 215/404 (53%), Gaps = 38/404 (9%)

Query  321  PIKDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNE  375
            P+ D AL+ P  +  +++  P L+     Q  A      TR WA ++  +W         
Sbjct  194  PVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGS  253

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKL  433
              +L +VG AG GK+                 HF +++ +   +P  +L+S+ +Q++  L
Sbjct  254  DVLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATL  296

Query  434  PDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN  493
            P ++ QL RLNL Y+++E D + LA K+L++PL S+  PL ++ ++LD +D+     G N
Sbjct  297  PTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYN  356

Query  494  -LISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVM  552
             L+  L+ V  E PSW+ FL++++      + +P   +L F  ++  +  D  + ++ ++
Sbjct  357  DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIV  416

Query  553  DKHGLDDK-NILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG-----MILELPKTLHEI  606
                 +D+ +   +LK KS G++ YL+F  QA S    E   G     ++ +LP++L+EI
Sbjct  417  AIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEI  476

Query  607  YDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLA  666
            Y+++FE+K+GKGR R+W+K   VL+ I  AA+  + +     +TE  V       + D+ 
Sbjct  477  YEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVR  531

Query  667  LIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINV  710
            ++ R+F DI+++    G Y + S  LFD+L D  R  E  H++V
Sbjct  532  MLRRAFIDIISIRH--GTYHIVSSALFDWLTDPQRKGEPYHVDV  573

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 34/40 (85%), Gaps = 0/40 (0%)

Query  168  GIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQST  207
             IRR++M E+HT++YD+LKE+TML+G + QL++ M +++T
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTT  159

>PYVX_23590
Length=689

 Score = 177 bits (449),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 120/417 (29%), Positives = 192/417 (46%), Gaps = 65/417 (16%)

Query  318  TRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGP  372
            T  P+ D AL+ P     L++  P ++        A    P TR WA  +  +W      
Sbjct  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301

Query  373  TNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQIS  430
              +  +L VVGG G GKST    +       ++A+HF ++D +    P  +L+SL  Q+ 
Sbjct  302  VGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVV  361

Query  431  CKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVST  489
              LP +++QL RLNL Y+++EPD  VLA K+LI+PL +   P+ ++ +VLD +D+   S 
Sbjct  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSR  421

Query  490  PGA---NLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTI  546
             G     L+  LA V  + PSW+  L+SS+    +   L    +L F  +++ F  D   
Sbjct  422  RGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARF  481

Query  547  AVQSV-MDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMILELPKT  602
             V  +  +           LL+ K+ G+F YL F  QA S   +   E++  M+ +LP++
Sbjct  482  LVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGLDDGELELDMLHDLPES  541

Query  603  LHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQ  662
            L+EIY ++FE+                                                 
Sbjct  542  LYEIYLEIFED------------------------------------------------N  553

Query  663  PDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719
             D+ L+ RSF DI+ V    G YR++S  LF++L D ARS E    + + G+  L +
Sbjct  554  DDMRLVKRSFVDIIAV--RGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRR  608

 Score = 40.4 bits (93),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)

Query  161  EMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRG  193
            +++     IRR+VM ELH  +YD+LKE+T+L+G
Sbjct  157  DVRAETQAIRREVMNELHVLRYDVLKEVTVLKG  189

>PYVX_21513
Length=1446

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 101/211 (48%), Gaps = 31/211 (15%)

Query  354  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFV--R  411
            + R W   +  +W  D+    + RV  + G  G+GK+++ + +V  +PE I A HF    
Sbjct  436  TGRDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPE-IAAFHFALQE  494

Query  412  YDERHAPSAILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPI----VLATKLLIEPLR  467
             D+ H     ++SLA+Q++ +LP+Y    V L     ++E  P+     L T LL+EPL 
Sbjct  495  DDQTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLN  551

Query  468  SMPAPLESQVIVLDAVD-----EDVSTPG------------ANLISLLADVALEFPSWVL  510
            ++  P +  ++++D ++       +S PG              L+++L  +    PSWV 
Sbjct  552  TIKRPAKPLILLIDGLECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVR  611

Query  511  FLLSSRLVESVLKAL----PAHDVLHFHMEH  537
             +L SR    V+  L    P+  + HF  E+
Sbjct  612  LVLLSREDHDVMTRLQTYIPSVVIDHFAQEN  642

>SPRG_19030
Length=1000

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 83/316 (26%), Positives = 148/316 (47%), Gaps = 38/316 (12%)

Query  340  PF-LNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  398
            PF   +Q   +  L   R W + +Y  W Q     N SR+  V G  G+GKS +++ ++ 
Sbjct  433  PFSFQSQISKLTQLFVAREWVLAKYDAWVQT---PNGSRIFVVSGVIGSGKSAIMAQIIQ  489

Query  399  NYPEQIMASHFVRYDERHAPSA--ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIV  456
            N PE I A H   ++E    SA   ++SL +Q+S +LP+Y      LN    ++E  P+ 
Sbjct  490  NRPE-IAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVK  545

Query  457  ----LATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFPSWVLFL  512
                L   LLI PL ++  P    V+++D +  +   PG  + +L A + L +PSWV F+
Sbjct  546  SLVDLIHALLIAPLSAIAHPASILVLLIDGI--ECFEPGF-VATLTAHMDL-WPSWVRFV  601

Query  513  LSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAV--------QSVMDKHGLDDKNILF  564
              +R   SVL+ L A+      ++   + +   I          Q   +  G  ++ + F
Sbjct  602  FGTREDPSVLQTLQAYMPPAVSLDPSLYESKLDIKAYLHLALTPQLTTESQGKRNEIVDF  661

Query  565  LLKAKSQGSFLYLQFVDQAFSMIH---SEIDAGMILELPKTLHEIYDQVFEEKY-GKGRR  620
             + A+++G FLY + +  A ++     +E+DA      P ++       F+ ++   G  
Sbjct  662  -IAARAEGLFLYARHLVNAIAVGQLQLNELDA-----FPTSMGGCLQHCFDAQFPSIGYY  715

Query  621  RVWQKVQAVLEAIVGA  636
            +  + ++ VLE +  A
Sbjct  716  K--KTIRPVLEVLCAA  729

>H257_01934
Length=1022

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 130/287 (45%), Gaps = 49/287 (17%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W ++++ +W     P+N  RV  + G  G+GK+ L +H++ N PE ++A H   ++  
Sbjct  463  RAWVLHEFDEWVTSP-PSNARRVFLLTGVIGSGKTALAAHIIQNRPE-VVAFHLASHEGE  520

Query  416  HAPSA--ILMSLAHQISCKLPDY-----------QQQLVRLNLPYLIQEPDPIVLATKLL  462
               +    +++L +Q++ +LP Y           ++ +   NL  L+QE         LL
Sbjct  521  QTQNGRRCVLNLVYQLTTQLPAYANVLKSQKEPLEETVFVGNLADLVQE---------LL  571

Query  463  IEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVL  522
            I PL  +  P  + VI++D + E       NL+++L      +P+W+ F+ +SR    VL
Sbjct  572  IAPLERIATPPSTMVILIDGI-ECFPCADDNLVAILTASLNRWPAWMRFVFTSREDPRVL  630

Query  523  KALPAHDVLHFHMEHRPFAADCTIAVQSVMD-KHGLDDK-------------NILFLLKA  568
              L A+ +        P A D   A QS  D +  LD               +++ LL  
Sbjct  631  SLLQAYML-------PPIALDLACA-QSKRDVRQYLDTALGSHFDISPPMPPHVIDLLVD  682

Query  569  KSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKY  615
            ++QG FLY + +  + S     +D   +  +P T+     Q F  ++
Sbjct  683  RTQGLFLYARHLVDSISSGQWNLDN--LDNVPTTMGGFLHQNFATQF  727

>SDRG_07983
Length=991

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 100/196 (51%), Gaps = 18/196 (9%)

Query  340  PF-LNTQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  398
            PF   +Q   +  L   R W + +Y  W Q     N SR+  + G  G+GKS +++ ++ 
Sbjct  425  PFSFQSQISKLTQLFVAREWVLAKYDAWVQT---PNGSRIFVMSGVIGSGKSAIMAQIIQ  481

Query  399  NYPEQIMASHFVRYDERHAPSA--ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPIV  456
            N PE I A H   ++E    SA   ++SL +Q+S +LP+Y      +N    ++E  P+ 
Sbjct  482  NRPE-IAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVK  537

Query  457  ----LATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFPSWVLFL  512
                L   LLI PL ++  P    V+++D +  D   PG  + +L A + L +PSWV F+
Sbjct  538  SLVDLIHALLIAPLSAIAHPASILVLLIDGI--DCFEPGF-VATLTAHMDL-WPSWVRFV  593

Query  513  LSSRLVESVLKALPAH  528
              +R   SVL+ L A+
Sbjct  594  FGTREDPSVLQTLQAY  609

>PHYSO_470533
Length=1084

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 140/335 (42%), Gaps = 58/335 (17%)

Query  356  RTWAINQYIKWAQDAGPTN---------ESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMA  406
            R W   ++ +W Q +   +           RV  +VG  G+GK+++ + +V   PE I A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPE-IAA  530

Query  407  SHFVRYDER--HAPSAILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLI  463
             HF R ++   H     ++SLA+Q++ +LP+Y   L     L  ++     + L ++LLI
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLI  590

Query  464  EPLRSM--PAPLESQVIVLDAVDEDVSTPGAN----------------LISLLADVALEF  505
             PL ++  P   +S V+++D ++  +    ++                L+S+L  +A   
Sbjct  591  GPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRL  650

Query  506  PSWVLFLLSSRL---VESVLKALPAHDVLHFHMEHR---------------------PFA  541
            P WV  ++ SR    V S L A    DV+  H +H                       FA
Sbjct  651  PDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFA  710

Query  542  ADCTIAVQSVMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPK  601
                 AV    + H    + ++ L+  +S+G FLY   V QA +     +    + ELP 
Sbjct  711  KASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT--EGRLRLHELAELPV  768

Query  602  TLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGA  636
             +     Q F   +        Q+V+ VLE +  A
Sbjct  769  GMGAYLQQFFASHFSD-HDMYKQRVRPVLEVLCAA  802

>SPRG_12621
Length=1003

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 133/296 (45%), Gaps = 27/296 (9%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W ++Q  +W Q        +V  V G  G GKS L ++++ + PE + A H V  ++ 
Sbjct  461  REWVLDQLDQWKQ-----THDQVFWVTGQIGTGKSALAAYIIQSRPE-VRAFHLVCKEDE  514

Query  416  HAPS--AILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLIEPLRSMPAP  472
               S    ++SLA+Q++ +LP+Y   L + + L  ++     + L   LL+ PLR++  P
Sbjct  515  QTQSHRRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEP  574

Query  473  LESQ-VIVLDAVD--EDVSTPGANLISLLADVALEFPSWVLFLLSSR---LVESVLKALP  526
              +  VI+LD +D  ED       L+S L  +  + PSWV  +L+SR   +V   L+   
Sbjct  575  ATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGFA  634

Query  527  AHDVLHFHMEHRPFAADCTIAVQSVMDKH------GLDDKNILFLLKAKSQGSFLYLQFV  580
                L    +H     D    +Q  +  +      G+  +  L  +  +++G FLY   +
Sbjct  635  PQIALDKCADHS--RQDIMSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFLYASHI  692

Query  581  DQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGA  636
              A S     +D   +   P  +     Q FE ++     +  + ++ +LE +  A
Sbjct  693  VHALSQHRLTLDN--LEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLEVLCAA  744

>PITG_17250
Length=1046

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 85/330 (26%), Positives = 143/330 (43%), Gaps = 56/330 (17%)

Query  356  RTWAINQYIKWAQDAGPT----NESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVR  411
            R W    + +W Q +  +    +  RV  V+G  G+GKS++ + +V   PE I A HF  
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQACPE-IAAFHFAT  508

Query  412  YDER--HAPSAILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLIEPLRS  468
             ++   H     ++SLA+Q++ +LP+Y   L     L  ++     + L T LLI PL +
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNA  568

Query  469  M--PAPLESQVIVLDAVDEDV---STP--GAN---------LISLLADVALEFPSWVLFL  512
            +  P+  +S V+++D V+  +    TP  G +         L+S+L  +    P WV  +
Sbjct  569  IARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIV  628

Query  513  LSSRLVESVLKALPAHD-----VLHFHMEH----RPF----------------AADCTIA  547
            L SR    VL  L A D     +  F +++    R F                 A   I 
Sbjct  629  LLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIG  688

Query  548  VQSVMDKHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKTLHEIY  607
              S   + G++   ++ L+  +S+G FLY   V QA S     +    + ELP  +    
Sbjct  689  SGSDTGEFGME--QVVELIARRSEGLFLYAVNVVQAIS--EGRLRLHELAELPVGMGAYL  744

Query  608  DQVFEEKYGKGRRRVWQ-KVQAVLEAIVGA  636
             Q F   +      V++ +++ VLE    A
Sbjct  745  HQFFASHFAD--HDVYKHRIRPVLEVCCAA  772

>H310_08292
Length=1007

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 87/176 (49%), Gaps = 12/176 (7%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W ++Q  +W   A     S+   V G  G GK+ L ++++ + PE + A H V  D+ 
Sbjct  455  REWVMDQLTQWKASA-----SQTFWVTGQIGTGKTALAAYIIQSQPE-VRAFHLVSKDDE  508

Query  416  HA--PSAILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLIEPLRSMPAP  472
                P   ++SLA+Q++ +LP Y   L +   L  ++       L T LL+ PL ++  P
Sbjct  509  QTQNPRRCILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQP  568

Query  473  LE-SQVIVLDAVD--EDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKAL  525
                 VI+LD +D  +D +      +S L  +  + PSWV  + +SR   SV++ L
Sbjct  569  TTVPLVILLDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKL  624

>SDRG_04575
Length=1003

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 90/176 (51%), Gaps = 12/176 (7%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W ++Q  +W Q        +V  + G  G GKS L ++++ + PE I A H V  ++ 
Sbjct  448  REWVLHQLDQWKQ-----THDQVFWITGQIGTGKSALAAYIIQSRPE-IRAFHLVCKEDE  501

Query  416  HAPS--AILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLIEPLRSMPAP  472
               S    ++SLA+Q++ +LP+Y   L + + L  ++     + L   LL+ PL ++  P
Sbjct  502  QTQSHRRCILSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEP  561

Query  473  LESQ-VIVLDAVD--EDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKAL  525
              +  VI+LD +D  ED       L+S L  +  + PSWV  +L+SR    V++ L
Sbjct  562  ATTPLVILLDGLDSLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>PPTG_11365
Length=1106

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 83/334 (25%), Positives = 136/334 (41%), Gaps = 57/334 (17%)

Query  356  RTWAINQYIKWAQDAGPTNESR------VLNVVGGAGAGKSTLLSHLVSNYPEQIMASHF  409
            R W   Q+ +W Q +  ++ +R      V  VVG  G+GK+++ + +V + PE I A H 
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSCPE-IAAFHL  561

Query  410  -VRYDER-HAPSAILMSLAHQISCKLPDYQQQLVRLN-LPYLIQEPDPIVLATKLLIEPL  466
              + DE+ H     ++SLA+Q++ +LP+Y   L     L  ++     + L T LLI PL
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPL  621

Query  467  RSM--PAPLESQVIVLDAVDEDVSTPGAN------------------LISLLADVALEFP  506
             ++  P+  +S V+++D V+  +    ++                   +S+L  +    P
Sbjct  622  TAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLP  681

Query  507  SWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTI--------------------  546
             WV  +L SR    VL  L A D     +E      D  I                    
Sbjct  682  EWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEK  741

Query  547  -AVQSVMD---KHGLDDKNILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKT  602
             A Q   D    H    + ++ L+  +S+G FLY   V QA S     +    + ELP  
Sbjct  742  AAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS--EGRLHLHELAELPVG  799

Query  603  LHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGA  636
            +     Q F   +         +V+ VLE    A
Sbjct  800  MGAYLQQFFASHFAD-HDMYKHRVRPVLEVCCAA  832

>PYU1_G002110
Length=999

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 99/399 (25%), Positives = 171/399 (43%), Gaps = 55/399 (14%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W I Q  KW     PT  S++  V G  G+GK+ L + LV   PE I A HF   ++ 
Sbjct  432  RKWLIAQLTKWID--SPT-ASQMFWVTGQIGSGKTALAARLVQTIPE-IKAFHFAFEEDE  487

Query  416  HAPSA--ILMSLAHQISCKLPDYQQQL-VRLNLPYLIQEPDPIVLATKLLIEPLRSMPAP  472
               +A   ++SLA+Q++ +L DY   L  R  L  L+       L T LLI+PL  + A 
Sbjct  488  QTQNARRCVLSLAYQLTTQLKDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI-AQ  546

Query  473  LESQ----VIVLDAVDE------DVSTP---------GANLISLLADVALEFPSWVLFLL  513
            L+SQ    V+++D ++       DVS+             L+S L  +  + P WV  ++
Sbjct  547  LQSQNTPLVLLIDGLENLSDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVRVIV  606

Query  514  SSR---LVESVLKALPAHDVLHFHMEH-----RPFAAD--CTIAVQSVMDKHGLDDKNIL  563
             SR    + + L+    + VL  +++      + F     C+ A   +     L    I 
Sbjct  607  LSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQID  666

Query  564  FLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKYGKGRRRVW  623
             +++ +S+G FLY   V Q+       +   + + +   L++ +   F      G ++  
Sbjct  667  LIVE-RSEGLFLYAANVVQSLEEKWFAVGQSLPIGMNGYLYDFFVSHF------GAKQYK  719

Query  624  QKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDEDTG  683
            + ++ VLE +  A     E  + P +       I KL   +   IA +F  ++++  D  
Sbjct  720  RLIRPVLEVLCAA----FEPLSLPTIAS-----ILKLQTNEQQEIATAFGSLLSIGADGS  770

Query  684  VYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTKGNV  722
            V    S  L    V   +S +  +++V  G   + K  V
Sbjct  771  VRPFHSSVL--NWVQELQSVDPFYVDVATGHELIGKWAV  807

>H257_11773
Length=1026

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 87/177 (49%), Gaps = 13/177 (7%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W ++Q  +W       + S+   + G  G GK+ + + ++ N PE + A H V  ++ 
Sbjct  470  REWVMDQLTEWK-----ASSSQTFWITGQIGTGKTAVAASVIQNQPE-VRAFHLVSKEDE  523

Query  416  HAPS--AILMSLAHQISCKLPDYQQQLVRLNLPY--LIQEPDPIVLATKLLIEPLRSMPA  471
               +    ++SLA+Q++ +LPDY   L + + P   ++       L   LL+ PL ++  
Sbjct  524  QTQNHRRCVLSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQ  583

Query  472  PLE-SQVIVLDAVD--EDVSTPGANLISLLADVALEFPSWVLFLLSSRLVESVLKAL  525
            P     VI++D +D  +D +      +S LA      P WV ++L+SR   SV++ L
Sbjct  584  PSTVPLVILIDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKL  640

>PYIR_14107
Length=1176

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 94/212 (44%), Gaps = 43/212 (20%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R W   Q   W   A PT  ++V  V G  G+GK+ L + +V   PE I A HF   ++ 
Sbjct  550  REWLFMQLENWI--ASPT-ATQVFWVTGQIGSGKTALAARMVQVIPE-IAAFHFALQEDE  605

Query  416  HAPSA--ILMSLAHQISCKLPDYQQQL-VRLNLPYLIQEPDPIVLATKLLIEPLRSMPAP  472
               +A   ++SLA+Q++ +LP Y   L  R  L  ++   +   L T+LL+EPL  +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  473  LESQ--VIVLDAV-------DEDVSTPGAN---------------------------LIS  496
              ++  V+++D +       +  + TPG +                           L+S
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  497  LLADVALEFPSWVLFLLSSRLVESVLKALPAH  528
             L  +    P+WV  +L SRL  +++  L  +
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGY  757

>PYAR_14788
Length=795

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (50%), Gaps = 14/151 (9%)

Query  376  SRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFV--RYDERHAPSAILMSLAHQISCKL  433
            S+V  V G  GAGK+++ + +V   PE I A HF     D+       ++SLA+Q++ +L
Sbjct  416  SKVFWVTGQIGAGKTSVAAKMVQTIPE-IAAFHFALQEDDQTQLARRCVLSLAYQLTTQL  474

Query  434  PDYQQQLVRLNLPYLIQEPDPI----VLATKLLIEPLRSMPAPLESQ--VIVLDAVDEDV  487
            P Y    V L     ++E  P+     L   LLI PL ++  P   +  ++++D ++   
Sbjct  475  PAYA---VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLA  531

Query  488  STPG--ANLISLLADVALEFPSWVLFLLSSR  516
            S  G     +SLL  +    PSWV  +L SR
Sbjct  532  SNTGGAGGGVSLLPSLIARLPSWVRVILLSR  562

>PYIW_15717
Length=1121

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (44%), Gaps = 42/213 (20%)

Query  354  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  413
            + R W   Q   W   A P+  ++V  V G  G+GK+ L + +V   PE I A HF   +
Sbjct  523  AGREWLFAQLESWI--ASPS-AAQVFWVTGQIGSGKTALAARMVQLIPE-IAAFHFALQE  578

Query  414  ERHAPSA--ILMSLAHQISCKLPDYQQQL-VRLNLPYLIQEPDPIVLATKLLIEPLRSMP  470
            +    +A   ++SLA+Q++ +LP Y   L  R  L  ++   +   L T+LL+EPL  + 
Sbjct  579  DEQTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIA  638

Query  471  APLESQ---VIVLDAVDEDVS-------------------TPGAN-------------LI  495
             P  +    V+++D ++  VS                   + G+N             L+
Sbjct  639  RPQTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLV  698

Query  496  SLLADVALEFPSWVLFLLSSRLVESVLKALPAH  528
            S L  +    P WV  +L SR   +++  L  H
Sbjct  699  SALPSLVARLPKWVRVVLLSRKDPAIIAKLQGH  731

>PYAP_22230
Length=1116

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 75/144 (52%), Gaps = 13/144 (9%)

Query  354  STRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYD  413
            + R W +    +W  +   T+ S+V  V G  G+GK+++ + +V   PE I A HF   D
Sbjct  494  TGRAWLLESIRQWI-NTPVTSGSKVFWVTGQIGSGKTSVAARMVQLMPE-IAAFHFALQD  551

Query  414  ERHAPSA--ILMSLAHQISCKLPDYQQQLVRLNLPYLIQEPDPI----VLATKLLIEPLR  467
            +     A   ++SLA+Q++ +LP+Y    V L     ++E  P+     L T LL+ PL 
Sbjct  552  DDQTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLN  608

Query  468  SMPAPLESQ--VIVLDAVDEDVST  489
            ++  P   +  V+++D ++  VST
Sbjct  609  AIARPKSDKPVVLLIDGLEHLVST  632

>PYU1_G009543
Length=1408

 Score = 38.1 bits (87),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 4/61 (7%)

Query  338  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  396
            HL F  +++      PS     I N Y  W +DA   + S +L VVG  G GKS +L+H 
Sbjct  58   HLAFAKSRKDDFAFAPSPHYVQILNNYCHWDRDA---SHSSILVVVGQPGNGKSAMLAHW  114

Query  397  V  397
            V
Sbjct  115  V  115

>PYIR_13773
Length=1486

 Score = 36.6 bits (83),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 46/195 (24%), Positives = 81/195 (42%), Gaps = 31/195 (16%)

Query  338  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHL  396
            HL F  +++      PS +   I N Y +W +DA     S VL  +   G GKS LL+H 
Sbjct  60   HLAFAKSRKDDFVFTPSLQCMHILNDYCRWDRDA---THSSVLVAISQPGNGKSALLAHW  116

Query  397  VSNYPE------QIMASHF--VRYDERHAPSAILMSLAHQISC-------KLP-DYQQQL  440
                 E      +++  H+    YD     S  L    +QI         +LP +++++ 
Sbjct  117  ADTRRESEEGAQELIYEHYAGCSYDSVRL-SLFLFRFMNQIKTTYSLRDFELPREHEEEK  175

Query  441  VRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLAD  500
            ++ +    ++       A       L    + L+  ++VLD +D   +  G + +S L  
Sbjct  176  LKFSFGRCLE-------AAVGRTNHLTGTNSKLKRIILVLDGIDCIRNEDGGDSLSWLPT  228

Query  501  VALEFPSWVLFLLSS  515
                FPS V  ++S+
Sbjct  229  T---FPSNVRIIVSA  240

>H310_09588
Length=280

 Score = 35.4 bits (80),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 32/138 (23%)

Query  328  TQPWENVLNQHLPF----LNTQRPAMEMLPSTRTWAINQYIKWAQ--DAGPTNESRVLNV  381
            +Q   N +NQH P      +TQR   ++   T    +++    A+    G T++  V+ V
Sbjct  26   SQSKSNKVNQHAPKKPLPAHTQRVQSDL---TEAQLVSESFTLARRPSDGSTDDILVIGV  82

Query  382  VGGAGAGKSTLLSHLVSNYPEQIMA--SH-FVRYDERHA------------PSAI-----  421
             GG+G+GK+TL   ++ +  +  ++  SH F   D  H             P A+     
Sbjct  83   CGGSGSGKTTLSKAIIDDIGDNAVSYLSHDFYYKDLSHLSMEQRAEHNFDHPDALDTALL  142

Query  422  ---LMSLAHQISCKLPDY  436
               L  L H I+C +P Y
Sbjct  143  VSHLAKLKHGIACDIPMY  160

>PYIW_17208
Length=198

 Score = 33.9 bits (76),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (59%), Gaps = 0/46 (0%)

Query  375  ESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSA  420
            + R+L V+GG GAGK T  S LV  Y    +++  +  +ER + SA
Sbjct  6    KKRILFVLGGPGAGKGTQCSKLVEKYGFVHLSAGDLLREERQSGSA  51

>PHYRA_73807
Length=948

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 70/173 (40%), Gaps = 40/173 (23%)

Query  592  DAGMILELPKTLHEIYDQVFEEKYGKGRRRV----WQ------KVQAVLEAIVGAATISH  641
            D G +L +  + HE+      +K G+G   V    W+      K++AVL A+  AA I  
Sbjct  410  DTGQMLLMSPSHHELKGLEIGDKIGEGVAVVYLGKWRGANVAVKMKAVLAALENAADIVE  469

Query  642  EKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDY-----L  696
             ++AC    +++ + +  L  P++ L             + G YR     + +Y     L
Sbjct  470  FQHACNVEIQAEAEVMRGLCHPNIVLFM-----------EAGFYRGSICIISEYCARGSL  518

Query  697  VDTARSQ--EVTHIN----------VERGIHYLTKGNVP--YKPSKKPKVTFD  735
             D  + Q  EV  +N          +  GI YL   N P  ++  K P V  D
Sbjct  519  RDVLKQQQPEVKDLNWPTKLRLALGISHGIQYLHNANPPMIHRDLKSPNVLVD  571

>SPRG_08282
Length=1250

 Score = 34.3 bits (77),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (54%), Gaps = 3/52 (6%)

Query  379   LNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAILMSLAHQIS  430
             + +VG  GAGKS+L   L   YP   +AS  +  D R   +  L SL HQIS
Sbjct  1045  IGIVGRTGAGKSSLTMALFRLYP---LASGAICIDGRDIATLSLHSLRHQIS  1093

>PYIW_20824
Length=1435

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 30/59 (51%), Gaps = 4/59 (7%)

Query  338  HLPFLNTQRPAMEMLPSTRTWAI-NQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSH  395
            H+ F  +++      PS +   I N Y +W +D   T  S VL V+   G GKS LL+H
Sbjct  55   HVAFAKSRKDDFVFAPSPQCMHILNDYCQWDRD---TAHSSVLVVISQPGNGKSALLAH  110

>SDRG_09748
Length=750

 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 34/80 (43%), Gaps = 12/80 (15%)

Query  356  RTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER  415
            R  A+ Q + W + A          +VG +G GKSTLL  L+  YP          YD +
Sbjct  441  RVNAMWQAVFWGEYA---------CIVGPSGCGKSTLLGCLMQFYPISAGTLRLDSYDTQ  491

Query  416  HAPSAILMSLAHQISCKLPD  435
            H   A   SLA Q +    D
Sbjct  492  HYSKA---SLADQTAVVFQD  508

>SDRG_00244
Length=876

 Score = 33.5 bits (75),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (42%), Gaps = 14/106 (13%)

Query  573  SFLYLQ--FVDQAFSMIHSEIDAGMILELPKTLHEIYDQVFEEKYGKGRRRVWQKVQAVL  630
            +  Y Q   V  A+S +H+  DA ++  LP T+ E  + + ++ YG      W   +A  
Sbjct  728  ALFYKQHLLVMDAYSTVHAVGDAMLVASLPATMEEESNSILQQMYG-----AWTVPEAST  782

Query  631  EAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIV  676
             + +     S   N   F   S   H+     P L  + RSF D V
Sbjct  783  SSRLNKEDASKAGNGGMFAAPS---HVL----PPLRSLYRSFLDTV  821

>SPRG_14614
Length=993

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query  381  VVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAILMSLAHQISCKLPD  435
            +VG +G GKSTLL  L+  YP    A     YD +H   A   SL+ Q +    D
Sbjct  687  IVGPSGCGKSTLLGCLMQFYPISAGALRLDAYDTQHYSKA---SLSDQTAVVFQD  738

>PYU1_G014376
Length=198

 Score = 32.3 bits (72),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 0/45 (0%)

Query  375  ESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPS  419
            + R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  6    KKRILFVLGGPGAGKGTQCSKLVEKYGFVHLSAGDLLREERQSGS  50

>SDRG_09749
Length=992

 Score = 33.5 bits (75),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 3/55 (5%)

Query  381  VVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAILMSLAHQISCKLPD  435
            +VG +G GKSTLL  L+  YP          YD +H   A   SLA Q +    D
Sbjct  672  IVGPSGCGKSTLLGCLMQFYPISAGTLRLDSYDTQHYSKA---SLADQTAVVFQD  723

>PPTG_01029
Length=939

 Score = 33.5 bits (75),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 71/173 (41%), Gaps = 40/173 (23%)

Query  592  DAGMILELPKTLHEIYDQVFEEKYGKGRRRV----WQ------KVQAVLEAIVGAATISH  641
            D G  L +  + HE+      +K G+G   V    W+      K++AVL A+  AA I+ 
Sbjct  410  DTGQKLLMSPSHHELKGLEIGDKIGEGVAVVYLGKWRGANVAVKMKAVLAALESAADIAE  469

Query  642  EKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTVDEDTGVYRLQSKGLFDY-----L  696
             ++AC    +++ + +  L  P++ L             + G YR     + +Y     L
Sbjct  470  FQHACNVEIQAEAEVMRGLCHPNIVLFM-----------EAGFYRGSICIISEYCARGSL  518

Query  697  VDTARSQ--EVTHIN----------VERGIHYLTKGNVP--YKPSKKPKVTFD  735
             D  + Q  +V ++N          +  GI YL   N P  ++  K P V  D
Sbjct  519  RDVLKQQTPDVKNLNWPTKLRLALGISHGIQYLHNANPPMIHRDLKSPNVLVD  571

>CCI41333
Length=196

 Score = 32.3 bits (72),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  377  RVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPS  419
            R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  8    RILFVLGGPGAGKGTQCSKLVQKYGFVHLSAGDLLREERQSGS  50

>CCA21773
Length=196

 Score = 32.3 bits (72),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 25/43 (58%), Gaps = 0/43 (0%)

Query  377  RVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPS  419
            R+L V+GG GAGK T  S LV  Y    +++  +  +ER + S
Sbjct  8    RILFVLGGPGAGKGTQCSKLVQKYGFVHLSAGDLLREERQSGS  50

>H257_06450
Length=1259

 Score = 33.1 bits (74),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  378  VLNVVGGAGAGKSTLLSHLVSNYP  401
            +  VVGG G+GKSTLLS L+ + P
Sbjct  442  ICAVVGGVGSGKSTLLSGLLGDAP  465

>SDRG_09480
Length=565

 Score = 32.7 bits (73),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  348  AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  399
             + ++ ST++  I + I    D     E+R + V+G A AGKST L+ L+S+
Sbjct  213  GIRLVSSTKSLGIKEII---GDIKKHRENRDVCVIGAANAGKSTFLNALISH  261

>H310_03690
Length=2166

 Score = 33.1 bits (74),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 20/77 (26%), Positives = 36/77 (47%), Gaps = 4/77 (5%)

Query  363  YIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHAPSAIL  422
            +I+   D G +  ++ + ++G  G G  ++ +  VS+ PE     + VR+D R  P  + 
Sbjct  894  HIRALCDVGAS--TKTMGMIGQKGIGFKSVFA--VSDCPEIHSNGYHVRFDARSTPDNVR  949

Query  423  MSLAHQISCKLPDYQQQ  439
              L H I     +Y  Q
Sbjct  950  FILPHWIESPAAEYSNQ  966

>SPRG_08053
Length=563

 Score = 32.7 bits (73),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  348  AMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVSN  399
             + ++ ST++  I + I    D     E+R + V+G A AGKST L+ L+S+
Sbjct  213  GIRLVSSTKSLGIKEII---GDIKKHRENRDVCVIGAANAGKSTFLNALISH  261

Lambda      K        H        a         alpha
   0.318    0.131    0.375    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 59010026934

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40