Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_18180147551351356158e-83
PHYRA_95903147551341304726e-61
PHYCA_11834147551341304612e-59
PPTG_17126147551361304543e-58
PHYSO_321155147551361364526e-58
PITG_18455147551321314482e-57
PHYKE_8392147551381384431e-56
PHALS_06479147551361304362e-55
PYAP_17747147551341344005e-50
HYAP_07103147551641643819e-47
PYU1_G001736147551231263422e-41
PYIW_19970147551301213362e-40
CCA17542147551201223335e-40
CCI44820147551231263143e-37
PYIR_13454147551291253083e-36
SPRG_06335147551231212599e-29
H257_06293147551231202537e-28
SDRG_01782147551231242537e-28
H310_09224147551231202467e-27
HYAP_0849911147108721125e-07
HYAP_0850065260172721122e-06
PHYRA_8167511147106721056e-06
PHYKE_584111147121631057e-06
PPTG_0925211147105721049e-06
PHYSO_31501711147109721031e-05
PITG_1373911147105721021e-05
PHALS_1156411147107721021e-05
PYIW_1474311147105731022e-05
PYVX_208541114710484994e-05
PYIR_151861114710973961e-04
PYU1_G0059631114710373942e-04
PHYCA_5353801114710872933e-04
SPRG_128831114710540933e-04
SDRG_149121114710540933e-04
CCA175211114710454890.001
PYAP_228461114710484860.003
CCI487201340311473810.019
CCI442321114710567780.037
PYAR_232071114711266780.040
CCA2384237769146740.15
H257_07358111479856740.17
H310_07567111479864730.20
CCA201021340311453700.72
PYAP_248671340314753691.0
PYAR_212891340311853671.6
PYU1_G013186793911458662.4
SPRG_029621114339239664.2
PHALS_0165175376027655.7
SPRG_1114712788665879656.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18180

Length=135
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18180                                                            241        8e-83
PHYRA_95903                                                           186        6e-61
PHYCA_11834                                                           182        2e-59
PPTG_17126                                                            179        3e-58
PHYSO_321155                                                          178        6e-58
PITG_18455                                                            177        2e-57
PHYKE_8392                                                            175        1e-56
PHALS_06479                                                           172        2e-55
PYAP_17747                                                            158        5e-50
HYAP_07103                                                            151        9e-47
PYU1_G001736                                                          136        2e-41
PYIW_19970                                                            134        2e-40
CCA17542                                                              132        5e-40
CCI44820                                                              125        3e-37
PYIR_13454                                                            123        3e-36
SPRG_06335                                                            104        9e-29
H257_06293                                                            102        7e-28
SDRG_01782                                                            102        7e-28
H310_09224                                                            99.4       7e-27
HYAP_08499                                                            47.8       5e-07
HYAP_08500                                                            47.8       2e-06
PHYRA_81675                                                           45.1       6e-06
PHYKE_5841                                                            45.1       7e-06
PPTG_09252                                                            44.7       9e-06
PHYSO_315017                                                          44.3       1e-05
PITG_13739                                                            43.9       1e-05
PHALS_11564                                                           43.9       1e-05
PYIW_14743                                                            43.9       2e-05
PYVX_20854                                                            42.7       4e-05
PYIR_15186                                                            41.6       1e-04
PYU1_G005963                                                          40.8       2e-04
PHYCA_535380                                                          40.4       3e-04
SPRG_12883                                                            40.4       3e-04
SDRG_14912                                                            40.4       3e-04
CCA17521                                                              38.9       0.001
PYAP_22846                                                            37.7       0.003
CCI48720                                                              35.8       0.019
CCI44232                                                              34.7       0.037
PYAR_23207                                                            34.7       0.040
CCA23842                                                              33.1       0.15 
H257_07358                                                            33.1       0.17 
H310_07567                                                            32.7       0.20 
CCA20102                                                              31.6       0.72 
PYAP_24867                                                            31.2       1.0  
PYAR_21289                                                            30.4       1.6  
PYU1_G013186                                                          30.0       2.4  
SPRG_02962                                                            30.0       4.2  
PHALS_01651                                                           29.6       5.7  
SPRG_11147                                                            29.6       6.2  

>PYVX_18180
Length=135

 Score = 241 bits (615),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%), Gaps = 0/135 (0%)

Query  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
            MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL
Sbjct  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  61   GYLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRR  120
            GYLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRR
Sbjct  61   GYLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRR  120

Query  121  QHFMDRGVAPPRPIF  135
            QHFMDRGVAPPRPIF
Sbjct  121  QHFMDRGVAPPRPIF  135

>PHYRA_95903
Length=134

 Score = 186 bits (472),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 108/130 (83%), Gaps = 0/130 (0%)

Query  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65
            ELRPLYKKLLRLAQSLPEPKR  ++ QIR EFRSH E+TD  EV+ L+QRAQS LGYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64

Query  66   VTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            VTPR  S  G++RYIYRNGQRV+AD  EA GE+ ARYKT D+EG LKRHHQLLRRQHFMD
Sbjct  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124

Query  126  RGVAPPRPIF  135
            R   PPRPIF
Sbjct  125  RKSGPPRPIF  134

>PHYCA_11834
Length=134

 Score = 182 bits (461),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 0/130 (0%)

Query  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65
            ELRPLYKKLLRLAQSLPEPKR +++ QIR EFRSH ++TD  EV+KLLQRAQS LGYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64

Query  66   VTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            VTPR  S +GV+R+IYR+G+RV+A+  E  GE+ AR+KT DME  LKRHHQLLRRQ+FMD
Sbjct  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124

Query  126  RGVAPPRPIF  135
            R   PPRPIF
Sbjct  125  RKSGPPRPIF  134

>PPTG_17126
Length=136

 Score = 179 bits (454),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 107/130 (82%), Gaps = 0/130 (0%)

Query  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65
            ELRPLYKKLLRLAQSLPEPKR S++ QIR +FR+H ++TD  EV+ L+QRAQS L YLKI
Sbjct  7    ELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKI  66

Query  66   VTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            VTPR  S  GV+RYIYRNGQRV+AD  E  GE+ AR+KT DMEG L+RHHQLLRRQ+F+D
Sbjct  67   VTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLD  126

Query  126  RGVAPPRPIF  135
            R   PPRPIF
Sbjct  127  RKSGPPRPIF  136

>PHYSO_321155
Length=136

 Score = 178 bits (452),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 109/136 (80%), Gaps = 1/136 (1%)

Query  1    MASPA-ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQ  59
            MA  A ELRPLYKKLLRLAQSLPEPKR  ++ QIR EFRSH ++TD   V+ L+QRAQS 
Sbjct  1    MAEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSS  60

Query  60   LGYLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLR  119
            L YLKIVTPRG S +GV+R+IYRNGQRV+A   EA GE+ ARYKT D+E  LKRHHQLLR
Sbjct  61   LSYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLR  120

Query  120  RQHFMDRGVAPPRPIF  135
            RQ+FMDR   PPRPIF
Sbjct  121  RQYFMDRKSGPPRPIF  136

>PITG_18455
Length=132

 Score = 177 bits (448),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 105/131 (80%), Gaps = 0/131 (0%)

Query  5    AELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLK  64
            +ELRPLYKKLLRLAQSLPEPKR S++ QIR +FRSH + TD  EV+ L+QRAQS L YLK
Sbjct  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61

Query  65   IVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFM  124
            IVTPR  S +GV+RYIYRNGQRV+A   E  G + AR+K  DMEG LKRHHQLL+RQ+FM
Sbjct  62   IVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFM  121

Query  125  DRGVAPPRPIF  135
            +R   PPRPIF
Sbjct  122  NRKSGPPRPIF  132

>PHYKE_8392
Length=138

 Score = 175 bits (443),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 109/138 (79%), Gaps = 3/138 (2%)

Query  1    MASPA-ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQ  59
            MA  A ELRPLYKKLLR+AQ+LPEPKR  +++QIR EFR+H +++D  EV+KLLQ AQS 
Sbjct  1    MAEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSS  60

Query  60   LGYLKIVTPRG--PSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQL  117
            L YLKIVTPR    S SGV+RYIYRNGQRV+A   E  GE+ ARYKT DME  LKRHHQL
Sbjct  61   LSYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQL  120

Query  118  LRRQHFMDRGVAPPRPIF  135
            +RRQHFMDR   PPRP+F
Sbjct  121  MRRQHFMDRKSGPPRPMF  138

>PHALS_06479
Length=136

 Score = 172 bits (436),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 0/130 (0%)

Query  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65
            ELRPLYKKLLRLAQ+LP+ KR S++ QIR EFR H ++TD  EV++ +QRAQS L YLKI
Sbjct  7    ELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKI  66

Query  66   VTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            +TPR  S +GV+R+IYRNGQRV+A   E  G + AR+KT DME   KRHHQLLRRQ+FMD
Sbjct  67   ITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMD  126

Query  126  RGVAPPRPIF  135
            R   PPRPIF
Sbjct  127  RKSGPPRPIF  136

>PYAP_17747
Length=134

 Score = 158 bits (400),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 106/134 (79%), Gaps = 2/134 (1%)

Query  3    SPAELRPLYKKLLRLAQSLP-EPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLG  61
            + +ELRPLYK+LLRLA+SLP E KR +T+ QIR+EFRS  +  D  EVA L+QRAQ+++G
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  62   YLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQ  121
            YLKIVTPR  + +GVK ++Y NG+RV   +     E+GARYKT D EG ++RH+QLLRRQ
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRV-DSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  122  HFMDRGVAPPRPIF  135
            HFMDRGVAPP+PIF
Sbjct  121  HFMDRGVAPPKPIF  134

>HYAP_07103
Length=164

 Score = 151 bits (381),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 103/164 (63%), Gaps = 35/164 (21%)

Query  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66
            +RPLYKKLLRLAQSLPEPKR  ++ QIR EFR H ++TD  EV+ LLQRAQS + +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  67   TPRGPSA-----------------------------------SGVKRYIYRNGQRVdada  91
            TPR  S                                    +G++R++YR+G+R+DA  
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  92   aeaagedgaRYKTPDMEGALKRHHQLLRRQHFMDRGVAPPRPIF  135
             +  GE+ ARYKT D+E  +KRHHQLLRRQHFMDR   PPRPIF
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRKSGPPRPIF  164

>PYU1_G001736
Length=123

 Score = 136 bits (342),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 4/126 (3%)

Query  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
            MAS ++LRP+YKKLL+LAQ+LP  KR +TV QIR EFR+H    D  E+A LL RAQS +
Sbjct  1    MAS-SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59

Query  61   GYLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRR  120
            GYLKIVTPR  S +GVK Y+Y  G+RV    A  A EDGARYKT D    ++RH QLLRR
Sbjct  60   GYLKIVTPRATSDAGVKNYVYIKGKRV---EAAGAAEDGARYKTADYNAQMQRHVQLLRR  116

Query  121  QHFMDR  126
            QHFMDR
Sbjct  117  QHFMDR  122

>PYIW_19970
Length=130

 Score = 134 bits (336),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 3/121 (2%)

Query  6    ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKI  65
            +LRP+YKKLL+LA++LPE KR +T  QIR+EFRS  E++D  E+  LL RAQS + YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  66   VTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            VTPR  S +GVK YIY+NGQRV    A A  EDGA+Y+ PD  G + RH +LLRRQHFMD
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRV---EAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMD  128

Query  126  R  126
            R
Sbjct  129  R  129

>CCA17542
Length=120

 Score = 132 bits (333),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 91/122 (75%), Gaps = 3/122 (2%)

Query  5    AELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLK  64
            ++ R +YK+L+RLA+SLP  K+A+T+  IRTEFR H +++D  ++++LL+RAQS +GYLK
Sbjct  2    SDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLK  61

Query  65   IVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFM  124
            IVTP   S SGVKR+++++G+R+          + AR+K  D+   LKRHHQLLRRQHFM
Sbjct  62   IVTPHKRSDSGVKRFMFKDGERI---EENLKASERARFKVQDIGEGLKRHHQLLRRQHFM  118

Query  125  DR  126
            DR
Sbjct  119  DR  120

>CCI44820
Length=123

 Score = 125 bits (314),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 89/126 (71%), Gaps = 3/126 (2%)

Query  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
            M +  E R ++KK+++LA+SLP  K+A T+  IR EFR H ++ D  ++A+LL+RAQS +
Sbjct  1    MTAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTI  60

Query  61   GYLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRR  120
            GYLKIVTP   S SGVK ++Y++G+R+          + A++K  DME  LKRH+QL+RR
Sbjct  61   GYLKIVTPHKRSDSGVKHFVYKDGERI---EKSLQAGEKAKFKVQDMEEGLKRHNQLIRR  117

Query  121  QHFMDR  126
            Q+FMDR
Sbjct  118  QYFMDR  123

>PYIR_13454
Length=129

 Score = 123 bits (308),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query  2    ASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLG  61
            A+  +LRP+YKKLL+LA++LPE KR +T+AQIR+EFR+  +V+D  E+  LL RAQS +G
Sbjct  7    AALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66

Query  62   YLKIVTPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQ  121
            YLKIVTPR  S +GVK YIY+NGQRV    A +  EDGA+Y  PD    ++RH +LLRRQ
Sbjct  67   YLKIVTPRKSSDAGVKNYIYKNGQRV---EATSVLEDGAKYSIPDYNAQMQRHQKLLRRQ  123

Query  122  HFMDR  126
            HFMDR
Sbjct  124  HFMDR  128

>SPRG_06335
Length=123

 Score = 104 bits (259),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 4/121 (3%)

Query  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66
            +R  YKKLL+LA+S+P+ +RA T+ ++RTEFR+H       E+ +LL++AQS++ YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  67   TP-RGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMD  125
            TP + PS      ++Y+NGQR+D     A        KT D    + +H QL+RRQHFMD
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGRELSADSAT---IKTADYNAMMTKHVQLVRRQHFMD  121

Query  126  R  126
            R
Sbjct  122  R  122

>H257_06293
Length=123

 Score = 102 bits (253),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 84/120 (70%), Gaps = 2/120 (2%)

Query  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66
            +R  YKKL++LAQSLP  ++ + + +IR +FRS   ++ A E+ KL+ +AQS++ YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  67   TPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMDR  126
            TP+    SG +R+IY++G+R+D+ + +  G      KT D+   ++RH +L+RRQHFMDR
Sbjct  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRT--IKTTDVNAMMERHVKLIRRQHFMDR  122

>SDRG_01782
Length=123

 Score = 102 bits (253),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 80/124 (65%), Gaps = 4/124 (3%)

Query  4    PAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYL  63
             A +R  YKKLL+LA+S+P+ +RA T+ ++R EFR+H       E+ +LL++AQS++ YL
Sbjct  2    DATIRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYL  61

Query  64   KIVTPRGPSASGV-KRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQH  122
            KIVTP+  S+S     ++Y+NGQR+D     A        KT D    + +H QL+RRQH
Sbjct  62   KIVTPKKSSSSTQGSHFVYKNGQRIDGRELSADSAT---IKTHDYNAMMTKHVQLVRRQH  118

Query  123  FMDR  126
            FMDR
Sbjct  119  FMDR  122

>H310_09224
Length=123

 Score = 99.4 bits (246),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 80/120 (67%), Gaps = 2/120 (2%)

Query  7    LRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIV  66
            +R  YKKL++LAQSLP  ++   + ++R EFRSH  +T + ++ K++ +AQS++ YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  67   TPRGPSASGVKRYIYRNGQRVdadaaeaagedgaRYKTPDMEGALKRHHQLLRRQHFMDR  126
            TP+    +  +RYIY++G+R+D    + +       KT D    ++RH +L+RRQHFMDR
Sbjct  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNAT--IKTVDFNAMMERHVKLVRRQHFMDR  122

>HYAP_08499
Length=108

 Score = 47.8 bits (112),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LAQ  P  KR S +  I++EFR++  ++DA +V K L   Q+ +
Sbjct  1   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  KELSMYASLHPS  72

>HYAP_08500
Length=172

 Score = 47.8 bits (112),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 42/72 (58%), Gaps = 0/72 (0%)

Query  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
            MA   E+  +Y+++L+LAQ  P  KR S +  I++EFR++  ++DA +V K L   Q+ +
Sbjct  65   MAEANEVLRMYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGI  124

Query  61   GYLKIVTPRGPS  72
              L +     PS
Sbjct  125  KELSMYASLHPS  136

>PHYRA_81675
Length=106

 Score = 45.1 bits (105),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LAQ  P  KRAS +  I+TEF ++  +TDA ++ + L   ++ +
Sbjct  1   MAETKEVVRMYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  KELSMYASLHPS  72

>PHYKE_5841
Length=121

 Score = 45.1 bits (105),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 39/63 (62%), Gaps = 0/63 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LAQ  P  KR S +  I+TEF +H  +TDA ++ + L  A++ +
Sbjct  1   MAEVKEVTRMYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

Query  61  GYL  63
             L
Sbjct  61  KEL  63

>PPTG_09252
Length=105

 Score = 44.7 bits (104),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (57%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  LY+++L+LAQ  P  KR S +  I+TEF ++  +TDA ++ + L   ++ +
Sbjct  1   MAETKEVLRLYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  TELSMYASLHPS  72

>PHYSO_315017
Length=109

 Score = 44.3 bits (103),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LAQ  P  KR S +  I+TEF ++ ++TDA ++ + L   ++ +
Sbjct  1   MAETKEVLRMYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  KELSMYASLHPS  72

>PITG_13739
Length=105

 Score = 43.9 bits (102),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 42/72 (58%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LAQ  P  KR S +  I+TEF ++ ++TDA ++ + L   ++ +
Sbjct  1   MAETREVLRMYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  TELSMYASLHPS  72

>PHALS_11564
Length=107

 Score = 43.9 bits (102),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 41/72 (57%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   ++  +Y++LL+LAQ  P  KR + +  I+ EF ++A +TDA ++ + +  A + +
Sbjct  1   MAETKQVLRVYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  KELSMYASLHPS  72

>PYIW_14743
Length=105

 Score = 43.9 bits (102),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 42/73 (58%), Gaps = 0/73 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  LY+++L+LA   P  KR++ + +I+ EF  +  +TD+A++   +Q A+  +
Sbjct  1   MAEAKEVVRLYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKILDKVQSARQGI  60

Query  61  GYLKIVTPRGPSA  73
             L   T   PS+
Sbjct  61  VELSQYTNLNPSS  73

>PYVX_20854
Length=104

 Score = 42.7 bits (99),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (54%), Gaps = 0/84 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  LY+++L+LAQ  P  KR S V  I+TEF  +  ++DA +V + +  A++ +
Sbjct  1   MADRLEVVRLYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGI  60

Query  61  GYLKIVTPRGPSASGVKRYIYRNG  84
             L       PSA+     + R+ 
Sbjct  61  QELSQYAALHPSAASWTVEVGRDA  84

>PYIR_15186
Length=109

 Score = 41.6 bits (96),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LA   P  KR + + +I+ EF ++  +TD A++   +Q A+  +
Sbjct  1   MAEAKEVVRVYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDNAKILDKVQSARQGI  60

Query  61  GYLKIVTPRGPSA  73
             L   T   PS+
Sbjct  61  VELSQYTNLNPSS  73

>PYU1_G005963
Length=103

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 0/73 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           M    E+  +Y+++L+LA   P  KR + +  I+ EFR +  +TDA+ +   +Q A+  +
Sbjct  1   MTEAKEVVRIYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

Query  61  GYLKIVTPRGPSA  73
             L   T   PS+
Sbjct  61  VELSQYTNLNPSS  73

>PHYCA_535380
Length=108

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 39/72 (54%), Gaps = 0/72 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   E+  +Y+++L+LA   P  KR S +  I+TEF ++  +TDA  + + L   ++ +
Sbjct  1   MAETKEVLRMYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGI  60

Query  61  GYLKIVTPRGPS  72
             L +     PS
Sbjct  61  KELSMYANLHPS  72

>SPRG_12883
Length=105

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  10  LYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEV  49
           +Y+++L+LAQ  P  K+   VA I+ EF  +A +TDAA++
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKI  48

>SDRG_14912
Length=105

 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  10  LYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEV  49
           +Y+++L+LAQ  P  K+   VA I+ EF  +A +TDAA++
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKI  48

>CCA17521
Length=104

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  10  LYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYL  63
           LY+++LRLA+  P  KR + +  IR EFR   ++T AA +   +  A + +  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PYAP_22846
Length=104

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/84 (29%), Positives = 41/84 (49%), Gaps = 4/84 (5%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           MA   ++  LY+ +L+LA+  P  KR + +  I+ EF      TDA  +   +  AQ+ +
Sbjct  1   MADKQKVLRLYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGI  60

Query  61  GYLKIVTPRGPSAS----GVKRYI  80
             L +     PS++    GV R +
Sbjct  61  KELSMYATLNPSSTAWTVGVGREV  84

>CCI48720
Length=114

 Score = 35.8 bits (81),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 0/73 (0%)

Query  11  YKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIVTPRG  70
           Y++  R+   LP   R+    QIR EF +   V +  ++  LL+  + QL Y+  +    
Sbjct  21  YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQLKYVSSLVDTA  80

Query  71  PSASGVKRYIYRN  83
            S    KR + RN
Sbjct  81  VSKQHQKRKVNRN  93

>CCI44232
Length=105

 Score = 34.7 bits (78),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 34/67 (51%), Gaps = 0/67 (0%)

Query  5   AELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLK  64
           A++  LY+++LRLA+  P  KR + V  IR EFR    +   A + + +  A + +  L 
Sbjct  4   AQIFGLYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKELM  63

Query  65  IVTPRGP  71
           +     P
Sbjct  64  MYANLNP  70

>PYAR_23207
Length=112

 Score = 34.7 bits (78),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  1   MASPA---ELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQ  57
           M  PA   E+  LY+++L+LA+  P  KR + V  I+ EF     +TDA  +   +  AQ
Sbjct  1   MTKPATSREVVRLYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQ  60

Query  58  SQLGYL  63
           + +  L
Sbjct  61  AGIKEL  66

>CCA23842
Length=91

 Score = 33.1 bits (74),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (57%), Gaps = 3/46 (7%)

Query  10  LYKKLLRLAQSLP---EPKRASTVAQIRTEFRSHAEVTDAAEVAKL  52
           LYK LL  A+      E +R ST + +R  FR +AE  D ++ AK+
Sbjct  15  LYKSLLSAAKQKDQGGEDRRGSTYSYVRERFRENAESVDRSDFAKI  60

>H257_07358
Length=98

 Score = 33.1 bits (74),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  1   MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRA  56
           M+S   +  +Y+++L+LA   P  K+   V  I+ EF  +  +TD A++ + +  A
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKIKEKINIA  56

>H310_07567
Length=98

 Score = 32.7 bits (73),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/64 (27%), Positives = 32/64 (50%), Gaps = 0/64 (0%)

Query  10  LYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIVTPR  69
           +Y+++L+LA+  P  KR   V  I+ EF  +  +TD  ++ + +  A   +  L      
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKIKEKVNIAIKGIQQLNQYVSL  69

Query  70  GPSA  73
            P+A
Sbjct  70  DPNA  73

>CCA20102
Length=114

 Score = 31.6 bits (70),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  11  YKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYL  63
           ++   R+  +LP   R+    QIRTEF     V D  +V  LL+    QL ++
Sbjct  21  FRDFQRVTAALPTSTRSDIRRQIRTEFEKCRFVEDDEQVQSLLRYGMEQLKHV  73

>PYAP_24867
Length=147

 Score = 31.2 bits (69),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  11  YKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYL  63
           Y + LR+ Q L E  R     QIR  F  +  V D  +V + +++ + QL ++
Sbjct  26  YHEFLRITQPLAEDTRRDVRQQIRAAFDMYRHVEDEKQVMQFIRQGREQLKHV  78

>PYAR_21289
Length=118

 Score = 30.4 bits (67),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  11  YKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYL  63
           YK+  R+ Q L +  R     QIR  +  +  V D  +VA  L++ + QL ++
Sbjct  27  YKEFWRITQPLDDATRRDVREQIRAGYELYRHVDDEKQVALFLRQGREQLKHV  79

>PYU1_G013186
Length=114

 Score = 30.0 bits (66),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query  5   AELRPLYKKLLRLAQSLPEP--KRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60
           AE R LY+++LR+A++      ++     + RT F     +TDA  + +L+Q    Q+
Sbjct  2   AEARALYRRVLRVARTWEGGYVEQQWIRREARTRFEEQRAITDARRIRELVQAGHDQV  59

>SPRG_02962
Length=392

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  17  LAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQR  55
           +A+ L  P   + +AQ+R   +S+    DAA  AKLLQ+
Sbjct  40  IAKVLASPSHTTALAQLRVASQSNTLWDDAANAAKLLQQ  78

>PHALS_01651
Length=760

 Score = 29.6 bits (65),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  48   EVAKLLQRAQSQLGYLKIVTPRGPSAS  74
            ++AK  QR Q++ GYL  V P+ PS S
Sbjct  534  DIAKWSQRKQNEAGYLNTVPPQPPSNS  560

>SPRG_11147
Length=658

 Score = 29.6 bits (65),  Expect = 6.2, Method: Composition-based stats.
 Identities = 22/79 (28%), Positives = 31/79 (39%), Gaps = 12/79 (15%)

Query  10   LYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEV------------TDAAEVAKLLQRAQ  57
            L  K+L L   L  P+R   +  +R     H E+            T A E A    R +
Sbjct  555  LVTKVLALDSQLDLPRRVQELMLVRAAAHGHLEMLRYLVQTHGFAWTSAVESAAQEGRRK  614

Query  58   SQLGYLKIVTPRGPSASGV  76
              LG+L  + P  PSA  +
Sbjct  615  RVLGFLATLGPAVPSAHAI  633

Lambda      K        H        a         alpha
   0.321    0.134    0.385    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3398400027

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40