Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_235901475868967224820.0
PYIW_199691475873367211784e-151
PYIR_134181475874768911631e-148
PPTG_171291475874576910377e-130
PITG_184581475874777510291e-128
PHYSO_348903147587667849979e-124
PHYRA_81098147587416749853e-122
PHYCA_511415147587444949714e-120
PYAR_13571147586666079175e-113
PYU1_G001733147587324149191e-112
PHYKE_83951475814204959533e-112
HYAP_07104147587214238928e-109
PYAP_17763147587944908761e-105
PHALS_06476147587265008055e-96
CCI44111147585764135534e-61
CCA22843147585864085282e-57
SPRG_06355147587134173423e-32
SDRG_01763147587364173318e-31
SDRG_0457513821100387870.21
SPRG_1262113821100387840.50
H310_08292138211007134830.61
H257_1177313821102675811.0
PHYSO_47053313821108488792.0
PYVX_21513138211446192782.8
PYAR_147881382179576739.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_23590

Length=689
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_23590                                                            960        0.0   
PYIW_19969                                                            458        4e-151
PYIR_13418                                                            452        1e-148
PPTG_17129                                                            404        7e-130
PITG_18458                                                            400        1e-128
PHYSO_348903                                                          388        9e-124
PHYRA_81098                                                           384        3e-122
PHYCA_511415                                                          378        4e-120
PYAR_13571                                                            357        5e-113
PYU1_G001733                                                          358        1e-112
PHYKE_8395                                                            371        3e-112
HYAP_07104                                                            348        8e-109
PYAP_17763                                                            342        1e-105
PHALS_06476                                                           314        5e-96 
CCI44111                                                              217        4e-61 
CCA22843                                                              207        2e-57 
SPRG_06355                                                            136        3e-32 
SDRG_01763                                                            132        8e-31 
SDRG_04575                                                            38.1       0.21  
SPRG_12621                                                            37.0       0.50  
H310_08292                                                            36.6       0.61  
H257_11773                                                            35.8       1.0   
PHYSO_470533                                                          35.0       2.0   
PYVX_21513                                                            34.7       2.8   
PYAR_14788                                                            32.7       9.4   

>PYVX_23590
Length=689

 Score = 960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/672 (100%), Positives = 672/672 (100%), Gaps = 0/672 (0%)

Query  18   ERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpg  77
            ERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYGGGPG
Sbjct  18   ERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYGGGPG  77

Query  78   ghaghgghaghggaDRSTAGSVRTTDVYRTTEQLRSTGLEPLAEDRVLPPAVPYGSVPHT  137
            GHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTGLEPLAEDRVLPPAVPYGSVPHT
Sbjct  78   GHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTGLEPLAEDRVLPPAVPYGSVPHT  137

Query  138  SGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVlkgavaqllaa  197
            SGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAA
Sbjct  138  SGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTVLKGAVAQLLAA  197

Query  198  lapgggdagsrpgsagsatsaattassssaelspaDRAAIGVAPTLAPVDDAALSAPLRP  257
            LAPGGGDAGSRPGSAGSATSAATTASSSSAELSPADRAAIGVAPTLAPVDDAALSAPLRP
Sbjct  198  LAPGGGDAGSRPGSAGSATSAATTASSSSAELSPADRAAIGVAPTLAPVDDAALSAPLRP  257

Query  258  EQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDtllgvvggpgtg  317
            EQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTG
Sbjct  258  EQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTG  317

Query  318  KSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLNLK  377
            KSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLK
Sbjct  318  KSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLK  377

Query  378  YVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVV  437
            YVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVV
Sbjct  378  YVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVV  437

Query  438  PQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVddiaanfadahaae  497
            PQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAE
Sbjct  438  PQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAE  497

Query  498  aRRLLETKAGGNFAYLDFTRQALSSPglddgeleldmlhdlPESLYEIYLEIFEDNDDMR  557
            ARRLLETKAGGNFAYLDFTRQALSSPGLDDGELELDMLHDLPESLYEIYLEIFEDNDDMR
Sbjct  498  ARRLLETKAGGNFAYLDFTRQALSSPGLDDGELELDMLHDLPESLYEIYLEIFEDNDDMR  557

Query  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKA  617
            LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKA
Sbjct  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKA  617

Query  618  KQQSDEADAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRYEPPANP  677
            KQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPARTSSRVSSRYEPPANP
Sbjct  618  KQQSDEADAQGHERRRMSRRESARSTASNSSSSTSSRSHSPPPARTSSRVSSRYEPPANP  677

Query  678  SKPVGILKRGRL  689
            SKPVGILKRGRL
Sbjct  678  SKPVGILKRGRL  689

>PYIW_19969
Length=733

 Score = 458 bits (1178),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 307/672 (46%), Positives = 414/672 (62%), Gaps = 81/672 (12%)

Query  18   ERDLKRAQSDGV--PLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMS-----DDVEEM  70
            +R L+RAQSD V     D++SLR+S+ V E+A RFQR+TT++++S++ +     DDVE+M
Sbjct  15   QRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDM  74

Query  71   FYg-------------ggpgghaghgghaghggaDRSTAGSVRTTDVYRTTEQLRST-GL  116
            FY                  G +            R+T GS+R TDVYRTTEQLR T  L
Sbjct  75   FYNGGDARSTSSSVRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGTANL  134

Query  117  EPLAEDRVLPPAVPYGSVPH--TSGPHADGPGG----LAALRAELADVRAETQAIRREVM  170
             PL ED VLP A    +     T+G +++G  G    L ALR EL++++ E QAIRRE+M
Sbjct  135  IPLQEDEVLPAASRTTTTSQMPTNGNYSNGNSGGGSQLDALRTELSEMKLEVQAIRREMM  194

Query  171  NELHVLRYDVLKEVTVlkgavaqllaalapgggdagsrpgsagsatsaattassssaels  230
            NE+HV RYDVLKEVT+LKG + QL+ AL   G         + +     + A+       
Sbjct  195  NEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTALFTSKATKDRRATR  254

Query  231  paDRAAIGVAPT-----LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTR  285
                + + V  +     LAPV D ALS PL   Q+DE+FPL++ S ++ A +R     +R
Sbjct  255  DESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSR  314

Query  286  DWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKA  345
            +WA  R QEW+DSRFNVG D LL +VG  G+GKST  G++ D    N++A H C FDRK+
Sbjct  315  EWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKS  374

Query  346  KSTPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPIT  405
            KS+PR VLLSLV Q+++NLP FK QLARLNLKYVLEE D  VLA K+L+DPL A EEP+T
Sbjct  375  KSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMT  434

Query  406  AKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSL  465
            AK  ++DGLDQCK+  RG  RN+LL+FLA ++P+LP+W+GV ++SKP+PEL  +L  +SL
Sbjct  435  AKVFMIDGLDQCKS--RG--RNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSL  490

Query  466  LDFSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPgl  525
            LDFS KN  ++ D   +++DI  +F+D    +AR +L+ K+GGNF +LDFT+QALS PG+
Sbjct  491  LDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM  550

Query  526  ddgelel--dmlhdlPESLYEIYLEIFED-------------------------------  552
            ++    +  D+LHDLPES+YEIY EIFED                               
Sbjct  551  EEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALI  610

Query  553  ------------NDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDAD  600
                         +D+R ++RSFVDII VR G YRIE+SALFEWL DP R+GE F+ D  
Sbjct  611  TETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVS  670

Query  601  AGVDELRRLQQH  612
             G+  LR+L   
Sbjct  671  GGMSALRQLHHQ  682

>PYIR_13418
Length=747

 Score = 452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 301/689 (44%), Positives = 410/689 (60%), Gaps = 101/689 (15%)

Query  18   ERDLKRAQSDGVPL--PDDESLRLSRQVAEDALRFQRHTTLSSASSA-----MSDDVEEM  70
            ++ L+RAQSD V +   D+E+LR+S+ V E+A RFQR+TT+++++++     MSDDVEEM
Sbjct  15   QKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEEM  74

Query  71   FYg--------------------ggpgghaghgghaghggaDRSTAGSVRTTDVYRTTEQ  110
            FY                                   +G A R+T GS+R TD+YRTTEQ
Sbjct  75   FYNGSANGNANPSASARSTDNFGRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRTTEQ  134

Query  111  LRSTGLEPLAEDRVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVM  170
            +R T L PL ED VLP A        T    ++G   + ALRAEL++++ E QAIRRE+M
Sbjct  135  MRGTNLMPLQEDEVLPAA---SRATTTMATASNGGNPIDALRAELSEMKLEVQAIRREMM  191

Query  171  N-----------ELHVLRYDVLKEVT------Vlkgavaqllaalapgggdagsrpgsag  213
            N           E+ +L+  +++ VT      V     +            +     +  
Sbjct  192  NEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTIS  251

Query  214  satsaattassssaelspaDRAAIGVAPT-----LAPVDDAALSAPLRPEQLDELFPLVD  268
              T+  T+ ++     +  D A + V  +     LAPV D ALS PL   Q+DE+FPLV+
Sbjct  252  RTTALYTSKATKERRATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVE  311

Query  269  ASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDM  328
             ST++ AFA+   P +R+WA  R QEW+DSRFNVG D LL +VG  G+GKST  G++CD 
Sbjct  312  CSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDK  371

Query  329  LQGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVL  388
               NV+A H C FDRK+KS+PR VLLSLV Q+++NLP FK QLARLNLKYVLEE D  VL
Sbjct  372  FHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVL  431

Query  389  AGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLV  448
            A KVL+DPL A EEP+TAK  V DG+DQCK+  +G  RN+LL+FLA ++P+LP+W+GV +
Sbjct  432  ARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KG--RNDLLDFLAVIIPELPTWVGVFI  487

Query  449  SSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGG  508
            +SKP+PEL  +L  TSLLDFS KN  ++ D   L++DI  NF+D    +AR +L+ K+GG
Sbjct  488  TSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGG  547

Query  509  NFAYLDFTRQALSSPglddgelel--dmlhdlPESLYEIYLEIFED--------------  552
            NF +LDFT+QALS PG+++    +  D+LHDLPES+YEIY EIFED              
Sbjct  548  NFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQ  607

Query  553  -----------------------------NDDMRLVKRSFVDIIAVRGGCYRIESSALFE  583
                                          +D+R ++R+FVDIIAV  G YRIE+SALFE
Sbjct  608  PLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFE  667

Query  584  WLSDPARSGESFFFDADAGVDELRRLQQH  612
            WL DP R+GE F+ D   G++ LR+L   
Sbjct  668  WLVDPQRAGEQFYVDVSGGMNLLRQLHHQ  696

>PPTG_17129
Length=745

 Score = 404 bits (1037),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 308/769 (40%), Positives = 422/769 (55%), Gaps = 146/769 (19%)

Query  25   QSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgghaghgg  84
            + +G    D++SLRL +   +D +RF R TTL+   + ++DDVEEMFY            
Sbjct  19   KKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVN-VTDDVEEMFY------------  65

Query  85   haghggaDRSTAGSVRTTDVYRTTEQLRSTG--LEPLAED----------------RVLP  126
                    RST+ +      YRTTEQ+R+    L  L ED                    
Sbjct  66   -------GRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFSTTT  118

Query  127  PAVPYGSVP-------------HTSGPHADGPGG---LAALRAELADVRAETQAIRRE--  168
            P+    S P             H++   +    G   L  LR+E+ +V+ E +AIRRE  
Sbjct  119  PSNYAASTPGNFSSTYHGFNTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVM  178

Query  169  ---------VMNELHVLRYDVLKEVTVlkgavaqllaalapgggdagsrpgsagsatsaa  219
                     V+ EL +L+   + ++T  + +    +++      D  S    A      +
Sbjct  179  NELHVTRYDVLKELALLK-GAIAQLTATQHSAPPSVSSTESSSSDPLSAEERAALTRQTS  237

Query  220  ttassssaelspaDRAAIGVAP-----------TLAPVDDAALSAPLRPEQLDELFPLVD  268
            T  S ++ +   A R  I   P            LAPV D ALS PL P+Q++E+FPL+D
Sbjct  238  TKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLID  297

Query  269  ASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDM  328
             ++++AA AR   PGTR WA  RV+EWLD+RFNVG DTLL VVG  GTGKS FCG+V   
Sbjct  298  FTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQ  357

Query  329  LQGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVL  388
             +GN+LA H C+FDRK+KS+PR VLLS+V Q+V NLP FK QLARLNLKYVLEE D F+L
Sbjct  358  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLL  417

Query  389  AGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLV  448
            AGKVL+DPL A EEP+ A  +++DG+DQC     G  RNELLEF A V+PQLPSW+G L+
Sbjct  418  AGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNG--RNELLEFFAQVIPQLPSWVGFLI  475

Query  449  SSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGG  508
            SSKP+ +LA +L  +S+LDFS KN  FV D   +VDDIA NF+D   AEA+++L+ K+GG
Sbjct  476  SSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGG  535

Query  509  NFAYLDFTRQALSSPglddgeleld----mlhdlPESLYEIYLEIFEDN-----------  553
            NFAYL+FT+QALS PG+     E      +LH+LPE+LY+IY EIFED            
Sbjct  536  NFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGK  595

Query  554  --------------------------------DDMRLVKRSFVDIIAVRGGCYRIESSAL  581
                                            +D+R+++RSFVD++AV+ G YRIESSAL
Sbjct  596  AKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSAL  655

Query  582  FEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKAKQQSDEADAQGHErrrmsrresar  641
              WLSDPARS E F+F  D  +  LR++++  ++ +      + + G             
Sbjct  656  CAWLSDPARSEEQFYFSIDDALQALRKMRRVSSSGSSSGHSGSSSDG-------------  702

Query  642  stasnsssstssrshspppartssrVSSRYEPPANPS-KPVGILKRGRL  689
                   ++  + S     ++T  R  +R+EP ANP  KPVGILKR +L
Sbjct  703  ------KATHRASSRVKTSSKTHQRAHTRHEPRANPDFKPVGILKRNKL  745

>PITG_18458
Length=747

 Score = 400 bits (1029),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 309/775 (40%), Positives = 415/775 (54%), Gaps = 152/775 (20%)

Query  25   QSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgghaghgg  84
            + +G    D++SLRL +   +D +RF R TTL+   + ++DDVEEMFY            
Sbjct  15   KKEGAWALDEDSLRLKQTQDDDPVRFDRSTTLADTVN-VTDDVEEMFY------------  61

Query  85   haghggaDRSTAGSVRTTDVYRTTEQLRSTG--LEPLAED-------------RVLPPAV  129
                    RST+ +      YRTTEQLR     L  L ED                    
Sbjct  62   -------GRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFSATT  114

Query  130  PYGSVPHTSGPHADGPGGLAA-------------------LRAELADVRAETQAIRREV-  169
            P      T G       GL                     LR+E+ +V+ E +AIRREV 
Sbjct  115  PSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIRREVM  174

Query  170  ----------MNELHVLRYDVLKEVTVlkgavaqllaalapgggdagsrpgsagsatsaa  219
                      + EL +L+   + ++T  +      +++      D  S    A      +
Sbjct  175  NELHVTRYDVLKELALLK-GAIAQLTATQHIAPASVSSTESSSSDPLSPDERAALTRQTS  233

Query  220  ttassssaelspaDRAAIGVAP-----------TLAPVDDAALSAPLRPEQLDELFPLVD  268
            T  S ++ +   A R  I   P            LAPV D ALS PL P+Q++E+FPL+D
Sbjct  234  TKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEMFPLID  293

Query  269  ASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDM  328
            +++++AA AR   PGTR WA  RV+EWLD+R+N+G DTLL VVG  GTGKSTFCG+V   
Sbjct  294  STSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCGTVAQQ  353

Query  329  LQGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVL  388
             +GN+LA H C+FDRK+KS+PR VLLS+V Q+V +LP FK QLARLNLKYVLEE D F+L
Sbjct  354  FRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEADPFLL  413

Query  389  AGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLV  448
            AGKVL+DPL A EEP+ A  +++DG+DQC     G  RNELLE  A V+PQLPSW+G LV
Sbjct  414  AGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNG--RNELLELFAQVIPQLPSWVGFLV  471

Query  449  SSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGG  508
            SSKP+ +LA +L  +S+LDFS KN  FV DA  LVDDIA NF+D  AAEA+++L+ K+GG
Sbjct  472  SSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKKSGG  531

Query  509  NFAYLDFTRQALSSPglddgeleld----mlhdlPESLYEIYLEIFED------------  552
            NFAYL+FT+QALS PG+     E      +LH+LPE+LY+IY EIFED            
Sbjct  532  NFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGK  591

Query  553  -------------------------------NDDMRLVKRSFVDIIAVRGGCYRIESSAL  581
                                            +D+R+++RSFVD+++V+ G YRIESSAL
Sbjct  592  AKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIESSAL  651

Query  582  FEWLSDPARSGESFFFDADAGVDELRRLQQ------HVAAKAKQQSDEADAQGHErrrms  635
              WLSDPARS E F+F  D  +  LR++++                 +A   GH      
Sbjct  652  CAWLSDPARSEEQFYFSVDDALLALRKIRRVGSSSSSSGHSGNSSDGKAAKNGH------  705

Query  636  rresarstasnsssstssrshspppartssrVSSRYEPPANPS-KPVGILKRGRL  689
                         +S+   +     ++T  R  +RYEP  +P  KPVGILKR +L
Sbjct  706  -------------ASSRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKRNKL  747

>PHYSO_348903
Length=766

 Score = 388 bits (997),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 307/784 (39%), Positives = 417/784 (53%), Gaps = 155/784 (20%)

Query  21   LKRAQSDGVPLPDDESLRLSRQVAEDA-LRFQRHTTLSSASSAMSDDVEEMFYgggpggh  79
            L  ++ D     D++SLRL +Q  +DA +R+ R  TLS   + ++DDVE+MFYG      
Sbjct  18   LGSSKKDAAWALDEDSLRL-KQAQDDAPVRYDRSGTLSDTVN-VTDDVEDMFYGRN----  71

Query  80   aghgghaghggaDRSTAGSVRTTDVYRTTEQLRST--GLEPLAEDRVLPPAVP-------  130
                        +RSTA +      YRTTEQLR T   L  L ED   P A         
Sbjct  72   ------------NRSTASAASDVPQYRTTEQLRDTHLTLSALHEDAETPSATNNLSSSFS  119

Query  131  -------------------------------------YGSVPHTSGPHADGPGGLAALRA  153
                                                 + ++P T G      G L  LRA
Sbjct  120  QFSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRA  179

Query  154  ELADVRAETQAIRRE-----------VMNELHVLRYDVLKEVTVlkgavaqllaalapgg  202
            E+ +V+ E +AIRRE           V+ EL +L+   + ++T  + +    +++     
Sbjct  180  EVLEVKEEVKAIRREVMNELHVTRYDVLKELALLK-GAVAQLTAAQHSSPPSVSSTDSSS  238

Query  203  gdagsrpgsagsatsaattassssaelspaDRAAIGVAP-----------TLAPVDDAAL  251
             D  S    A      +T  S ++ E   A RA +   P            LAPV D AL
Sbjct  239  LDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDAL  298

Query  252  SAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDtllgvv  311
            S PL  +Q++E+FPL+D ++++AA AR   PG+R WA  RV+EWLDSRFN G D LL VV
Sbjct  299  STPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVV  358

Query  312  ggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQL  371
            G  GTGKS FCG+V    +GN+LA H C+FDRK+KSTPR VLLS+V Q+V N PPFK QL
Sbjct  359  GEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQL  418

Query  372  ARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLE  431
            ARLNLKYVLEE D  +LA KVL+DPL A EEP+ A  +++DG+DQC    +G  RNELLE
Sbjct  419  ARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQG--RNELLE  476

Query  432  FLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVddiaanfa  491
            F A ++PQLP+W+G L+SSKP+ +LA +L  +S+LDFS +N  FV D   LV+DIA NF+
Sbjct  477  FFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFS  536

Query  492  dahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleld----mlhdlPESLYEIYL  547
            D    +A+ +L+ K+GGNFAYL+FT+QALS PG+     E      +L+DLPE+LY+IY 
Sbjct  537  DDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYA  596

Query  548  EIFEDN-------------------------------------------DDMRLVKRSFV  564
            EIFED                                            +D+R+++RSFV
Sbjct  597  EIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFV  656

Query  565  DIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKAKQQSDEA  624
            D++AVR G YRIESSAL  WLSDPARS E F+F  D  +  LR++++  ++ +      +
Sbjct  657  DLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSGSSSGHSGS  716

Query  625  DAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRYEPPANPS-KPVGI  683
             + G        R ++R    +   S                   ++EP ANP  KPVGI
Sbjct  717  SSDGTTSAPTLSRTTSRGATKSHHRSHV-----------------KHEPRANPDYKPVGI  759

Query  684  LKRG  687
            LKRG
Sbjct  760  LKRG  763

>PHYRA_81098
Length=741

 Score = 384 bits (985),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 298/674 (44%), Positives = 383/674 (57%), Gaps = 126/674 (19%)

Query  33   DDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgghaghgghaghggaD  92
            D++SLRL +Q  +DALR  R TTL+   + ++DDVEEMFYG                   
Sbjct  24   DEDSLRL-KQTQDDALRLDRSTTLTDTVN-VTDDVEEMFYG------------------G  63

Query  93   RSTAGSVRTTDVYRTTEQLRSTG--LEPLAEDRVLP-----------------PAVPYGS  133
            RST   V     YRTTEQLR T   L  L ED                      A   G 
Sbjct  64   RSTVSDVPQ---YRTTEQLRGTHMTLSALHEDAEASNASSSFSQFSATTPSNYAASTPGH  120

Query  134  VPHTSGPHADGPGGLAALRA-----ELADVRAETQ-------AIRREVMN----------  171
            VP+  G + D     +  RA     EL  +R+E         AIRREVMN          
Sbjct  121  VPN-QGAYHDFSTAHSTTRAISDAFELERLRSEVVEVKEEVKAIRREVMNELHVTRYDVL  179

Query  172  -ELHVLRYDVLKEVTVlkgavaqllaalapgggdagsrpgsagsatsaattassssaels  230
             EL +L+  + +       + A  +++      D  S    A      +T  SS++ E  
Sbjct  180  KELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAALTRQTSTKTSSATRERL  239

Query  231  paDRAAIGVAP-----------TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARA  279
             A RA I   P            LAPV D ALS PL P+Q++++FPL+D ++++AA AR+
Sbjct  240  AASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFPLIDFTSELAAHARS  299

Query  280  RAPGTRDWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFC  339
              PG+R WA  RV+EWLD+RFNVG DTLL VVG  GTGKS F G+V    +GN+LA H C
Sbjct  300  LTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCC  359

Query  340  KFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAA  399
            +FDRK+KS+PR VLLS+V Q+V +LPPFK QLARLNLKYVLEE D FVLAGKVL+DPL A
Sbjct  360  QFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADPFVLAGKVLVDPLNA  419

Query  400  CEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQ  459
             EEP+ A  +++DG+DQC    RG  RNELLEF A V+P LPSW+G +VSSKP+ +LA +
Sbjct  420  MEEPMHATFMLVDGIDQCSAGPRG--RNELLEFFAQVIPLLPSWVGFMVSSKPSSKLAKR  477

Query  460  LKFTSLLDFSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQA  519
            L  +S+LDFS KN  FV D   LV+D+A NF+D  AAEA+++L+ K+GGNFAYL+FT+QA
Sbjct  478  LPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSGGNFAYLEFTKQA  537

Query  520  LSSPglddgele----ldmlhdlPESLYEIYLEIFEDN----------------------  553
            LS PG+     E    L +LH+LPE+LY+IY EIFED                       
Sbjct  538  LSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGA  597

Query  554  ---------------------DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSG  592
                                 +D+R+++ SFVD++AVR G YRIESSAL  WLSDPARS 
Sbjct  598  AAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSALCGWLSDPARSE  657

Query  593  ESFFFDADAGVDEL  606
            E F+F  D  +  L
Sbjct  658  EQFYFAIDDAIQAL  671

>PHYCA_511415
Length=744

 Score = 378 bits (971),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 242/494 (49%), Positives = 319/494 (65%), Gaps = 65/494 (13%)

Query  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
            LAPV D ALS PL  +Q++E+FPL+D ++D+AA AR   PG+R WA  RV+EWLD+RFNV
Sbjct  269  LAPVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNV  328

Query  303  GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
            G DTLL VVG  GTGKS F G+V    +GN+LA H C+FDRK+KS+PR VLLS+V Q+V 
Sbjct  329  GTDTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVD  388

Query  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
            NLP FK QLARLNLKYVLEE D  +LAGKVL+DPL A EEP+ A  +++DG+DQC     
Sbjct  389  NLPLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPN  448

Query  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
            G  RNELL+F A V+PQLPSW+G L+SSKP+ +LA +L  +S+LDFS KN  FV D   L
Sbjct  449  G--RNELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSL  506

Query  483  VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleld----mlhdl  538
            VDDIA NF+D  AAEA+++L+ K+GGNFAYL+FT+QALS PG+     E      +LH+L
Sbjct  507  VDDIARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHEL  566

Query  539  PESLYEIYLEIFEDN-------------------------------------------DD  555
            PE+LY+IY EIFED                                            +D
Sbjct  567  PETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAED  626

Query  556  MRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAA  615
            +R+++RSFVD++AV+ G YRIESSAL  WLSDPARS E F+F  D  +  LR+++++V++
Sbjct  627  LRMLRRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKMRRNVSS  686

Query  616  KAKQQSDEADAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRYEPPA  675
                 S  +                   ++   +S+ + S     +++  R  +R+EP  
Sbjct  687  SGHSHSGSSSDS----------------SATHHTSSRASSRVTASSKSQQRSHTRHEPRT  730

Query  676  NPSKPVGILKRGRL  689
            NP KPVGILKRG+L
Sbjct  731  NPGKPVGILKRGKL  744

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 97/203 (48%), Gaps = 54/203 (27%)

Query  19   RDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgg  78
            R  +  + +G    D++SLRL +Q  +DA+RF R TTL+   + ++DDVEEMFYG     
Sbjct  9    RSSRLHKKEGAWALDEDSLRLKQQ-QDDAVRFDRSTTLADTVN-VTDDVEEMFYGRNT--  64

Query  79   haghgghaghggaDRSTAGSVRTTDVYRTTEQLRSTGL--EPLAEDRVLP----------  126
                         +RST  S      YRTTEQ+R   L    L E+ V P          
Sbjct  65   -------------NRSTTAS--EMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFS  109

Query  127  ------PAVPYGSVPHTSGPH-------ADGPGG----------LAALRAELADVRAETQ  163
                  P+    S P   G +       A    G          L  LR+E+ +V+ E +
Sbjct  110  QFSATTPSNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVK  169

Query  164  AIRREVMNELHVLRYDVLKEVTV  186
            AIRREVMNELHV RYDVLKE+T+
Sbjct  170  AIRREVMNELHVTRYDVLKELTL  192

>PYAR_13571
Length=666

 Score = 357 bits (917),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 259/607 (43%), Positives = 334/607 (55%), Gaps = 99/607 (16%)

Query  50   FQRHTTLSSASSAMS--DDVEEMFYgggpgghaghgghaghggaDRSTAGSVRTTDVYRT  107
            +Q  +  S+ SSAMS  DD + M+                   +DRSTA    T    RT
Sbjct  29   YQIPSARSTTSSAMSYDDDNDSMY---------------SGYSSDRSTAT---TPSNART  70

Query  108  TEQLRSTGLEPLAEDRVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRR  167
            TE LR+TGLE L E    P       V  ++  +    G    +    A       AIRR
Sbjct  71   TENLRATGLETLNELEEEP-------VDRSTARYIGEQGDFTPMPTTAAPAYTPMPAIRR  123

Query  168  EVMNELHVLRYDVLKEVTVlkgavaqllaalapgggdagsrpgsagsatsaattassssa  227
            E+MNE+H  RYDVLKEVT+LKG + QL+  +A       S+       T+          
Sbjct  124  EMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPPLL-  182

Query  228  elspaDRAAIGVAPTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDW  287
                  RA       LAPVDD+ALS PL  EQ+DELFPL+D S ++   AR R  GTR+W
Sbjct  183  ------RATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREW  236

Query  288  ATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKS  347
            A  RVQEWLDSRFNVG D                   V D   G    THFCKF+RK KS
Sbjct  237  AFDRVQEWLDSRFNVGSD--------------VLLAMVGDAGTGK---THFCKFERKGKS  279

Query  348  TPrvvllslvrqvvANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAK  407
            +PR VLLS+V Q+ A LP FK QLARLNLKYVLEE DV  LA KVL+DPLA+ EEP+TAK
Sbjct  280  SPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK  339

Query  408  CLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLD  467
             ++LDGLDQC  +      N+LL+FL+ VVP+ PSWLG L+++KP+PE A ++  TSLLD
Sbjct  340  FVLLDGLDQCGVANG---YNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLD  396

Query  468  FSGKNKLFVQDARFLVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPgldd  527
            FS KN  +V D   L+ DI A F     A+A ++L+TK+ GN++YL+FTRQA+S+PG++ 
Sbjct  397  FSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEA  456

Query  528  geleldmlhdl--PESLYEIYLEIFED---------------------------------  552
             +  + +      P+SLYEIY EIFED                                 
Sbjct  457  PQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITE  516

Query  553  ----------NDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAG  602
                       DD+R+++R+F+DII++R G Y I SSALF+WL+DP R GE +  D    
Sbjct  517  QHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLH  576

Query  603  VDELRRL  609
            V  LRR+
Sbjct  577  VKVLRRV  583

>PYU1_G001733
Length=732

 Score = 358 bits (919),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 213/414 (51%), Positives = 279/414 (67%), Gaps = 49/414 (12%)

Query  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
            LAPV D ALS PL   Q+D++FPLVD S D+   A+   P +R+WA  R Q+W+DSRFNV
Sbjct  268  LAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNV  327

Query  303  GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
            G D LL +VG  G+GKST  G++CD    N++A H CKFDRK+KS+PR VLLSLV Q++A
Sbjct  328  GGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIA  387

Query  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
            NLP FK QLARLNLKYVLEE D  VLA KVL+DPL A EEP+TAK L++DG+DQCK+   
Sbjct  388  NLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKD-  446

Query  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
               RN+LL+FLA ++P+ P+WLG+ ++SKP+PEL  +L  TSLLDFS KN  ++ D   L
Sbjct  447  ---RNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIIL  503

Query  483  VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgelel--dmlhdlPE  540
            ++DI  NF+D   +EAR +L+ K+GGNF +LDFT+QALS PG+++    +  D+LHDLPE
Sbjct  504  INDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPE  563

Query  541  SLYEIYLEIFEDN-------------------------------------------DDMR  557
            S+YEIY EIFED                                            DD+R
Sbjct  564  SIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIR  623

Query  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQ  611
            +++R+F DII VR G YR+E+SA++EWL DP RSGE F+ +  A +D LRRL +
Sbjct  624  MIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677

 Score = 131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 113/181 (62%), Gaps = 24/181 (13%)

Query  21   LKRAQSDGV-PLPDDESLRLSRQVAEDALRFQRHTTLSSASSA-----MSDDVEEMFY--  72
            ++RAQSDGV    D+++LR+S+ VAEDA R+ R+TT+++++++     MSDDVE+MFY  
Sbjct  19   VERAQSDGVRATADEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDMFYNG  78

Query  73   -------gggpgghaghgghaghggaDRSTAGSVRTTDVYRTTEQLRSTGLEPLAEDRVL  125
                                    G +RST  S+R TDVYRTTEQLR+T L PL ED VL
Sbjct  79   GGGITRSTSDYTTGRTTSSMRDANGMNRST--SLRVTDVYRTTEQLRNTNLMPLNEDEVL  136

Query  126  PPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVT  185
            P A+   +     G  AD      ALRAEL +++ E Q IRRE+MNE+HV RYDVLKE+T
Sbjct  137  PAAM-RTTTGAAGGSEAD------ALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEIT  189

Query  186  V  186
            +
Sbjct  190  M  190

>PHYKE_8395
Length=1420

 Score = 371 bits (953),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 233/495 (47%), Positives = 314/495 (63%), Gaps = 59/495 (12%)

Query  243   LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
             LAPV D ALS PL P+Q++E+FPL+D ++++AA AR   PGTR WA  RV+EWLD+RFNV
Sbjct  937   LAPVADNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNV  996

Query  303   GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
             G DT+L VVG  GTGKS FCG+V    +GN+LA H C+FDRK+KSTPR VLLS V Q+V 
Sbjct  997   GNDTVLAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVD  1056

Query  363   NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
             NLPPFK QLARLNLKYVLEE D F+LA KV +DPL A EEPI A  ++++GLDQC     
Sbjct  1057  NLPPFKNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPN  1116

Query  423   GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
             G  RNELLEFL+ ++PQLPSW+G ++SSKP  + A +L  +S+LDFS KN  FV D   L
Sbjct  1117  G--RNELLEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSL  1174

Query  483   VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleldmlhdl----  538
             VDDIA NF+D  +AEA+R+L+ K+GGNFAYL+FT+QALS PG+     E  +  ++    
Sbjct  1175  VDDIARNFSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDL  1234

Query  539   PESLYEIYLEIFED-------------------------------------------NDD  555
             P+SL++IY EIFED                                            +D
Sbjct  1235  PQSLFDIYTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTED  1294

Query  556   MRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAA  615
             +R+++RSFVD++ V+ G YR+ESSAL  WLSDPARS E F+   D  +  LR+L++  ++
Sbjct  1295  LRMLRRSFVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKLRRSRSS  1354

Query  616   KAKQQSDEADAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRYEPPA  675
              +      + +                 ++ S + + + S     +++  R  +R+EP  
Sbjct  1355  GSNSDHSHSGSS---------SSDGSVPSTTSHTPSRATSSRAASSKSHQRAHTRHEPRV  1405

Query  676   NPS-KPVGILKRGRL  689
             NP  KP+GILKRG++
Sbjct  1406  NPEFKPMGILKRGKM  1420

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 101/204 (50%), Gaps = 57/204 (28%)

Query  19   RDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgg  78
            R  K  + +G    D++SLRL++Q  +DA RF R+T ++   + +SDDVE+MFY      
Sbjct  679  RSSKLHKKEGAWALDEDSLRLNKQ-QQDADRFDRNTAMTDTVN-VSDDVEDMFY------  730

Query  79   haghgghaghggaDRSTAGS--VRTTDV--YRTTEQLRSTG--LEPLAEDRVLPP-----  127
                          RST  S    T+DV  YRTTEQ+R T   L  L E+  + P     
Sbjct  731  -------------GRSTTQSQLSNTSDVPSYRTTEQMRGTNSTLTALHEEEAMTPSASHL  777

Query  128  ----AVPYGSVP---------------HTSG------PHADGPGGLAALRAELADVRAET  162
                A  Y S P               H++G              ++ LRAEL +V+AE 
Sbjct  778  SNSFASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEV  837

Query  163  QAIRREVMNELHVLRYDVLKEVTV  186
            Q IRREVMNELH+ RYDVLKE+T+
Sbjct  838  QTIRREVMNELHMTRYDVLKELTL  861

>HYAP_07104
Length=721

 Score = 348 bits (892),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 280/423 (66%), Gaps = 47/423 (11%)

Query  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
            LAPV D+ALS PL   Q+++LFPL+D +T++AA AR   PG+R WA  R +EWL+SRF  
Sbjct  263  LAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKA  322

Query  303  GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
            G D LL VVG  G+GKS FCG+V    +G ++A H C+FDRK KS+PR VLLS+V Q+V 
Sbjct  323  GMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVV  382

Query  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
            NLP FK QLARLNLKYVLEE D  +LA KVL+DPL A E+P+    +++DG+DQC     
Sbjct  383  NLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPA  442

Query  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
            G  RNELLEFLA ++PQLPSWLGV+VSSKP+ +LA +L  +S+LDFS KN+ FV D   L
Sbjct  443  G--RNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSL  500

Query  483  VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALS--SPglddgeleldmlhdlPE  540
            VD+IA +F      EA+ +L+ K+GGNFAYL+FT+QALS  +    +G + +D+L +LPE
Sbjct  501  VDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPE  560

Query  541  SLYEIYLEIFED-------------------------------------------NDDMR  557
            +LY+IY EIFED                                            +D+R
Sbjct  561  TLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLR  620

Query  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAAKA  617
            L++RSFVD++AV+ G YRIE+SAL  WL DPAR+ E F+F+ D  +  LR++++  A+ +
Sbjct  621  LLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDALQALRKMRRASASAS  680

Query  618  KQQ  620
              Q
Sbjct  681  SGQ  683

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 87/201 (43%), Gaps = 53/201 (26%)

Query  18   ERDLKRAQSDGVPLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpg  77
            +  L+  + DG    D++S+RL +Q  +  +R  R  TL+   +  +DDVEEMFY     
Sbjct  5    KNKLRLHKKDGTWDLDEDSMRL-KQNQDHVVRLDRSGTLTDTVNE-TDDVEEMFYSSTQT  62

Query  78   ghaghgghaghggaDRSTAGSVRTTDVYRTTEQL--RSTGLEPLAEDRVLPP--------  127
                           RST G  +    YR+TEQL  R   L  L ED   P         
Sbjct  63   ---------------RSTNGPPQ----YRSTEQLPGRLLTLTSLNEDAETPSGGSNASSS  103

Query  128  -------AVPYGSVPHTSG-----------PHADGPGG----LAALRAELADVRAETQAI  165
                   A    SV  TS             H    GG    L  LR EL +V+ E  AI
Sbjct  104  FSQFSDHATSISSVNLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAI  163

Query  166  RREVMNELHVLRYDVLKEVTV  186
            R+ V+NELHV RYDVLKE+ +
Sbjct  164  RQHVVNELHVTRYDVLKELAL  184

>PYAP_17763
Length=794

 Score = 342 bits (876),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 226/490 (46%), Positives = 313/490 (64%), Gaps = 50/490 (10%)

Query  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
            LAPVDD+ALS PL  EQ+D++FPL+D S ++   +R R  G+R+W   RVQEWLDSRFNV
Sbjct  303  LAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNV  362

Query  303  GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
            G D +L +VG  G+GK+    SVCD  +  V+A HFCKFDRKAKS+PR VLLSLV Q+ +
Sbjct  363  GADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTS  422

Query  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
            +LP FK QLARLNLKYVLEE DV  L+ KVLIDPL A EEP+T K +V D +DQC+T   
Sbjct  423  SLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRT---  479

Query  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
            G   N+L +FL+ ++P+ P WLG LVSSKP+PE A  +  +S+LDFS +N  ++ D  FL
Sbjct  480  GVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFL  539

Query  483  VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddge--leldmlhdlPE  540
            ++DIAA F D   AEA+++L+TK+GGN++YL+FT+QALS+PG+++    + +D+LHDLP+
Sbjct  540  INDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQ  599

Query  541  SLYEIYLEIFED-------------------------------------------NDDMR  557
            SLYEIY EIFED                                            D++R
Sbjct  600  SLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVR  659

Query  558  LVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRL--QQHVAA  615
            +++R+F+DII++R G Y I SSA+++WL+D  R GE +F D +  V  LR++   + +  
Sbjct  660  MLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNM  719

Query  616  KAKQQSDEADAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRYEPPA  675
                 S  ++     R   S   S+ S++  SS  +++ S       +SS  +  +EP  
Sbjct  720  PGTSSSGTSERSTMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNL  779

Query  676  NPSKPVGILK  685
            NPSKPVGILK
Sbjct  780  NPSKPVGILK  789

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 57/100 (57%), Gaps = 16/100 (16%)

Query  94   STAGSVRTTDVYRTTEQLRSTGLEPLAE------DRVLPPAVPYGSVPHTSGPHADGPGG  147
            +T   +R TD       LR+TGLE L E      DR     V  G  P T  P A    G
Sbjct  128  ATNSGLRGTD-------LRATGLETLNEMEEEVVDRSTARYVGPGVTPTT--PAAVIRAG  178

Query  148  LA-ALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTV  186
             A  LRAEL +++ E QAI+RE+MNE+H+ RYDVLKEVT+
Sbjct  179  DADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTM  218

>PHALS_06476
Length=726

 Score = 314 bits (805),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 218/500 (44%), Positives = 290/500 (58%), Gaps = 97/500 (19%)

Query  243  LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFNV  302
            LAPV D ALS PL  +Q++E FPL+D ++++AA AR+  PG+R WA  R+QEWLD+RF++
Sbjct  271  LAPVADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHM  330

Query  303  GQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvvA  362
            G DTLL VVG  G+GKS FCG+V    +GN+LA H C+FDRK+KS PR VLLS+V Q+V 
Sbjct  331  GNDTLLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVD  390

Query  363  NLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRR  422
            NLP FK QLARLNL+YVLEE D F+LA KVLIDPL A EEP  +  +++DG+DQC T   
Sbjct  391  NLPLFKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSN  450

Query  423  GGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARFL  482
            G  RNELLEF++ ++  LPSW+G LVSSKP+ +LA  L  +S+LDFS KN  FV DA  L
Sbjct  451  G--RNELLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSL  508

Query  483  VddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgele----ldmlhdl  538
            V+DI+  F+D  A EA+R+L  K+GGNFAYL+FT+QALS PG+          L +L +L
Sbjct  509  VEDISQYFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLREL  568

Query  539  PESLYEIYLEIFEDN-------------------------------------------DD  555
            PE+LY+IY EIFED                                            DD
Sbjct  569  PETLYDIYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADD  628

Query  556  MRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRRLQQHVAA  615
            +R+++RSFVDI+AV                    +  E F+F  +  +  LR+++ + ++
Sbjct  629  LRMLRRSFVDIVAV--------------------KHEEQFYFSIEDALLALRKMRLNSSS  668

Query  616  KAKQQ----SDEADAQGHErrrmsrresarstasnsssstssrshspppartssrVSSRY  671
             +       S + +A  H RR        +                          S R+
Sbjct  669  DSSSGDPGISSDKNAPDHNRRLSRANSRGKLPNK----------------------SQRH  706

Query  672  EPPAN--PSKPVGILKRGRL  689
            EP  N    KPVGILKRG+L
Sbjct  707  EPRTNFENYKPVGILKRGKL  726

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 85/189 (45%), Gaps = 58/189 (31%)

Query  33   DDESLRLSRQVAEDALRFQRHTTLSSASSAMSDDVEEMFYgggpgghaghgghaghggaD  92
            +D+SLR  +   ++ +R  R  TL+   + M+DDVEEMFY                   +
Sbjct  27   NDDSLR-RKHTQDETVRVDRSATLTDTVN-MTDDVEEMFY-------------------N  65

Query  93   RSTAGSVRTTDVYRTTEQLRSTGLE--PLAED-----------------RVLPPAVPYGS  133
            RSTA S      YRTTEQ+R   L    L ED                     P+    S
Sbjct  66   RSTATS--GIPQYRTTEQIRGNNLALYALHEDFETQSTASDASSSFSQFSATTPSSYAAS  123

Query  134  VP-HTSGPHAD---------------GPGGLAALRAELADVRAETQAIRREVMNELHVLR  177
             P + +G H D               G   L  L +E+  +++E + IRREVMNELHV R
Sbjct  124  TPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIKSEVKTIRREVMNELHVTR  183

Query  178  YDVLKEVTV  186
            YDVLKE+T+
Sbjct  184  YDVLKELTL  192

>CCI44111
Length=576

 Score = 217 bits (553),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 156/413 (38%), Positives = 220/413 (53%), Gaps = 50/413 (12%)

Query  241  PTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRF  300
            PTL  +D+A LS PL  +++DE+FPL+D S D+ + A   A GTR WA   + +W+ S F
Sbjct  168  PTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNF  227

Query  301  NVGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqv  360
              G + +L +VG  G GKST  G VC     N+ A HF +FDRK  S+ R V+LSLV Q 
Sbjct  228  ENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQF  287

Query  361  vANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKT  419
             + L  +KRQL RLNL+Y+L E +  V+A K+LIDPL A  E  +    VL DG+DQC  
Sbjct  288  ASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLV  347

Query  420  SRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDA  479
              +    N+LLE L+H+  + PSW+G +V+SK  P  A +LK  S++   G N  F+QD+
Sbjct  348  KNQS---NDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDS  404

Query  480  RFLVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleld--mlhd  537
            R L++++   F   H  EA  +L  K+GGN  YL F  +ALS P L   +  L   +L +
Sbjct  405  RILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDE  464

Query  538  lPESLYEIYLEIFEDN-------------------------------------------D  554
            LPES+ EI   IF+D                                            +
Sbjct  465  LPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELREN  524

Query  555  DMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELR  607
            + R++ R+F DII      YRI +S+L++WL    RS + F  +  A    LR
Sbjct  525  EWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

 Score = 37.0 bits (84),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 24/38 (63%), Gaps = 0/38 (0%)

Query  148  LAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVT  185
            + A R E+  +R E Q +R+E++  +   RYD+LKE+ 
Sbjct  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIV  90

>CCA22843
Length=586

 Score = 207 bits (528),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 147/408 (36%), Positives = 220/408 (54%), Gaps = 50/408 (12%)

Query  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301
            T  P+D++ LS PL  ++ DE+FP +D  +D+ + A   A GTR WA  RV+EW++S F 
Sbjct  179  TSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFK  238

Query  302  VGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvv  361
               D +L ++G  G+GKST  G +C      + A HFC+FDRK++S+ R V+LSLV Q  
Sbjct  239  SENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFA  298

Query  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKTS  420
            +  P +KRQL  LNL+Y+L+E +  V+A K+LI+PL A     + +  VL DG+DQC   
Sbjct  299  SKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLVE  358

Query  421  RRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDAR  480
                  N+LL+ ++H+  + PS +G +V+SK +P    + K  S++    +N  F+ D+R
Sbjct  359  NES---NDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSR  415

Query  481  FLVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleld--mlhdl  538
             L+++   NF   H  EA  +L  K+GGN  YL FT +ALS P L      L   +L +L
Sbjct  416  ILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDEL  475

Query  539  PESLYEIYLEIFED-------------------------------------------NDD  555
            P+S+ +I+  IFED                                            ++
Sbjct  476  PDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEE  535

Query  556  MRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDADAGV  603
             R++KRSF DII      YRI +S+LF WL    RS + F+ D  AG+
Sbjct  536  WRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGI  582

 Score = 38.1 bits (87),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 26/35 (74%), Gaps = 0/35 (0%)

Query  150  ALRAELADVRAETQAIRREVMNELHVLRYDVLKEV  184
            A+R E+ D+R E Q++R+E++  +   RYD++KE+
Sbjct  62   AVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEI  96

>SPRG_06355
Length=713

 Score = 136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 194/417 (47%), Gaps = 65/417 (16%)

Query  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301
            T  P+ D AL+ P     L++  P ++        A    P TR WA  +  +W      
Sbjct  295  TRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGP  349

Query  302  VGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvv  361
              +  +L VVGG G GKST    +       ++A+HF ++D +  ++   +L+SL  Q+ 
Sbjct  350  TNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQIS  407

Query  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSR  421
              LP F++QL RLNL Y+++EPD  VLA K+LI+PL +   P+ ++ +VLD +D+   S 
Sbjct  408  CKLPDFQQQLVRLNLAYLIQEPDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DAST  466

Query  422  RGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARF  481
             G     L+  LA V  + PSW+  L+SS+P   +   L    +L F  +++ F  D   
Sbjct  467  PG---TNLISLLADVALEFPSWVLFLLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTI  523

Query  482  LVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleldmlhdlPES  541
             V  +              LL+ K+ G+F YL F  QA +   +   E++  M+ +LP++
Sbjct  524  AVQSLMDKHGLDDKNIL-FLLKAKSQGSFLYLQFVDQAFA---MIHSEIDAGMILELPKT  579

Query  542  LYEIYLEIFED------------------------------------------------N  553
            LYEIY ++FE+                                                 
Sbjct  580  LYEIYDQVFEEKYGKGRRRVWQKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQ  639

Query  554  DDMRLVKRSFVDIIAV--RGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRR  608
             D+ L+ RSF DI+AV    G YR++S  LF++L D +RS E    + + GV  L +
Sbjct  640  PDLALIARSFEDIVAVDEETGVYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 42.4 bits (98),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 0/60 (0%)

Query  127  PAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTV  186
            PA  Y   P      +D P    A+ A + +++     IRR+VM ELH  +YD+LKE+T+
Sbjct  118  PAKAYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTM  177

>SDRG_01763
Length=736

 Score = 132 bits (331),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 120/417 (29%), Positives = 191/417 (46%), Gaps = 65/417 (16%)

Query  242  TLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTRDWATARVQEWLDSRFN  301
            T  P+ D AL+ P     L++  P ++        A    P TR WA  +  +W      
Sbjct  318  TRQPIKDQALTQPWE-NVLNQHLPFLNTQRP----AMEMLPSTRTWAINQYIKWAQDAGP  372

Query  302  VGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRKAKSTPrvvllslvrqvv  361
              +  +L VVGG G GKST    +       ++A+HF ++D +    P  +L+SL  Q+ 
Sbjct  373  TNESRVLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQIS  430

Query  362  ANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVLDGLDQCKTSR  421
              LP +++QL RLNL Y+++EPD  VLA K+LI+PL +   P+ ++ +VLD +D+   S 
Sbjct  431  CKLPDYQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDE-DVST  489

Query  422  RGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSLLDFSGKNKLFVQDARF  481
             G     L+  LA V  + PSW+  L+SS+    +   L    +L F  +++ F  D   
Sbjct  490  PGA---NLISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTI  546

Query  482  LVddiaanfadahaaeaRRLLETKAGGNFAYLDFTRQALSSPglddgeleldmlhdlPES  541
             V  +              LL+ K+ G+F YL F  QA S   +   E++  M+ +LP++
Sbjct  547  AVQSVMDKHGLDDKNIL-FLLKAKSQGSFLYLQFVDQAFS---MIHSEIDAGMILELPKT  602

Query  542  LYEIYLEIFED------------------------------------------------N  553
            L+EIY ++FE+                                                 
Sbjct  603  LHEIYDQVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQ  662

Query  554  DDMRLVKRSFVDIIAV--RGGCYRIESSALFEWLSDPARSGESFFFDADAGVDELRR  608
             D+ L+ RSF DI+ V    G YR++S  LF++L D ARS E    + + G+  L +
Sbjct  663  PDLALIARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

 Score = 42.4 bits (98),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 0/60 (0%)

Query  127  PAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVTV  186
            PA  Y   P      +D P    A+ A + +++     IRR+VM ELH  +YD+LKE+T+
Sbjct  131  PAKAYRDEPTGFENTSDAPAPSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTM  190

>SDRG_04575
Length=1003

 Score = 38.1 bits (87),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 3/87 (3%)

Query  376  LKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKTSRRGGVRNELLEFLA  434
            L+ V+    V  L   +L+ PL+A  EP T   ++L DGLD  + ++     N L+  L 
Sbjct  534  LEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVILLDGLDSLEDTQE--TDNCLVSALP  591

Query  435  HVVPQLPSWLGVLVSSKPAPELATQLK  461
             ++ +LPSW+ V+++S+  P +  +L+
Sbjct  592  GLLQKLPSWVRVILTSREDPVVMRKLQ  618

>SPRG_12621
Length=1003

 Score = 37.0 bits (84),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query  376  LKYVLEEPDVFVLAGKVLIDPLAACEEPITAKCLVL-DGLDQCKTSRRGGVRNELLEFLA  434
            L+ V+    V  L   +L+ PL A  EP T   ++L DGLD  + ++     N L+  L 
Sbjct  547  LEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVILLDGLDSLEDTQE--TDNCLVSALP  604

Query  435  HVVPQLPSWLGVLVSSKPAPELATQLK  461
             ++ +LPSW+ V+++S+  P +  +L+
Sbjct  605  ALLQKLPSWVRVILTSREDPVVMRKLQ  631

>H310_08292
Length=1007

 Score = 36.6 bits (83),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 65/134 (49%), Gaps = 4/134 (3%)

Query  330  QGNVLATHFCKFDRKAKSTPrvvllslvrqvvANLPPFKRQLARLN-LKYVLEEPDVFVL  388
            Q  V A H    D +    PR  +LSL  Q+   LP +   L +   L+ ++    V  L
Sbjct  494  QPEVRAFHLVSKDDEQTQNPRRCILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTEL  553

Query  389  AGKVLIDPLAACEEPITAKCLVL-DGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVL  447
               +L+ PL A  +P T   ++L DGLD  + +    + N  +  L  +V +LPSW+ ++
Sbjct  554  VTTLLVVPLNAIAQPTTVPLVILLDGLDAFQDA--AALDNCFVSSLVALVRKLPSWVRMI  611

Query  448  VSSKPAPELATQLK  461
             +S+  P +  +L+
Sbjct  612  WTSREDPSVMRKLQ  625

>H257_11773
Length=1026

 Score = 35.8 bits (81),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query  388  LAGKVLIDPLAACEEPITAKCLVL-DGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGV  446
            L   +L+ PL A  +P T   ++L DGLD  + S    V N  +  LA  V  LP W+  
Sbjct  569  LVHSLLVVPLNAIAQPSTVPLVILIDGLDAFQDS--NAVENCFVSSLAAAVRNLPPWVRW  626

Query  447  LVSSKPAPELATQLK  461
            +++S+  P +  +L+
Sbjct  627  VLTSREDPSVMQKLQ  641

>PHYSO_470533
Length=1084

 Score = 35.0 bits (79),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 43/88 (49%), Gaps = 14/88 (16%)

Query  388  LAGKVLIDPLAACEEPITAKCLVL--DGLDQ----------CKTSRRGGVRNE--LLEFL  433
            L  ++LI PL A   P T K LVL  DG++              +  GG ++E  L+  L
Sbjct  584  LVSQLLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSML  643

Query  434  AHVVPQLPSWLGVLVSSKPAPELATQLK  461
              +  +LP W+ V+V S+  P + ++L 
Sbjct  644  PALASRLPDWVRVVVLSREDPPVLSKLH  671

>PYVX_21513
Length=1446

 Score = 34.7 bits (78),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 17/192 (9%)

Query  285  RDWATARVQEWLDSRFNVGQDtllgvvggpgtgKSTFCGSVCDMLQGNVLATHFCKFDRK  344
            RDW   RVQ+W++   + G D  +  + G      T   +        + A HF   +  
Sbjct  438  RDWLFKRVQQWINDS-SSGTDHRVFWITGQIGSGKTSVAARMVQTFPEIAAFHFALQEDD  496

Query  345  AKSTPrvvllslvrqvvANLPPFKRQL-ARLNLKYVLEEPDVFVLAGKVLIDPLAACEEP  403
                 R  +LSL  Q+   LP +   L +R  L+ ++       L   +L++PL   + P
Sbjct  497  QTHIARRCVLSLAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRP  556

Query  404  ITAKCLVLDGLDQCKTS---------RRGG-----VRNELLEFLAHVVPQLPSWLGVLVS  449
                 L++DGL +C  S           GG     +   L+  L  +V +LPSW+ +++ 
Sbjct  557  AKPLILLIDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLL  615

Query  450  SKPAPELATQLK  461
            S+   ++ T+L+
Sbjct  616  SREDHDVMTRLQ  627

>PYAR_14788
Length=795

 Score = 32.7 bits (73),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query  388  LAGKVLIDPLAACEEPITAKCLVL--DGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLG  445
            L   +LI PL A   P + K L+L  DGL+    S  GG    +   L  ++ +LPSW+ 
Sbjct  499  LIAHLLITPLNAIARPKSDKPLILLIDGLEHL-ASNTGGAGGGV-SLLPSLIARLPSWVR  556

Query  446  VLVSSKPAPELATQLK  461
            V++ S+    +  +L+
Sbjct  557  VILLSREDHTIVMKLQ  572

Lambda      K        H        a         alpha
   0.318    0.134    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 54485603988

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40