Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_18179534611471206561e-88
PYVX_18175147521471185093e-66
PYVX_18174854042041744213e-52
PHYCA_14368528562191293634e-43
PHYRA_81107568762021753442e-40
PHYCA_511409568762041763406e-40
PHYSO_477820568762021743381e-39
PHYKE_8388568762051753372e-39
PPTG_17121568762021753346e-39
PPTG_17122147522041723223e-37
PHYKE_8389147522041753181e-36
PHYSO_284086147522041733154e-36
PITG_18450147522031713102e-35
PYVX_18176568762011743085e-35
PHYRA_84190720132061742972e-33
PHYRA_81106147522021762938e-33
PHYKE_3446231281991632912e-32
PHYCA_14369109792481632924e-32
PHYKE_7718109792201632886e-32
PHYRA_85631109792281742871e-31
PPTG_10635528561991742642e-28
PPTG_10634720132081592642e-28
PHYSO_254168462841701412603e-28
PHYRA_78625541464341192734e-28
PHYRA_82864231281931642614e-28
PHYRA_78626578954731192745e-28
PPTG_10643457052501742593e-27
PHYSO_246676457051871482544e-27
PHYCA_102624720131951672511e-26
PPTG_15264231281941692502e-26
PPTG_17366239131941692502e-26
PHYCA_102852242061951672467e-26
PHYCA_102550457052681632508e-26
PYU1_G001741854041991682442e-25
PYIR_25089854042621682463e-25
PHALS_00498109791991642372e-24
PPTG_10636109792461642384e-24
PHYCA_129425147522041732354e-24
PYU1_G001742932042131672303e-23
PYU1_G001744568762131672294e-23
PYVX_18173449665001602394e-23
PHALS_03284309411881642274e-23
PHYSO_341599109791851702265e-23
PHYSO_536424606911971702232e-22
PHYSO_507031586531971702232e-22
PITG_1981815643147952175e-22
PITG_1352010979171762142e-21
PHYKE_81047713586562082e-21
PPTG_10048213141901632083e-20
PHYSO_49997823128174672049e-20
PHYSO_50157582077174672049e-20
PYIR_26626147522121662051e-19
PHYSO_262732469371881511971e-18
PHYSO_340369526762001511972e-18
PHYKE_771752856568462024e-18
HYAP_07096534612511601843e-16
PYU1_G00173993203266591828e-16
PHYKE_9185445762811651811e-15
PPTG_14255469372681641811e-15
PYIW_18791854041941611762e-15
PHYSO_417649445761851651752e-15
PHYCA_53693413059831641822e-15
PYU1_G001740147522061581762e-15
PHYCA_510817445761881651734e-15
PHYSO_34337653237172571724e-15
PHYSO_35340153461146411714e-15
PHYSO_34159652856231761721e-14
PPTG_14254445761881651692e-14
PYIR_26546866052391631712e-14
PHYCA_53732344966200411683e-14
PPTG_1712314753201401665e-14
PPTG_088208662250491687e-14
PYIW_187905687686751588e-14
PHYRA_81105534612011631622e-13
PITG_1845214753856381663e-13
PYIW_1879293204125541531e-12
PITG_104998662323521582e-12
PHYSO_527908600641741521523e-12
PHYRA_9518452672937291513e-11
PYAP_2227393203268521484e-11
PYAR_2409693203227381441e-10
PYAP_24689101439252751441e-10
PYAP_22278932042891801432e-10
PYAP_24691101441145521358e-10
PYAP_1813199172226481361e-09
PYU1_G00173853461226421361e-09
PYIW_1878893203244441343e-09
PYAP_2227985404223411334e-09
PHYCA_1303654235266771328e-09
PITG_049484234232421282e-08
PITG_049494235337421292e-08
PYIR_164354233304371292e-08
PYAR_20617104048254601274e-08
PYU1_G00532394355251611264e-08
PHYRA_7465169969344411267e-08
PPTG_046184235326431258e-08
PPTG_046194234276421248e-08
PYU1_G0066729480057521159e-08
PHYSO_4855244234278421249e-08
PHYSO_4839554235320421241e-07
PHYKE_39134234321391222e-07
PHYCA_53116319434314611222e-07
PYU1_G00532484534191461193e-07
PYU1_G00532646349191461193e-07
PYU1_G0053284233191461193e-07
PHYRA_735834234630421213e-07
PHYKE_280975282291391203e-07
PHYRA_735824235326581195e-07
PYAP_1871194356210421176e-07
PHYRA_7360719434343441171e-06
PHYRA_791403807424531171e-06
PYU1_G0146904234295371151e-06
PHALS_053924235367421152e-06
CCI473811729211641132e-06
PPTG_0464719434327591142e-06
PHYRA_8349446435224541132e-06
PPTG_0462269696273451133e-06
PYAR_1425694355199471113e-06
PHYRA_7797170555230511123e-06
PHYRA_8579472619230511123e-06
PYU1_G00532594356207371113e-06
PYIR_164444234182381104e-06
PHYRA_8350071814394531125e-06
PYIR_2474385164357611125e-06
PHYCA_53447342331050441116e-06
PHYSO_48405157198285451106e-06
PHYKE_1057877880239501098e-06
PHYRA_7358169693293431108e-06
PPTG_075073807299411109e-06
PHYRA_735844233287441099e-06
PPTG_0750971814299411099e-06
PPTG_1816624206445411101e-05
PHYKE_293757198366611091e-05
SDRG_07565124412278521091e-05
PHYSO_45910619434223421081e-05
PYAP_1870994355235601081e-05
PHYCA_9847981950276401081e-05
PYAR_1426194356150561061e-05
PYAR_1426084534212371071e-05
PYU1_G00736485164316381081e-05
PHYKE_102951729292381081e-05
PHYCA_1294221331353401081e-05
PPTG_046204233342391082e-05
PHYSO_32475550435262441072e-05
PPTG_0751120433183421062e-05
PHYRA_8601672746236401072e-05
PHYRA_8675273236300401072e-05
PYIW_1915183191248411062e-05
PHYRA_7360657198366581072e-05
CCA171791729185581043e-05
PHYCA_186573807295411063e-05
PHALS_0317930883372601063e-05
H310_063621730197371044e-05
PHALS_053944234288781054e-05
PHALS_0441194496262591044e-05
SDRG_08129136331218461035e-05
PITG_049474233298381046e-05
PHYRA_772931729302381036e-05
SDRG_08137136334282461036e-05
PPTG_1018616173270661036e-05
HYAP_1417016173266361036e-05
PYVX_1466251086540391046e-05
PYVX_216431729260431036e-05
PHYRA_8615172836170341016e-05
PYU1_G00598582077200451026e-05
PHYCA_12295816173260361036e-05
PHYKE_191373236280371037e-05
PITG_2031215981270421037e-05
PITG_2063116173270421037e-05
PHYRA_8794174106157341017e-05
PPTG_011481729295381037e-05
PYVX_2456316173254391028e-05
PYAP_1822194496226411028e-05
PYU1_G00747653913195441019e-05
H257_135501730266371029e-05
PHALS_064805346115953991e-04
PHYRA_8473216173265481011e-04
PITG_019661729327381011e-04
SDRG_173171617312244981e-04
PHYCA_6958346349224591001e-04
PHYSO_32929351032310381011e-04
PHYSO_48892157461296381011e-04
PHYSO_3423645298319439991e-04
SPRG_1991616173305511002e-04
PHYSO_2628441729276371002e-04
PHYKE_83905346113053972e-04
PYIR_204811729277401002e-04
PYAP_2225710036124757992e-04
PHYKE_25391617325845992e-04
PYU1_G005868172926740992e-04
PPTG_07520381429440992e-04
PPTG_075164643529440992e-04
PHYCA_979654018728838992e-04
PHYSO_4760771617326836992e-04
PHYSO_4720091598126836992e-04
PHYCA_129433697128738992e-04
PYIW_1879416688524748983e-04
PPTG_075214503028140983e-04
PYAR_17163172911449943e-04
PITG_119569791339112983e-04
PYVX_16673173168143983e-04
PYIW_15526173025637974e-04
PHYKE_5749380730040974e-04
PHALS_03176447820743964e-04
SPRG_22161173030061974e-04
SDRG_1744813848926243965e-04
PYAR_17166173011449935e-04
PHYSO_2559754642418748955e-04
PHYRA_834992043347345975e-04
PYIW_180658516430838965e-04
PHYKE_102965746151257966e-04
PHYKE_6001447828943966e-04
PYIR_164438239927535957e-04
PHYCA_145605746130042957e-04
PHYCA_1034795103231437957e-04
PPTG_011539449531753940.001
PYU1_G0058665746119440930.001
PHYKE_60795977330268940.001
PHYRA_772905746130940930.001
PITG_05271447827843930.001
SPRG_0779912598334538930.001
SPRG_1991713394624146920.002
SDRG_1731813394624141920.002
PHYCA_562062172923738910.002
PYAP_18584172921040910.002
PYIW_2546316503921644910.002
PYU1_G0058679449520046910.002
PHYSO_340332447829539910.002
PYIR_20483173028737910.003
PHYSO_3403335267128439910.003
SPRG_0779612598032272900.003
PHYCA_5342965267130939900.003
PHYSO_488139173026539900.004
PYIW_20715172926443900.004
PYIW_274778239918051890.004
PYAR_219411045566141830.005
SDRG_0094812598335237890.005
PHYRA_78689683829639890.005
SPRG_0779712598131862890.005
PYIR_244218990321356880.006
PPTG_03160979137961890.006
PPTG_046176969349639890.006
PHYCA_1456384062296118880.007
PYAP_182268406222665870.007
SDRG_08782173045043880.008
PYU1_G005869173025937870.008
PYIR_151878207720737870.008
PHYSO_2550564634926938870.008
PPTG_14221447827540870.009
PHYSO_4381035572123839870.009
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18179

Length=147
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18179                                                            257        1e-88
PYVX_18175                                                            200        3e-66
PYVX_18174                                                            166        3e-52
PHYCA_14368                                                           144        4e-43
PHYRA_81107                                                           137        2e-40
PHYCA_511409                                                          135        6e-40
PHYSO_477820                                                          134        1e-39
PHYKE_8388                                                            134        2e-39
PPTG_17121                                                            133        6e-39
PPTG_17122                                                            128        3e-37
PHYKE_8389                                                            127        1e-36
PHYSO_284086                                                          125        4e-36
PITG_18450                                                            124        2e-35
PYVX_18176                                                            123        5e-35
PHYRA_84190                                                           119        2e-33
PHYRA_81106                                                           117        8e-33
PHYKE_3446                                                            116        2e-32
PHYCA_14369                                                           117        4e-32
PHYKE_7718                                                            115        6e-32
PHYRA_85631                                                           115        1e-31
PPTG_10635                                                            106        2e-28
PPTG_10634                                                            106        2e-28
PHYSO_254168                                                          104        3e-28
PHYRA_78625                                                           109        4e-28
PHYRA_82864                                                           105        4e-28
PHYRA_78626                                                           110        5e-28
PPTG_10643                                                            104        3e-27
PHYSO_246676                                                          102        4e-27
PHYCA_102624                                                          101        1e-26
PPTG_15264                                                            100        2e-26
PPTG_17366                                                            100        2e-26
PHYCA_102852                                                          99.4       7e-26
PHYCA_102550                                                          100        8e-26
PYU1_G001741                                                          98.6       2e-25
PYIR_25089                                                            99.4       3e-25
PHALS_00498                                                           95.9       2e-24
PPTG_10636                                                            96.3       4e-24
PHYCA_129425                                                          95.1       4e-24
PYU1_G001742                                                          93.2       3e-23
PYU1_G001744                                                          92.8       4e-23
PYVX_18173                                                            96.7       4e-23
PHALS_03284                                                           92.0       4e-23
PHYSO_341599                                                          91.7       5e-23
PHYSO_536424                                                          90.5       2e-22
PHYSO_507031                                                          90.5       2e-22
PITG_19818                                                            88.2       5e-22
PITG_13520                                                            87.0       2e-21
PHYKE_8104                                                            84.7       2e-21
PPTG_10048                                                            84.7       3e-20
PHYSO_499978                                                          83.2       9e-20
PHYSO_501575                                                          83.2       9e-20
PYIR_26626                                                            83.6       1e-19
PHYSO_262732                                                          80.5       1e-18
PHYSO_340369                                                          80.5       2e-18
PHYKE_7717                                                            82.4       4e-18
HYAP_07096                                                            75.5       3e-16
PYU1_G001739                                                          74.7       8e-16
PHYKE_9185                                                            74.3       1e-15
PPTG_14255                                                            74.3       1e-15
PYIW_18791                                                            72.4       2e-15
PHYSO_417649                                                          72.0       2e-15
PHYCA_536934                                                          74.7       2e-15
PYU1_G001740                                                          72.4       2e-15
PHYCA_510817                                                          71.2       4e-15
PHYSO_343376                                                          70.9       4e-15
PHYSO_353401                                                          70.5       4e-15
PHYSO_341596                                                          70.9       1e-14
PPTG_14254                                                            69.7       2e-14
PYIR_26546                                                            70.5       2e-14
PHYCA_537323                                                          69.3       3e-14
PPTG_17123                                                            68.6       5e-14
PPTG_08820                                                            69.3       7e-14
PYIW_18790                                                            65.5       8e-14
PHYRA_81105                                                           67.0       2e-13
PITG_18452                                                            68.6       3e-13
PYIW_18792                                                            63.5       1e-12
PITG_10499                                                            65.5       2e-12
PHYSO_527908                                                          63.2       3e-12
PHYRA_95184                                                           62.8       3e-11
PYAP_22273                                                            61.6       4e-11
PYAR_24096                                                            60.1       1e-10
PYAP_24689                                                            60.1       1e-10
PYAP_22278                                                            59.7       2e-10
PYAP_24691                                                            56.6       8e-10
PYAP_18131                                                            57.0       1e-09
PYU1_G001738                                                          57.0       1e-09
PYIW_18788                                                            56.2       3e-09
PYAP_22279                                                            55.8       4e-09
PHYCA_130365                                                          55.5       8e-09
PITG_04948                                                            53.9       2e-08
PITG_04949                                                            54.3       2e-08
PYIR_16435                                                            54.3       2e-08
PYAR_20617                                                            53.5       4e-08
PYU1_G005323                                                          53.1       4e-08
PHYRA_74651                                                           53.1       7e-08
PPTG_04618                                                            52.8       8e-08
PPTG_04619                                                            52.4       8e-08
PYU1_G006672                                                          48.9       9e-08
PHYSO_485524                                                          52.4       9e-08
PHYSO_483955                                                          52.4       1e-07
PHYKE_3913                                                            51.6       2e-07
PHYCA_531163                                                          51.6       2e-07
PYU1_G005324                                                          50.4       3e-07
PYU1_G005326                                                          50.4       3e-07
PYU1_G005328                                                          50.4       3e-07
PHYRA_73583                                                           51.2       3e-07
PHYKE_2809                                                            50.8       3e-07
PHYRA_73582                                                           50.4       5e-07
PYAP_18711                                                            49.7       6e-07
PHYRA_73607                                                           49.7       1e-06
PHYRA_79140                                                           49.7       1e-06
PYU1_G014690                                                          48.9       1e-06
PHALS_05392                                                           48.9       2e-06
CCI47381                                                              48.1       2e-06
PPTG_04647                                                            48.5       2e-06
PHYRA_83494                                                           48.1       2e-06
PPTG_04622                                                            48.1       3e-06
PYAR_14256                                                            47.4       3e-06
PHYRA_77971                                                           47.8       3e-06
PHYRA_85794                                                           47.8       3e-06
PYU1_G005325                                                          47.4       3e-06
PYIR_16444                                                            47.0       4e-06
PHYRA_83500                                                           47.8       5e-06
PYIR_24743                                                            47.8       5e-06
PHYCA_534473                                                          47.4       6e-06
PHYSO_484051                                                          47.0       6e-06
PHYKE_10578                                                           46.6       8e-06
PHYRA_73581                                                           47.0       8e-06
PPTG_07507                                                            47.0       9e-06
PHYRA_73584                                                           46.6       9e-06
PPTG_07509                                                            46.6       9e-06
PPTG_18166                                                            47.0       1e-05
PHYKE_2937                                                            46.6       1e-05
SDRG_07565                                                            46.6       1e-05
PHYSO_459106                                                          46.2       1e-05
PYAP_18709                                                            46.2       1e-05
PHYCA_98479                                                           46.2       1e-05
PYAR_14261                                                            45.4       1e-05
PYAR_14260                                                            45.8       1e-05
PYU1_G007364                                                          46.2       1e-05
PHYKE_10295                                                           46.2       1e-05
PHYCA_12942                                                           46.2       1e-05
PPTG_04620                                                            46.2       2e-05
PHYSO_324755                                                          45.8       2e-05
PPTG_07511                                                            45.4       2e-05
PHYRA_86016                                                           45.8       2e-05
PHYRA_86752                                                           45.8       2e-05
PYIW_19151                                                            45.4       2e-05
PHYRA_73606                                                           45.8       2e-05
CCA17179                                                              44.7       3e-05
PHYCA_18657                                                           45.4       3e-05
PHALS_03179                                                           45.4       3e-05
H310_06362                                                            44.7       4e-05
PHALS_05394                                                           45.1       4e-05
PHALS_04411                                                           44.7       4e-05
SDRG_08129                                                            44.3       5e-05
PITG_04947                                                            44.7       6e-05
PHYRA_77293                                                           44.3       6e-05
SDRG_08137                                                            44.3       6e-05
PPTG_10186                                                            44.3       6e-05
HYAP_14170                                                            44.3       6e-05
PYVX_14662                                                            44.7       6e-05
PYVX_21643                                                            44.3       6e-05
PHYRA_86151                                                           43.5       6e-05
PYU1_G005985                                                          43.9       6e-05
PHYCA_122958                                                          44.3       6e-05
PHYKE_1913                                                            44.3       7e-05
PITG_20312                                                            44.3       7e-05
PITG_20631                                                            44.3       7e-05
PHYRA_87941                                                           43.5       7e-05
PPTG_01148                                                            44.3       7e-05
PYVX_24563                                                            43.9       8e-05
PYAP_18221                                                            43.9       8e-05
PYU1_G007476                                                          43.5       9e-05
H257_13550                                                            43.9       9e-05
PHALS_06480                                                           42.7       1e-04
PHYRA_84732                                                           43.5       1e-04
PITG_01966                                                            43.5       1e-04
SDRG_17317                                                            42.4       1e-04
PHYCA_69583                                                           43.1       1e-04
PHYSO_329293                                                          43.5       1e-04
PHYSO_488921                                                          43.5       1e-04
PHYSO_342364                                                          42.7       1e-04
SPRG_19916                                                            43.1       2e-04
PHYSO_262844                                                          43.1       2e-04
PHYKE_8390                                                            42.0       2e-04
PYIR_20481                                                            43.1       2e-04
PYAP_22257                                                            42.7       2e-04
PHYKE_2539                                                            42.7       2e-04
PYU1_G005868                                                          42.7       2e-04
PPTG_07520                                                            42.7       2e-04
PPTG_07516                                                            42.7       2e-04
PHYCA_97965                                                           42.7       2e-04
PHYSO_476077                                                          42.7       2e-04
PHYSO_472009                                                          42.7       2e-04
PHYCA_12943                                                           42.7       2e-04
PYIW_18794                                                            42.4       3e-04
PPTG_07521                                                            42.4       3e-04
PYAR_17163                                                            40.8       3e-04
PITG_11956                                                            42.4       3e-04
PYVX_16673                                                            42.4       3e-04
PYIW_15526                                                            42.0       4e-04
PHYKE_5749                                                            42.0       4e-04
PHALS_03176                                                           41.6       4e-04
SPRG_22161                                                            42.0       4e-04
SDRG_17448                                                            41.6       5e-04
PYAR_17166                                                            40.4       5e-04
PHYSO_255975                                                          41.2       5e-04
PHYRA_83499                                                           42.0       5e-04
PYIW_18065                                                            41.6       5e-04
PHYKE_10296                                                           41.6       6e-04
PHYKE_6001                                                            41.6       6e-04
PYIR_16443                                                            41.2       7e-04
PHYCA_14560                                                           41.2       7e-04
PHYCA_103479                                                          41.2       7e-04
PPTG_01153                                                            40.8       0.001
PYU1_G005866                                                          40.4       0.001
PHYKE_6079                                                            40.8       0.001
PHYRA_77290                                                           40.4       0.001
PITG_05271                                                            40.4       0.001
SPRG_07799                                                            40.4       0.001
SPRG_19917                                                            40.0       0.002
SDRG_17318                                                            40.0       0.002
PHYCA_562062                                                          39.7       0.002
PYAP_18584                                                            39.7       0.002
PYIW_25463                                                            39.7       0.002
PYU1_G005867                                                          39.7       0.002
PHYSO_340332                                                          39.7       0.002
PYIR_20483                                                            39.7       0.003
PHYSO_340333                                                          39.7       0.003
SPRG_07796                                                            39.3       0.003
PHYCA_534296                                                          39.3       0.003
PHYSO_488139                                                          39.3       0.004
PYIW_20715                                                            39.3       0.004
PYIW_27477                                                            38.9       0.004
PYAR_21941                                                            36.6       0.005
SDRG_00948                                                            38.9       0.005
PHYRA_78689                                                           38.9       0.005
SPRG_07797                                                            38.9       0.005
PYIR_24421                                                            38.5       0.006
PPTG_03160                                                            38.9       0.006
PPTG_04617                                                            38.9       0.006
PHYCA_14563                                                           38.5       0.007
PYAP_18226                                                            38.1       0.007
SDRG_08782                                                            38.5       0.008
PYU1_G005869                                                          38.1       0.008
PYIR_15187                                                            38.1       0.008
PHYSO_255056                                                          38.1       0.008
PPTG_14221                                                            38.1       0.009
PHYSO_438103                                                          38.1       0.009
PPTG_03156                                                            38.1       0.009
SPRG_07795                                                            38.1       0.009
PYU1_G005872                                                          38.1       0.009
PHALS_03177                                                           37.7       0.010
PYAR_21940                                                            37.7       0.011
SDRG_16535                                                            37.7       0.011
PYU1_G005871                                                          37.7       0.011
PHYCA_127270                                                          37.7       0.012
PHYRA_78177                                                           37.7       0.012
PHYSO_342361                                                          37.0       0.013
PPTG_03161                                                            37.7       0.014
PHYSO_524101                                                          37.7       0.014
PHYRA_77291                                                           37.4       0.014
PHYCA_14559                                                           37.4       0.015
PPTG_03143                                                            37.4       0.015
PHYRA_78176                                                           37.4       0.015
PPTG_18176                                                            37.4       0.016
PHALS_10635                                                           37.4       0.016
PYU1_G005873                                                          37.0       0.017
PHYKE_3912                                                            37.0       0.017
PPTG_01152                                                            37.0       0.018
PHYCA_14558                                                           37.0       0.018
PYIR_23585                                                            37.0       0.019
PHYKE_6078                                                            37.0       0.023
PHYRA_78162                                                           37.0       0.023
PHYRA_78161                                                           37.0       0.023
PPTG_01147                                                            37.0       0.023
SPRG_07627                                                            37.0       0.025
PHYSO_533682                                                          36.6       0.026
PHYSO_533903                                                          36.6       0.027
PHYCA_19612                                                           37.0       0.027
PHYSO_246481                                                          36.6       0.028
SDRG_15426                                                            37.0       0.029
PYVX_22511                                                            36.6       0.033
PHYSO_318693                                                          36.6       0.034
PHYSO_525076                                                          36.2       0.038
PHYRA_78169                                                           36.2       0.043
PHYCA_552912                                                          36.2       0.050
PYIR_14463                                                            35.8       0.054
PHYKE_7445                                                            35.8       0.064
PHYCA_19606                                                           35.4       0.069
PHYRA_86751                                                           35.0       0.073
SPRG_04679                                                            35.4       0.075
SDRG_16534                                                            35.4       0.078
PITG_01969                                                            35.4       0.081
PHYCA_19598                                                           35.4       0.081
PHYCA_132255                                                          34.3       0.092
PPTG_03138                                                            35.0       0.096
PITG_11935                                                            35.0       0.099
PITG_11936                                                            35.0       0.11 
PHYRA_78165                                                           35.0       0.11 
PYU1_G001518                                                          34.7       0.12 
SPRG_07826                                                            35.0       0.12 
PPTG_04801                                                            34.7       0.12 
PHYKE_7446                                                            34.7       0.13 
PYAP_22462                                                            34.3       0.13 
PYIW_15528                                                            34.7       0.14 
PHYKE_6069                                                            34.7       0.14 
PYAP_16347                                                            34.3       0.14 
PYVX_23997                                                            34.3       0.16 
PYAR_18165                                                            34.3       0.16 
PYAP_16994                                                            34.3       0.17 
PYIR_19612                                                            34.3       0.20 
PYAP_23672                                                            33.9       0.20 
H257_11258                                                            34.3       0.21 
PHALS_02044                                                           33.9       0.23 
H310_05438                                                            33.9       0.23 
PYAR_23252                                                            33.9       0.25 
PPTG_03144                                                            33.9       0.25 
PHALS_05110                                                           33.5       0.26 
PYVX_20783                                                            33.9       0.27 
PHALS_01460                                                           33.9       0.27 
PYIR_25571                                                            33.9       0.27 
PYU1_G001525                                                          33.9       0.28 
PHYRA_77292                                                           33.5       0.30 
PHYSO_324715                                                          33.5       0.30 
PHALS_02041                                                           33.5       0.32 
PHYCA_18729                                                           33.5       0.33 
PYAP_19707                                                            33.5       0.33 
PITG_11957                                                            33.5       0.34 
PHYRA_84947                                                           33.5       0.35 
PPTG_04803                                                            33.5       0.35 
PHYRA_78167                                                           33.1       0.38 
SDRG_00972                                                            33.5       0.39 
PPTG_09880                                                            33.1       0.44 
PHYSO_318690                                                          33.1       0.44 
PYVX_21438                                                            33.1       0.45 
PHYSO_374518                                                          32.3       0.45 
PHALS_08575                                                           33.1       0.46 
PPTG_03148                                                            33.1       0.49 
PYU1_G006404                                                          33.1       0.49 
PYU1_G006405                                                          33.1       0.50 
PYIW_21964                                                            32.7       0.51 
PYIR_22137                                                            32.7       0.51 
HYAP_11925                                                            32.7       0.52 
PYIR_23622                                                            32.7       0.56 
PYAP_18713                                                            32.3       0.57 
PYIR_22134                                                            32.7       0.57 
PYAP_19712                                                            32.7       0.60 
H257_11265                                                            32.7       0.60 
H257_11264                                                            32.7       0.60 
PPTG_03153                                                            32.7       0.63 
PYIW_16810                                                            32.3       0.73 
PHYCA_12944                                                           32.0       0.73 
PHYCA_19608                                                           32.3       0.74 
PHYCA_120062                                                          32.3       0.74 
PYIW_25573                                                            32.3       0.75 
PHYKE_2379                                                            32.3       0.76 
SPRG_07825                                                            32.3       0.86 
PYAP_20077                                                            32.0       0.89 
PYIR_20304                                                            32.0       0.93 
PHYCA_10470                                                           32.0       1.0  
PHYKE_6076                                                            32.0       1.0  
PITG_11942                                                            32.0       1.1  
H310_05432                                                            32.0       1.1  
PHYKE_6066                                                            32.0       1.1  
PHYCA_123316                                                          32.0       1.2  
PHALS_02037                                                           32.0       1.2  
PYIW_24289                                                            31.6       1.2  
PHYSO_374025                                                          32.0       1.2  
PPTG_17795                                                            31.2       1.3  
PHYSO_375794                                                          30.8       1.4  
PYAP_20456                                                            31.6       1.5  
PYVX_20789                                                            31.6       1.6  
PYAR_15391                                                            31.2       1.6  
PYIR_23689                                                            31.2       1.7  
PHYRA_78174                                                           31.2       1.8  
PHYSO_339832                                                          31.2       1.8  
PYIR_22135                                                            31.2       1.9  
H257_11273                                                            31.2       1.9  
PYVX_22510                                                            31.2       2.0  
PYU1_G001514                                                          31.2       2.0  
PHYRA_78172                                                           31.2       2.0  
PYIR_25334                                                            31.2       2.1  
PYAP_23673                                                            31.2       2.1  
PYU1_G001524                                                          31.2       2.1  
PYVX_24274                                                            31.2       2.1  
PHYRA_86201                                                           30.8       2.5  
PPTG_03140                                                            30.8       2.7  
PHYRA_78164                                                           30.8       2.8  
PYVX_19277                                                            30.8       2.8  
PPTG_10073                                                            30.4       3.0  
PITG_11937                                                            30.8       3.1  
PHYKE_2454                                                            30.8       3.3  
PHYRA_86241                                                           30.4       3.4  
PYU1_G001519                                                          30.4       3.4  
PPTG_03139                                                            30.4       3.8  
PYIW_24288                                                            30.0       3.9  
PYIW_14247                                                            30.0       4.1  
PPTG_03145                                                            30.4       4.1  
PYU1_G007242                                                          30.0       4.2  
CCI47989                                                              30.0       4.5  
PYIW_15395                                                            30.4       4.5  
PYIR_16375                                                            30.0       4.7  
PHYKE_6077                                                            30.0       5.1  
PYIW_16208                                                            29.6       5.7  
PPTG_13879                                                            29.6       6.0  
PYU1_G007254                                                          29.6       6.3  
PYAP_16351                                                            29.6       6.3  
PYIW_24287                                                            29.6       6.6  
PYIW_14252                                                            29.6       6.8  
PITG_01083                                                            29.6       6.8  
PYVX_21174                                                            28.5       7.0  
PITG_11931                                                            29.6       7.1  
PHYSO_318683                                                          29.6       7.2  
PYAR_24672                                                            29.6       7.3  
PYAR_24113                                                            29.3       7.4  
H310_05433                                                            29.6       7.5  
PPTG_17798                                                            29.3       7.5  
PPTG_03147                                                            29.3       7.8  
PYU1_G006403                                                          29.3       7.8  
PYAP_18307                                                            29.3       7.8  
PYAP_18710                                                            27.7       7.9  
HYAP_11923                                                            29.6       8.4  
PHYCA_123476                                                          29.3       8.7  
PYIW_23029                                                            28.5       8.9  
PYU1_G005878                                                          27.7       9.0  
PYAR_16493                                                            29.3       9.4  
PYIW_20907                                                            29.3       9.5  
PYAP_23455                                                            29.3       9.7  

>PYVX_18179
Length=147

 Score = 257 bits (656),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK  87
            HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK
Sbjct  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK  87

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
            DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN
Sbjct  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147

>PYVX_18175
Length=147

 Score = 200 bits (509),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 105/118 (89%), Gaps = 5/118 (4%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK  87
            HQYVILP+P+WT+ D DVWYSPLAFLE+QGF TQEDF++WR ANGY TLR+FMD   SGK
Sbjct  28   HQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD---SGK  84

Query  88   --DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
              DTA+DYSSC GSCTLYW+WMGVRYLKGAYSWQVYKNCVPLSTSARMLE A+N SA+
Sbjct  85   YTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142

>PYVX_18174
Length=204

 Score = 166 bits (421),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 103/174 (59%), Gaps = 58/174 (33%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGY--------------  73
            HQYVILP+PTWT+ D DVWY+PLAFLEDQGF T EDFN+WR +NGY              
Sbjct  28   HQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQASYTV  87

Query  74   ---------------------------------------DTLRAFMD----QAVSGKDTA  90
                                                   D+ R + +    +A+SGKDTA
Sbjct  88   TDGADQTCGFTEIDGTPQPIPANFRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKDTA  147

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
            +DYS    G+CTLYW+WMGVRYL  AYSWQVYKNCVPLSTSARMLEGAANASAI
Sbjct  148  IDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSARMLEGAANASAI  201

>PHYCA_14368
Length=219

 Score = 144 bits (363),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 82/129 (64%), Gaps = 14/129 (11%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
            HQ V+LP+P WT+ D D  Y+PLAFLE+QGF TQ+DF SWR+ N Y +LR FMD A    
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAKYTV  87

Query  84   ----------VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARM  133
                         KD  VDYSSC G+CTL W+W+G+R+LK  YSWQVYK C+PLS S   
Sbjct  88   TDGADFSCGFTDPKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGGT  147

Query  134  LEGAANASA  142
              G   A +
Sbjct  148  EAGTTPAGS  156

>PHYRA_81107
Length=202

 Score = 137 bits (344),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 91/175 (52%), Gaps = 59/175 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFN------------------SWRS  69
            HQ V+LP PT+T++D    Y+PLAFLEDQGF+TQEDF                   S+  
Sbjct  25   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAFDDGASYTV  84

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
            ++G D    F D                                         + +SGKD
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
              +DYSSC+ +CTLYWFWMGVRYL  AYSWQVYK CVPLS SAR LEGAAN SAI
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASARRLEGAANESAI  199

>PHYCA_511409
Length=204

 Score = 135 bits (340),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 96/176 (55%), Gaps = 59/176 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED---------FNSWRSAN-------  71
            HQ V+LP PT+T++D    Y+PLAFLEDQGFATQED         ++S R+ N       
Sbjct  27   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGASYTV  86

Query  72   -----------------------------GY-----------DTLRAFMD---QAVSGKD  88
                                         GY           DT+    D   +A+SGKD
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIA  144
              +DYSSC+ +CTLYWFW+GVRYLK  YSWQ+YK CVPLS SAR LEGAAN SAIA
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIA  202

>PHYSO_477820
Length=202

 Score = 134 bits (338),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 91/174 (52%), Gaps = 59/174 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFN------------------SWRS  69
            HQ V+LP PT+T++D    Y+PLAFLEDQGFATQEDF                   S+  
Sbjct  25   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDGASYTV  84

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
            A+G D    F +                                         +++SGKD
Sbjct  85   ADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGKD  144

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
              +DYSSC+ +CTLYWFW+GVRYLK  YSWQ+YK CVPLSTSAR LEGA N SA
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGATNESA  198

>PHYKE_8388
Length=205

 Score = 134 bits (337),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 89/175 (51%), Gaps = 59/175 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFN------------------SWRS  69
            HQ V+LP PT+T++D    Y+PLAFLEDQGF+TQEDF                   S+  
Sbjct  28   HQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDASYTV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
            ++G D    F D                                          ++SGKD
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
              +DYSSC+ +CTLYWFWMGVRYLK  YSWQVYK CVPLS SAR LEGA N S I
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASARRLEGAVNESVI  202

>PPTG_17121
Length=202

 Score = 133 bits (334),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 95/175 (54%), Gaps = 59/175 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED---------FNSWRSAN-------  71
            HQ V+L  PT+T++D D  Y+PLAFLEDQGFATQED         ++S R+ N       
Sbjct  25   HQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGASYTV  84

Query  72   -----------------------------GY-----------DTLRAFMD---QAVSGKD  88
                                         GY           DT+    D   +A+SGK 
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
              +DYSSC+ +CTLYWFW+GVRYLK  YSWQ+YK CVPLSTSAR LEGAAN SAI
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAI  199

>PPTG_17122
Length=204

 Score = 128 bits (322),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 88/172 (51%), Gaps = 58/172 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSAN----------------  71
            HQ V+LP PT+T+++ D  Y+PLAFLE+QG+ T EDFN WR  N                
Sbjct  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAKYTV  87

Query  72   ----------------------------GY----------DTLRAFMD----QAVSGKDT  89
                                        GY          DT R        + +SGK  
Sbjct  88   TDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTY  147

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
             +DYSSC+G+CTL W+W+GVRYLK AYSWQ+YK C+PLS SAR LE AAN S
Sbjct  148  NLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARRLESAANES  199

>PHYKE_8389
Length=204

 Score = 127 bits (318),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 91/175 (52%), Gaps = 61/175 (35%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF-----------------------  64
            HQ V+LP PT+T++D D  Y+PLAFLE+QGF T +DF                       
Sbjct  27   HQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAKYTV  86

Query  65   -----------------------NSWRSANGY----------DTLRAFMD----QAVSGK  87
                                   N+ RS  GY          DT R        +A+SGK
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRS-TGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
            D  +DYSSC+G+CTL W+W+GVR+LK  YSWQVYK CVPLS SAR L+GAAN SA
Sbjct  146  DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARRLKGAANESA  200

>PHYSO_284086
Length=204

 Score = 125 bits (315),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 87/173 (50%), Gaps = 58/173 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRS------------------  69
            HQ V+LP PT+T++D    Y+PLAFLE+QG+ T EDFN+WR                   
Sbjct  28   HQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGASYTV  87

Query  70   ANGYDTLRAFMD----------------------------------------QAVSGKDT  89
            A+G D    F D                                        +  SGK  
Sbjct  88   ADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTY  147

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
             +DYSSC GSCTL W+W+GVR+LK  YSWQVYK CVPLSTSAR LE AAN SA
Sbjct  148  DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESA  200

>PITG_18450
Length=203

 Score = 124 bits (310),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 85/171 (50%), Gaps = 55/171 (32%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSAN----------------  71
            HQ V+LP PT+T++D D  Y+PL FLE QG+ T EDFN WR  N                
Sbjct  28   HQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFMEYTVADG  87

Query  72   -------------------------GY----------DTLRAFMD----QAVSGKDTAVD  92
                                     GY          D+ R        + + GK   +D
Sbjct  88   ADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYNLD  147

Query  93   YSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
            YSSC G+CTL W+W+GVR+LK AYSWQ+YK C+PLS SAR LE AAN S +
Sbjct  148  YSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARRLEVAANKSVV  198

>PYVX_18176
Length=201

 Score = 123 bits (308),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 89/174 (51%), Gaps = 58/174 (33%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLE---------------DQGFATQEDF---NSWRS  69
            HQYVILP PTW ++D DV Y+PLAFLE               D G+ +   F    S+  
Sbjct  25   HQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGASYTV  84

Query  70   ANGYD----------TLRAFMD------------------------------QAVSGKDT  89
             +G D          T +A  D                               ++SGK  
Sbjct  85   TDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKTY  144

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
             +DYSSC+ +CTLYWFWMGVRYL   YSWQVYKNCVPLS SAR LEGAANASA+
Sbjct  145  DLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAV  198

>PHYRA_84190
Length=206

 Score = 119 bits (297),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 82/174 (47%), Gaps = 59/174 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRS------------------  69
            HQ V+LP+P WT++D D  Y+PLAFLE++GFATQEDF +WR+                  
Sbjct  11   HQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNAKYSV  70

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             NG D    F D                                         +   GKD
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
              VDYSSC G+CTL W+WMGVR+LK  YSWQVYK C+PL+  +   E A    A
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESAPATDA  184

>PHYRA_81106
Length=202

 Score = 117 bits (293),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 88/176 (50%), Gaps = 64/176 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF-----------------------  64
            HQ V+LP PT+T++  D  Y+PLAFLE+QGF T  DF                       
Sbjct  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAKYTV  87

Query  65   -----------------------NSWRSANGY----------DTLRAFMD----QAVSGK  87
                                   N+ RS  GY          DT R        +A+SGK
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRS-TGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  146

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
            D  +DYSSC+G+CTL+W+WMGVRYLK AYSWQVYK CVPLS SAR L    N SA+
Sbjct  147  DYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199

>PHYKE_3446
Length=199

 Score = 116 bits (291),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 82/163 (50%), Gaps = 59/163 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD----QA  83
            HQ V+LP+P W ++  ++ Y+PLAFLE+QGFATQED N+WR  NGY TLRAFMD    Q 
Sbjct  28   HQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAKYQV  87

Query  84   VSGKD---------------------------------------------------TAVD  92
              G D                                                   T  D
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  93   YS----SCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            Y+    +C G+C L W+W+GVR+LK +YSWQVYK C+PL++ +
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  190

>PHYCA_14369
Length=248

 Score = 117 bits (292),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 78/163 (48%), Gaps = 59/163 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRS------------------  69
            HQ V+LP+P WT+ D D  Y+PLAFLE+QGF TQ+DF +WR+                  
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRAKYTV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             NG D    F D                                         +   GKD
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
              VDYSSC G+CTL W+W+GVR+LK AYSWQVYK C+PL+ S 
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PHYKE_7718
Length=220

 Score = 115 bits (288),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 79/163 (48%), Gaps = 59/163 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSAN----------------  71
            HQ V+LP+PTWT++D D  Y+PLAFLE +GF  QEDF +WR  N                
Sbjct  32   HQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAKYSV  91

Query  72   --GYDTLRAFMD-----------------------------------------QAVSGKD  88
              G D+   F D                                         +A  GKD
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
              +DYS+C G+CTL W+W+GVR+LK +YSWQVYK C+PL+ S 
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSG  194

>PHYRA_85631
Length=228

 Score = 115 bits (287),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 81/174 (47%), Gaps = 59/174 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRS------------------  69
            HQ V+LP+P WT++D D  Y+PLAFLE++GF TQEDF SWR                   
Sbjct  28   HQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAKYNV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
            A+G D    F D                                         +   GKD
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
              VDYSSC G+CTL W+W+G+R+LK  YSWQVYK C+PL+  +   E A    A
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPATEA  201

>PPTG_10635
Length=199

 Score = 106 bits (264),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 81/174 (47%), Gaps = 59/174 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQE------DFNSWRS------------  69
            HQ V+LP+P WT+ D D  Y+PLAFLE+QGF TQE      D N ++S            
Sbjct  11   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAKYEV  70

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             +G D    F D                                         +   GKD
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
              VDYSSC GSCTL W+W+GVR+LK +YSWQVYK C+PL+  A    G+  A +
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGAGAPAGSLPAGS  184

>PPTG_10634
Length=208

 Score = 106 bits (264),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 76/159 (48%), Gaps = 59/159 (37%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF------NSWRS------------  69
            HQ V+LP+P WT+ D +  Y+PLAFLE++GF TQEDF      N ++S            
Sbjct  28   HQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAKYPV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             +G D    F D                                         +   GKD
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
              VDYSSC G+CTLYW+W+GVR+LK  YSWQVYK C+PL
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYSO_254168
Length=170

 Score = 104 bits (260),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 71/141 (50%), Gaps = 46/141 (33%)

Query  41   EDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA-----------------  83
            ED D  Y+PLAFLE QGFATQE F++ R  NGY TLR FMD+                  
Sbjct  29   EDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNP  88

Query  84   ---------------------------VSGKDTAVDYSSC--SGSCTLYWFWMGVRYLKG  114
                                       V  +   +DYSSC   G CT++W+W+GVR+LK 
Sbjct  89   KGTPQPIPRSTGYTHDGPCEIWLDDVRVLERSPTIDYSSCEKKGGCTMHWYWLGVRFLKN  148

Query  115  AYSWQVYKNCVPLSTSARMLE  135
            +YSWQVYK C+PL+ + + L 
Sbjct  149  SYSWQVYKECIPLTAAPKRLR  169

>PHYRA_78625
Length=434

 Score = 109 bits (273),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 19/119 (16%)

Query  28   HQYVILPKPTWTSEDHDV-----WYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ  82
            HQ V +P PTWT  +         ++PL+FLE +GF TQE+F  ++  NGY +LR F+D+
Sbjct  241  HQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLDK  300

Query  83   A--------------VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            A              ++ +   +DYS C  SC LYW+W+G RYLKG+YSWQVYK C+ L
Sbjct  301  AKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYRA_82864
Length=193

 Score = 105 bits (261),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 77/164 (47%), Gaps = 58/164 (35%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNS---------------------  66
            HQ V+LP+P WT+++ D  Y+PLAFLE QGFATQ DFN+                     
Sbjct  28   HQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRAKYTV  87

Query  67   ---------WRSANG------------------------YDTLRAFM----DQAVSGKDT  89
                     W   NG                         D  R        +    KD 
Sbjct  88   TEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKDY  147

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARM  133
             +DYSSC G+CTL+W+W+GVR+LK +YSWQVYK C+ L++  R+
Sbjct  148  PIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQRL  191

>PHYRA_78626
Length=473

 Score = 110 bits (274),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 72/119 (61%), Gaps = 19/119 (16%)

Query  28   HQYVILPKPTWTSEDHDV-----WYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ  82
            HQ V +P PTWT  +         ++PL+FLE +GF TQE+F  ++  NGY +LR F+D+
Sbjct  280  HQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLDK  339

Query  83   A--------------VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            A              ++ +   +DYS C  SC LYW+W+G RYLKG+YSWQVYK C+ L
Sbjct  340  AKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PPTG_10643
Length=250

 Score = 104 bits (259),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 80/174 (46%), Gaps = 59/174 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
            HQ V+LP+P WT+ D D  Y+PLAFLE+QGF  QEDF +W   NGY +LR FMD+A    
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRAKYEV  87

Query  84   VSGKDTAVDYSSCSGS--------------------CTLY--------------------  103
              G D +  +++  G+                    C +Y                    
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  104  ---------------WFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
                           W+W+G+R+LK AYSWQVYK C+PL  S  + + A   S 
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVSQTAPVTSG  201

>PHYSO_246676
Length=187

 Score = 102 bits (254),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 76/148 (51%), Gaps = 28/148 (19%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
            HQ V+LP+P WT+ D    Y+PLAFLE+QGF TQEDF +WR  NGY TLR FMD+A    
Sbjct  11   HQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKAKYDV  70

Query  84   VSGKDTAVDYSSCSGSCTLYWFWMGVRY-----------------LKGAYSWQVYKNCVP  126
             SG D +  ++   G+         +R                  +K +YSW+VYK C+P
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASLVLDGMKNSYSWKVYKACIP  130

Query  127  LS-------TSARMLEGAANASAIAFGN  147
            LS        S R     +N+SA    N
Sbjct  131  LSGSGGTSQESTRTPNAPSNSSATTAPN  158

>PHYCA_102624
Length=195

 Score = 101 bits (251),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 73/167 (44%), Gaps = 59/167 (35%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF------NSWRS------------  69
            HQ V+LPKP W +++ D  + PL FLE  GF TQ DF      N ++S            
Sbjct  28   HQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAKYPV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
            + G D    F D                                         +   GKD
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              +DYS C G CTLYW+W+GVR+LK  YSWQVYK C+PL++  R L 
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQRSLR  194

>PPTG_15264
Length=194

 Score = 100 bits (250),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 77/169 (46%), Gaps = 61/169 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED------------------------  63
            HQ V+ P+P WT+++ D+ Y+PLAFLE QGF TQED                        
Sbjct  25   HQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKYTV  84

Query  64   ------FNSWRSANG-------------------------YDTLRAF----MDQAVSGKD  88
                  F  W    G                          D +R        +++ GKD
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  89   TAVDYSSC--SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              +DYSSC   G C L W+W+GVR+LK +YSWQVYK C+PL+T+ + L 
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PPTG_17366
Length=194

 Score = 100 bits (250),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 77/169 (46%), Gaps = 61/169 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED------------------------  63
            HQ V+ P+P WT+++ D+ Y+PLAFLE QGF TQED                        
Sbjct  25   HQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKYTV  84

Query  64   ------FNSWRSANG-------------------------YDTLRAF----MDQAVSGKD  88
                  F  W    G                          D +R        +++ GKD
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  89   TAVDYSSC--SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              +DYSSC   G C L W+W+GVR+LK +YSWQVYK C+PL+T+ + L 
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTTPKRLR  193

>PHYCA_102852
Length=195

 Score = 99.4 bits (246),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 73/167 (44%), Gaps = 59/167 (35%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFA---------TQEDFNSWRS---------  69
            HQ V+LP+P WT+ D D  Y+PLAFLE++GF          T+  + S R          
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRAKYPV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
              G D    F D                                         +   GK 
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              +DYSSC G+CTLYWFW+GVR+LK  YSWQVYK C+PL+   R L 
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTAGQRNLR  194

>PHYCA_102550
Length=268

 Score = 100 bits (250),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 73/163 (45%), Gaps = 59/163 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDF------NSWRS------------  69
            HQ V+LP P W +++ D  + PLAFLE QGF TQ+DF      N ++S            
Sbjct  28   HQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRAKYTV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             NG D    + D                                         +   GK 
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
              +DYS C G CTLYW+W+GVR+LK +YSWQVYK C+PL+ S 
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PYU1_G001741
Length=199

 Score = 98.6 bits (244),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 82/168 (49%), Gaps = 59/168 (35%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGF-------------------ATQEDFNSWR  68
            HQYV+LP PT+T +     ++PLAFLE+QGF                   A  +D  ++ 
Sbjct  27   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYT  86

Query  69   SANGYD------------------TLRA-----------FMDQA-----------VSGKD  88
             A+G D                  T+R+           ++D              +G  
Sbjct  87   VASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEG  136
              +DYSSC GSCTL W+WMG+R+LKG YSWQVYKNCVP+ +S R+ +G
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSSRRLGDG  194

>PYIR_25089
Length=262

 Score = 99.4 bits (246),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 83/168 (49%), Gaps = 61/168 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFN-------------------SWR  68
            HQYVILP PT+T +     ++PLAFLE+QGF T  DF+                   +++
Sbjct  28   HQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYK  87

Query  69   SANGYD-------------------TLRA-----------FMDQAVSGKDT---------  89
             A+G D                   T+R+           ++D+    K T         
Sbjct  88   VADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGT  147

Query  90   --AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
               +DYSSC GSC L W+WMG+R+LKG YSWQVYKNCVP+ T +R L+
Sbjct  148  TFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV-TGSRSLD  194

>PHALS_00498
Length=199

 Score = 95.9 bits (237),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 70/164 (43%), Gaps = 59/164 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFAT---------QEDFNSWRS---------  69
            HQ V+LP+P W + D D  Y+PLAFLE+Q F T         Q  F + R          
Sbjct  28   HQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAKYTV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
              G D    F D                                         +   GKD
Sbjct  88   VKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
              +DYSSC  +C L W+W+GVR+LK  YSWQVYK C+PLS SA+
Sbjct  148  YTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PPTG_10636
Length=246

 Score = 96.3 bits (238),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 75/164 (46%), Gaps = 59/164 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQG------FATQEDFNSWRS------------  69
            HQ V+LP+P WT+ D D  Y+PLAFLE+QG      F +  + N+++S            
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAKYEV  87

Query  70   ANGYDTLRAFMD-----------------------------------------QAVSGKD  88
             +G D    F D                                         +   GKD
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
              VDYSSC G+CTL W+W+G+R+LK  YSWQVYK C+PLS S  
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGE  191

>PHYCA_129425
Length=204

 Score = 95.1 bits (235),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 80/173 (46%), Gaps = 58/173 (34%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAF--------LED-------QGFATQEDF--------  64
            HQ V+LP PT+T+++ D  Y+PLAF        +ED        G+ T   F        
Sbjct  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAKYTV  87

Query  65   ---------------------NSWRSANGY----------DTLRAFMD----QAVSGKDT  89
                                 +    + GY          D+ R        +   GK  
Sbjct  88   TDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTY  147

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASA  142
             +DYSSC GSC L W+W+G R+LK  +SWQVYK C+PLS+SAR LEGAAN SA
Sbjct  148  NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSARRLEGAANESA  200

>PYU1_G001742
Length=213

 Score = 93.2 bits (230),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 79/167 (47%), Gaps = 60/167 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFAT-------------------QEDFNSWR  68
            HQYV+LP PT+T +     ++PLAFLE+QG+ T                    +D  +++
Sbjct  28   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYK  87

Query  69   SANGYD------------------TLRA-----------FMDQA-----------VSGKD  88
             A G D                  T+R+           ++D               G  
Sbjct  88   VAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              +DYSSC GSCTL W+WMG+R+LKG YSWQVYKNCVP+    R+LE
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG-GKRLLE  193

>PYU1_G001744
Length=213

 Score = 92.8 bits (229),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 79/167 (47%), Gaps = 60/167 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFAT-------------------QEDFNSWR  68
            HQYV+LP PT+T +     ++PLAFLE+QGF T                    +D  +++
Sbjct  28   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYK  87

Query  69   SANGYD------------------TLRA-----------FMDQAV-----------SGKD  88
             A G D                  T+R+           ++D  +            G  
Sbjct  88   VAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
              + Y+SC GSCTL W+WMG+R+LKG YSWQVYKNCVP+    R+LE
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG-GKRLLE  193

>PYVX_18173
Length=500

 Score = 96.7 bits (239),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 76/160 (48%), Gaps = 59/160 (37%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED---------FNSWRSANGYDTLRA  78
            HQ VILP PT+T E  D  + PLAFLE Q F+T +D         F+S R+    D+L +
Sbjct  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYS  294

Query  79   ----------FMD----------------------------------------QAVSGKD  88
                      F D                                        + +SGK 
Sbjct  295  VNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
              +DYS+C+GSCTLYW+W+GVRYLK  YSWQVYK CVP+S
Sbjct  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 58.9 bits (141),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            +DYS C  SC + WFW+G++Y    YSWQV+KNC+ LS SA
Sbjct  160  IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           Q V+ P P +  +  D   SP+A+LE QG  T  +  +W +  GY TLRA MD
Sbjct  38  QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90

>PHALS_03284
Length=188

 Score = 92.0 bits (227),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 70/164 (43%), Gaps = 59/164 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED---------FNSWRS---------  69
            HQ ++LP+P W + D D  Y+PLAFLE+Q F T  D         +NS R          
Sbjct  14   HQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRANYTV  73

Query  70   ANGYDTLRAFMD-----QAVS------------------------------------GKD  88
              G D    F D     Q +                                     GKD
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
              VDYSSC  +C +YW+W+ VR LK  YSWQVYK C+PL+ S +
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PHYSO_341599
Length=185

 Score = 91.7 bits (226),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 78/170 (46%), Gaps = 61/170 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQ---------------GFATQEDF--------  64
            HQ V+LP+P WT+ D +  Y+PLAFLE+Q               G+ +  DF        
Sbjct  11   HQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRAKYDV  70

Query  65   -----------------------NSWRSANGY-----------DTLRAFMD---QAVSGK  87
                                   N  RS  GY           DT+    D   +   GK
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRST-GYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  129

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGA  137
            D  VDYSSC G+CTL W+W+GVR+LK  YSWQVYK C+PL++ +    G+
Sbjct  130  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  179

>PHYSO_536424
Length=197

 Score = 90.5 bits (223),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 78/170 (46%), Gaps = 61/170 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQ---------------GFATQEDF--------  64
            HQ V+LP+P WT+ D +  Y+PLAFLE++               G+ +  DF        
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYDV  82

Query  65   -----------------------NSWRSANGY-----------DTLRAFMD---QAVSGK  87
                                   N  RS  GY           DT+    D   +   GK
Sbjct  83   TSGADFSCGFTDPKGTPQPIPEGNKMRST-GYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGA  137
            D  VDYSSC G+CTL W+W+GVR+LK  YSWQVYK C+PL++ +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PHYSO_507031
Length=197

 Score = 90.5 bits (223),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 78/170 (46%), Gaps = 61/170 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQ---------------GFATQEDF--------  64
            HQ V+LP+P WT+ D +  Y+PLAFLE++               G+ +  DF        
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAKYDV  82

Query  65   -----------------------NSWRSANGY-----------DTLRAFMD---QAVSGK  87
                                   N  RS  GY           DT+    D   +   GK
Sbjct  83   TSGADFSCGFTDPKGTPQPIPEGNKMRST-GYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGA  137
            D  VDYSSC G+CTL W+W+GVR+LK  YSWQVYK C+PL++ +    G+
Sbjct  142  DYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMASTGS  191

>PITG_19818
Length=147

 Score = 88.2 bits (217),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 7/95 (7%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
            HQ V+LP+P WT++D D  Y+PLAFLE+QGF  Q+DF +WR  NGY +LR FMD+A    
Sbjct  26   HQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRANLFR  85

Query  84   -VSGKDTAVDYSSCSGSC--TLYWFWMGVRYLKGA  115
             V+  D  V  ++    C  T  W WM     + +
Sbjct  86   RVTPCDRLVTRTTDRARCGSTTRWCWMATTVTRSS  120

>PITG_13520
Length=171

 Score = 87.0 bits (214),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 53/76 (70%), Gaps = 4/76 (5%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
            HQ V+LP+P WT++D D  Y+PLAFLE+QGF TQ+DF +WR  NGY +LR FMD+A    
Sbjct  28   HQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRAKYDV  87

Query  84   VSGKDTAVDYSSCSGS  99
             SG D +  ++   G+
Sbjct  88   TSGADFSCGFTDPKGT  103

>PHYKE_8104
Length=86

 Score = 84.7 bits (208),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 42/56 (75%), Gaps = 0/56 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83
           HQ V+LP+PTWT+ D D  Y+PLAFLE +GF  QEDF +WR  NGY +LR FMD A
Sbjct  28  HQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDNA  83

>PPTG_10048
Length=190

 Score = 84.7 bits (208),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 72/163 (44%), Gaps = 59/163 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQ---------------GFATQEDFNS------  66
            HQ V+ P P W +++ D  ++PLAFLE Q               G+ T  DF        
Sbjct  25   HQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAKYTV  84

Query  67   ---------WRSANGY--------------------------DTLRAFMDQ---AVSGKD  88
                     W +  G                           DT     D    ++ GK+
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  89   TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
              +DYS C G+C LYW+W+GVR+LK +YSWQVYK C+PL+T++
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PHYSO_499978
Length=174

 Score = 83.2 bits (204),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK  87
           HQ V+ P+P WT+ D +  Y+PLAFLE+QGFATQ+DF  WR+ NGY TLR FMD      
Sbjct  28  HQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKYTV  87

Query  88  DTAVDYS  94
               D+S
Sbjct  88  TKGADFS  94

>PHYSO_501575
Length=174

 Score = 83.2 bits (204),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGK  87
           HQ V+ P+P WT+ D +  Y+PLAFLE+QGFATQ+DF  WR+ NGY TLR FMD      
Sbjct  28  HQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGKYTV  87

Query  88  DTAVDYS  94
               D+S
Sbjct  88  TKGADFS  94

>PYIR_26626
Length=212

 Score = 83.6 bits (205),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 74/166 (45%), Gaps = 60/166 (36%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLED---------------QGFATQEDF--------  64
            HQ VILP PT+T+ D +V+++PLAFLE+               +G+ T   F        
Sbjct  28   HQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87

Query  65   ---------------NSWRSANGYDTLRAF----------------------MDQAVSGK  87
                           N  R      T+R+                        ++   GK
Sbjct  88   VDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGK  147

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARM  133
              ++ Y+SC GSCTL W+WMG+R+LK  +SWQVYK CVP+ +  R+
Sbjct  148  THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGSGRRL  193

>PHYSO_262732
Length=188

 Score = 80.5 bits (197),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 70/151 (46%), Gaps = 52/151 (34%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLEDQGFATQ-EDFN---------------  65
            HQ V +P PTWT      +E  ++W +PLAFLE+QGF T   DF                
Sbjct  22   HQVVYIPSPTWTRANSTAAERRELW-NPLAFLENQGFQTHLRDFMDNAKYTVTEGADQAC  80

Query  66   SWRSANGY-------DTLRA-----------FM-----------DQAVSGKDTAVDYSSC  96
             W    G         T+R            +M            ++++ +   +DYS C
Sbjct  81   GWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGC  140

Query  97   SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
              SCTLYW+W+GVR+L   YSWQVYK C+P+
Sbjct  141  GDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PHYSO_340369
Length=200

 Score = 80.5 bits (197),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 64/151 (42%), Gaps = 52/151 (34%)

Query  28   HQYVILPKPTWTS------EDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
            +Q V +P PTWT+      E   +W  PLA+ EDQGF T  +F  W+  NG+ TLR FMD
Sbjct  25   NQVVHIPAPTWTAANSTTDEQRKLWM-PLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  83

Query  82   Q------------------------------------AVSGKDTAV---------DYSSC  96
                                                 A S  D  V         DYS C
Sbjct  84   NGNYSVTSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGC  143

Query  97   SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
              SC +YW+ +GV      YSW+VYK C+PL
Sbjct  144  GASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PHYKE_7717
Length=568

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)

Query  83   AVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            A  GKD  +DYS+C G+CTL W+W+GVR+LK AYSWQVYK C+PL+
Sbjct  1    AFPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>HYAP_07096
Length=251

 Score = 75.5 bits (184),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 66/160 (41%), Gaps = 61/160 (38%)

Query  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD-------  81
            Q V+ P P +  +D  +    LA+L++QG  T  +  SW+  +GY +LRA +D       
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  82   ---------------------------------------------QAVSGKDTAVD----  92
                                                         Q  SG++   +    
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  93   -----YSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
                 YSSC  SCTL W+W+G++Y+ G YSWQVYKNC+ L
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PYU1_G001739
Length=266

 Score = 74.7 bits (182),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 3/59 (5%)

Query  86   GKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIA  144
            GK   +DYSSC GSCTL W+W+GVRYLK  YSWQ+YK CV LS +A    G+A+AS  A
Sbjct  142  GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA---SGSASASTPA  197

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           HQ +I P+P +  +  D  + PLAFLE+QG  T  D   +    GY  LRA MD
Sbjct  24  HQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMD  77

>PHYKE_9185
Length=281

 Score = 74.3 bits (181),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (47%), Gaps = 66/165 (40%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLEDQG---------------FATQEDF--  64
            HQ V +P PTWT       E  ++W +PL+FLE +G               +A+  DF  
Sbjct  25   HQVVYIPSPTWTRPNSTSKERRELW-NPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMD  83

Query  65   -NSWRSANGYD-------------------TLR--------------------AFMD--Q  82
               ++ ++G D                   T+R                    ++++  +
Sbjct  84   KAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  143

Query  83   AVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +++ +   +DYS+C  SC LYW+W+GVR LKG+YSWQ+YK C+PL
Sbjct  144  SITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PPTG_14255
Length=268

 Score = 74.3 bits (181),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 71/164 (43%), Gaps = 64/164 (39%)

Query  28   HQYVILPKPTWT-----SEDHDVWYSPLAFLE---------------DQGFATQEDFNS-  66
            HQ V +P PTWT     S +  V ++PL+FLE               D G+ +  DF   
Sbjct  22   HQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN  81

Query  67   --------------WRSANGY--------------------------DTLR-AFMD--QA  83
                          W    G                           DTL  ++++  ++
Sbjct  82   AKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHES  141

Query  84   VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            ++ +   +DYS+C  SC LYW+W+GVRYLK  YSWQVYK C+PL
Sbjct  142  ITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PYIW_18791
Length=194

 Score = 72.4 bits (176),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 60/161 (37%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLE---------------DQGFAT----QEDFNSWR  68
            HQ V +PKP WT      +++PL+FLE               D+G++T     +D   ++
Sbjct  22   HQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYK  81

Query  69   SANGYD--------------------TLRA------------FMDQAVSGKD--------  88
            + +  D                    T+R               D+ V   D        
Sbjct  82   TNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN  141

Query  89   -TAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
             T VDYS+C G CT+ W+W+G+RYLK  +SWQVYKNC+ L+
Sbjct  142  TTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHYSO_417649
Length=185

 Score = 72.0 bits (175),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 69/165 (42%), Gaps = 66/165 (40%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLE---------------DQGFATQEDF--  64
            HQ V +P PTWT      SE  ++W +PL+FLE               D G+ +  DF  
Sbjct  21   HQVVYVPSPTWTRANSTASERRELW-NPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  79

Query  65   -NSWRSANGYDTLRAFMD-----------------------------------------Q  82
               ++  +G D    + D                                         +
Sbjct  80   RAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  139

Query  83   AVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +++ +   +DYS C  SC LYW+W+GVR LKG +SWQVYK C+PL
Sbjct  140  SITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PHYCA_536934
Length=983

 Score = 74.7 bits (182),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 70/164 (43%), Gaps = 64/164 (39%)

Query  28   HQYVILPKPTWT-----SEDHDVWYSPLAFLE---------------DQGFATQEDFNS-  66
            HQ V +P PTWT     S +  V ++PL+FLE               D G+    DF   
Sbjct  39   HQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN  98

Query  67   --------------WRSANGYD-------TLR--------------------AFMD--QA  83
                          W   NG         T+R                    ++++  ++
Sbjct  99   AKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHES  158

Query  84   VSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            ++ +   +DYS C  SC LYW+W+GVRYLK  YSWQVYK C+PL
Sbjct  159  ITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PYU1_G001740
Length=206

 Score = 72.4 bits (176),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/158 (32%), Positives = 66/158 (42%), Gaps = 58/158 (37%)

Query  28   HQYVILPKPTWTSEDHDVWYSPL---------------------------AFLEDQ----  56
            HQ VILP PT+T    D  +SPL                           AF++D+    
Sbjct  28   HQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYK  87

Query  57   ---------GFATQEDFNSWRSAN----GY----------DTLRAF----MDQAVSGKDT  89
                     G+  +        AN    GY          D  +        +   GK  
Sbjct  88   VNSNADFECGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH  147

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            A+ Y++C GSCTL W+WMG+R+LKG +SWQVYK CVPL
Sbjct  148  AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PHYCA_510817
Length=188

 Score = 71.2 bits (173),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 73/165 (44%), Gaps = 66/165 (40%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLE---------------DQGFATQEDF--  64
            HQ V +P PTWT       E  ++W +PL+FLE               D G+ +  DF  
Sbjct  23   HQVVYVPSPTWTRPNSTSKERRELW-NPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  81

Query  65   -NSWRSANGYD-------------------TLR--------------------AFMD--Q  82
               ++ ++G D                   T+R                    ++++  +
Sbjct  82   KAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHE  141

Query  83   AVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            ++  +   +DYS C  SC LYW+W+GVR LKG YSWQVYK C+PL
Sbjct  142  SIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PHYSO_343376
Length=172

 Score = 70.9 bits (172),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)

Query  38  WTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGKDTAVDYS  94
           WT+ D +  Y+PLAFLE+QGFATQ+DF +WR+ NGY TLR FMD          D+S
Sbjct  36  WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFS  92

>PHYSO_353401
Length=146

 Score = 70.5 bits (171),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 37/41 (90%), Gaps = 0/41 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            +DYS+C  SCTL+W+W+G++Y++GAYSWQVYKNCV LS +A
Sbjct  104  IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  50  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  3   LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLD  34

>PHYSO_341596
Length=231

 Score = 70.9 bits (172),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 12/76 (16%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA----  83
           HQ V+L        D D  Y+PLAFLE+QGF TQEDF SWR  NGY +LR FMD+A    
Sbjct  28  HQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDKAKYTV  79

Query  84  VSGKDTAVDYSSCSGS  99
            SG D +  ++   G+
Sbjct  80  TSGADFSCGFTDPKGT  95

>PPTG_14254
Length=188

 Score = 69.7 bits (169),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 66/165 (40%), Gaps = 66/165 (40%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLE---------------DQGFATQEDF--  64
            HQ V +P PTWT       E  ++W +PL+FLE               D G+ +  DF  
Sbjct  23   HQVVNVPAPTWTRANSTSKERRELW-NPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD  81

Query  65   -NSWRSANGYDTLRAFMD-----------------------------------------Q  82
               ++   G D    + D                                         +
Sbjct  82   RAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHE  141

Query  83   AVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            ++  +   +DYS C  SC LYW+W+GVR LKG YSWQVYK C+P+
Sbjct  142  SIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PYIR_26546
Length=239

 Score = 70.5 bits (171),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 63/163 (39%), Gaps = 63/163 (39%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLAFLEDQ----------------GFATQEDF-------  64
            HQ V+LPKPTWT E     + P+A+LE Q                GF T  +F       
Sbjct  28   HQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLY  87

Query  65   ------------------------NSWRSANGY----------DTLRAFM------DQAV  84
                                    N      GY          D ++ F       D A 
Sbjct  88   RPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVAS  147

Query  85   SGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
                  +D+SSC G CT+YW+WMG+R    + SWQ+YK C+PL
Sbjct  148  GMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYCA_537323
Length=200

 Score = 69.3 bits (168),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC  SCTL W+W+G++Y++G YSWQVYKNCV L T+A
Sbjct  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

 Score = 37.7 bits (86),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           Q V  P P +  +  D     LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  36  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88

>PPTG_17123
Length=201

 Score = 68.6 bits (166),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            VDYSSC  +CTL W+W+G++Y++G YSWQVYKNCV LST+
Sbjct  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           Q V+ P P +  +  D     LA+L++QG  T  +  SW   +GY +LRA +D
Sbjct  37  QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLD  89

>PPTG_08820
Length=250

 Score = 69.3 bits (168),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 2/49 (4%)

Query  82   QAVSGKDTAVDYSSC--SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            + + GK   +DYSSC   G CTLYWFW+G+R++K  +SWQVYK CVPL+
Sbjct  145  EKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLT  193

 Score = 67.4 bits (163),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 37/58 (64%), Gaps = 2/58 (3%)

Query  28  HQYVILPKPTWTS--EDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83
           HQ ++ P+P W     D D  + PLAFLE QGF  Q DFN WR+ +GY  LR FMD+A
Sbjct  28  HQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRA  85

>PYIW_18790
Length=86

 Score = 65.5 bits (158),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ----AV  84
           +YV+LP+PTWT +     ++PLAFLE+QGF T  DF ++    GY TLR FMD      V
Sbjct  3   RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  62

Query  85  SGKDTAVDYSSCSGS  99
            G D    +S+  G+
Sbjct  63  DGGDFECGWSTLKGT  77

>PHYRA_81105
Length=201

 Score = 67.0 bits (162),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/163 (25%), Positives = 66/163 (40%), Gaps = 60/163 (37%)

Query  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD-------  81
            Q V+ P P +  +  D     LA+L++QG  T  +   W   +GY +LR+ +D       
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  82   --------------------------------------------QAVSGKDTAVDY----  93
                                                        +A +G++   ++    
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  94   -----SSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
                 S+C  +C L W+W+G++Y++GAYSWQVYKNC+ L   A
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

>PITG_18452
Length=856

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VDYSSC GSC L W+W+G++Y++G YSWQVYKNCV LS
Sbjct  814  VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 28/53 (53%), Gaps = 0/53 (0%)

Query  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
            Q V+ P P +  +  D     LA+L++QG  T  +  SW    GY +LRA +D
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLD  744

>PYIW_18792
Length=125

 Score = 63.5 bits (153),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           HQYV LP PTWT +     ++PLAFLE QG+    DF ++  + GY  LR FMD
Sbjct  24  HQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMD  77

>PITG_10499
Length=323

 Score = 65.5 bits (158),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 34/52 (65%), Gaps = 2/52 (4%)

Query  34  PKPTWTS--EDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83
           P+P W     D D  + PLAFLE QGF  QEDFN WR+ NGY  LR FMD+A
Sbjct  4   PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRA  55

 Score = 63.5 bits (153),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 37/49 (76%), Gaps = 2/49 (4%)

Query  82   QAVSGKDTAVDYSSC--SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +++ G+   +D+SSC   G CTLYWFW+G+R++K  +SWQVYK C+ L+
Sbjct  115  ESIPGRTYKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PHYSO_527908
Length=174

 Score = 63.2 bits (152),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 59/152 (39%), Gaps = 66/152 (43%)

Query  28   HQYVILPKPTWT------SEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
            HQ V +P PTWT      +E  ++W  PLAFLE QGF TQ +F  +   NGY +LR FMD
Sbjct  22   HQVVHVPTPTWTRANSTSAECQELW-KPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMD  80

Query  82   QA----VSGKDTA---------------------------------------VDYSSCSG  98
                    G D A                                       + Y +C  
Sbjct  81   NGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHE  140

Query  99   S----------------CTLYWFWMGVRYLKG  114
            S                C LYW+W+GVR++KG
Sbjct  141  SITSQPFKLDYSACGDSCVLYWYWLGVRFIKG  172

>PHYRA_95184
Length=937

 Score = 62.8 bits (151),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)

Query  99   SCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            SC LYW+W+GVRYLKG+YSWQVYK C+PL
Sbjct  2    SCILYWYWLGVRYLKGSYSWQVYKECIPL  30

>PYAP_22273
Length=268

 Score = 61.6 bits (148),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 8/52 (15%)

Query  77   RAFMDQAVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +AF D+        +DYS+C G C L W+W+G+R +   YSWQ+YK C+PL+
Sbjct  145  KAFTDK--------IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

 Score = 58.2 bits (139),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ  82
           HQ V  P+  +T  D    + P A LE+QG+ T +DFN++ SANGY TLR FMD+
Sbjct  26  HQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDK  80

>PYAR_24096
Length=227

 Score = 60.1 bits (144),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 0/38 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +DYS+C G+C L W+W+G+R    +YSWQ+YK C+PLS
Sbjct  152  IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 0/55 (0%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ  82
           HQ V LP   +T  + +  + P A LE QG+ T  DFN++  AN Y TLR FMD+
Sbjct  27  HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81

>PYAP_24689
Length=252

 Score = 60.1 bits (144),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 38/75 (51%), Gaps = 7/75 (9%)

Query  73   YDTLRAFMDQAV-----SGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D  R F+D        S     +DYS C G C L ++W+G++   G   WQ YKNCVPL
Sbjct  121  FDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPL  178

Query  128  STSARMLEGAANASA  142
                RMLE   +  A
Sbjct  179  GNDKRMLEEGGDEVA  193

>PYAP_22278
Length=289

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 71/180 (39%), Gaps = 75/180 (42%)

Query  28   HQYVILPKPTWTSEDHDVWYSPLA---------------FLEDQGFATQEDF--------  64
            HQ V +P PT+T+ D +V ++PLA               FL  +G  T  D+        
Sbjct  25   HQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYK  84

Query  65   ------------------------NSWRSANGY---------------------DTLRAF  79
                                    N    + GY                     +  R  
Sbjct  85   IEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDV  144

Query  80   MDQAVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKG-AYSWQVYKNCVPLS---TSARMLE  135
             ++AVS K   +D+S C G+C L W+W+G R + G  +SWQ+YK CVPL    T+AR ++
Sbjct  145  GNKAVSYK---IDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTAARSID  201

>PYAP_24691
Length=145

 Score = 56.6 bits (135),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 3/52 (6%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARML-EGAANAS  141
            +DYS C G+C L ++W+G++   G   WQ YKNCVP+    RML EG   A+
Sbjct  34   IDYSKCKGNCLLRFYWLGLQ--DGGKRWQSYKNCVPIGNGKRMLAEGDDEAT  83

>PYAP_18131
Length=226

 Score = 57.0 bits (136),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 3/48 (6%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL---STSARMLE  135
            +D+S C G C + W+W+G+R L   +SWQVYK C+P+    T+AR ++
Sbjct  75   IDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTAARSID  122

>PYU1_G001738
Length=226

 Score = 57.0 bits (136),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)

Query  86   GKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            G +  +DYSSC GSC L W+W+G++ +   YSWQVYK CV L
Sbjct  140  GTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (55%), Gaps = 0/51 (0%)

Query  31  VILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           V+ P+P +  +  +   +P+A LE+QG  T  D + +    GY  LRA +D
Sbjct  25  VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLD  75

>PYIW_18788
Length=244

 Score = 56.2 bits (134),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 1/44 (2%)

Query  86   GKDTAVDYSSCSGSCTLYWFWMGV-RYLKGAYSWQVYKNCVPLS  128
            G  T +DYSSC G CTL W+ + V +   G+YSW+VYKNCV LS
Sbjct  145  GTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

 Score = 29.3 bits (64),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 17/32 (53%), Gaps = 0/32 (0%)

Query  50  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           +A LEDQ   T  D   +    GY +LRA +D
Sbjct  49  VARLEDQNVTTSADVAGFLKQKGYASLRAMLD  80

>PYAP_22279
Length=223

 Score = 55.8 bits (133),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 0/41 (0%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            +D+S C G+C L W+W+  R +   +SWQVYK CVPL  SA
Sbjct  149  IDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSA  189

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           HQ + +P PT T+ D +   +PLAFLE+QG    +D   +    G  TLR FMD
Sbjct  22  HQRITIPAPTLTT-DRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMD  74

>PHYCA_130365
Length=266

 Score = 55.5 bits (132),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 40/77 (52%), Gaps = 10/77 (13%)

Query  53   LEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGKDTAVDYSSC-SGSCTLYWFWMGVRY  111
            L+D+     +D  S       DT+  F           VDYSSC SG C L ++W+G++ 
Sbjct  126  LDDKMVLQNDDCQSAYGDGTQDTISVFK---------PVDYSSCASGGCMLRFYWLGLQR  176

Query  112  LKGAYSWQVYKNCVPLS  128
            L G   WQ YKNC+PL+
Sbjct  177  LDGKTVWQAYKNCIPLT  193

>PITG_04948
Length=232

 Score = 53.9 bits (128),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C L ++W+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCIPLSGPA  198

>PITG_04949
Length=337

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC+ G C L ++W+ ++ LKG   WQ YKNC+PL+  A
Sbjct  156  VDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  197

>PYIR_16435
Length=304

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D+SSC GSC L WFW+G++       WQVYKNCVPL
Sbjct  148  IDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCVPL  182

>PYAR_20617
Length=254

 Score = 53.5 bits (127),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 7/60 (12%)

Query  73   YDTLRAFMDQAV-----SGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D + AF D        S    AVD+S CSGSC L ++W+G++   G   WQ YKNCVPL
Sbjct  118  FDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PYU1_G005323
Length=251

 Score = 53.1 bits (126),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 39/61 (64%), Gaps = 7/61 (11%)

Query  73   YDTLRAFMD---QAVSGKDTA--VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D +RAF D   +   G  T+  VD+S+C GSC L ++W+G++   G   WQ YKNC+PL
Sbjct  117  FDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

Query  128  S  128
            +
Sbjct  175  T  175

>PHYRA_74651
Length=344

 Score = 53.1 bits (126),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 1/41 (2%)

Query  89   TAVDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            + VDYSSC SG CTL ++W+  + L  +  WQVYKNCVPL+
Sbjct  157  SPVDYSSCPSGGCTLRFYWLAFQGLDSSTVWQVYKNCVPLT  197

>PPTG_04618
Length=326

 Score = 52.8 bits (125),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query  90   AVDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
             VDYSSC SG C L ++W+ ++ L G   WQ YKNC+PL+  A
Sbjct  155  PVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PPTG_04619
Length=276

 Score = 52.4 bits (124),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C   ++W+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCIPLSGPA  198

>PYU1_G006672
Length=57

 Score = 48.9 bits (115),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 4/52 (8%)

Query  77   RAFMDQAVSGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +AF  + ++     VD+SSC GSC L ++W+G +       WQVYKNCV L 
Sbjct  10   KAFAGKGITESKMPVDFSSCKGSCMLRFYWLGFQ----NEQWQVYKNCVRLK  57

>PHYSO_485524
Length=278

 Score = 52.4 bits (124),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C   ++W+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCIPLSGPA  198

>PHYSO_483955
Length=320

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C L ++W+ ++ L G   WQ YKNC+PL+  A
Sbjct  156  VDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PHYKE_3913
Length=321

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 1/39 (3%)

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VDYSSC+ G C   ++WM ++ L G   WQVYKNCVPL+
Sbjct  184  VDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVPLT  222

>PHYCA_531163
Length=314

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 3/61 (5%)

Query  74   DTLRAFMDQAVSGKD--TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            D L A+ D  V  K   T VDYSSCS S C L ++W+  + +  A  WQVYK+CVPL+  
Sbjct  140  DCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVWQVYKDCVPLTGP  199

Query  131  A  131
            A
Sbjct  200  A  200

>PYU1_G005324
Length=191

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 3/46 (7%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  135
            +D+S+C G+C L ++W+G++   G   WQ YKNCVPL +S  R LE
Sbjct  141  IDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PYU1_G005326
Length=191

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 3/46 (7%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  135
            +D+S+C G+C L ++W+G++   G   WQ YKNCVPL +S  R LE
Sbjct  141  IDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PYU1_G005328
Length=191

 Score = 50.4 bits (119),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 3/46 (7%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  135
            +D+S+C G+C L ++W+G++   G   WQ YKNCVPL +S  R LE
Sbjct  141  IDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PHYRA_73583
Length=630

 Score = 51.2 bits (121),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C   ++W+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNCIPLSGPA  198

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            +DYSSC +G C   +FW+ ++       WQVYKNCVPLS  A
Sbjct  458  IDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNCVPLSGPA  499

>PHYKE_2809
Length=291

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 1/39 (3%)

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VDYSSC+ G C   ++W+ ++ L G   WQVYKNCVPLS
Sbjct  144  VDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCVPLS  182

>PHYRA_73582
Length=326

 Score = 50.4 bits (119),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 4/58 (7%)

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
            VDYS C+ G C L ++W+ ++ L G   WQ YKNC+PL+  A    G A+ +A + G+
Sbjct  155  VDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLTGPAG---GGASQTAPSTGD  209

 Score = 30.4 bits (67),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 28/68 (41%), Gaps = 7/68 (10%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED-------FNSWRSANGYDTLRAFM  80
           H Y+  P PTW  E+ + W   +A L   G+   +        F    + N Y  L+  M
Sbjct  24  HGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTLM  83

Query  81  DQAVSGKD  88
           D    G+D
Sbjct  84  DGPEFGED  91

>PYAP_18711
Length=210

 Score = 49.7 bits (117),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 29/42 (69%), Gaps = 2/42 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            +DYS C G+C L ++W+G++   G   WQ YKNCVP+ ++ +
Sbjct  141  IDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGSATK  180

>PHYRA_73607
Length=343

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 1/44 (2%)

Query  89   TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            T VDYSSCS S C L ++W+  + +  +  WQVYKNCVPL+  A
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQVYKNCVPLTGPA  200

>PHYRA_79140
Length=424

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 4/53 (8%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANA  140
            D  VDYSSC+G CTL  +W+  +  +    WQ Y NCVPLS S    +  + A
Sbjct  151  DMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLSGSGSATQTQSTA  199

>PYU1_G014690
Length=295

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D+SSC  +C L +FW+G++       WQVYKNCVPL
Sbjct  144  IDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKNCVPL  178

>PHALS_05392
Length=367

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 28/42 (67%), Gaps = 1/42 (2%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC+   C L ++W+ ++ L G   WQ YKNC+PL+  A
Sbjct  239  VDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKNCIPLNGPA  280

>CCI47381
Length=211

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 36/64 (56%), Gaps = 10/64 (16%)

Query  77   RAFMDQAVSGKDTA------VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            R F D   +G  T+      +++SSCSG C L +FW+ +   +    WQVYKNC+P++ +
Sbjct  131  RVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYKNCIPIAPN  186

Query  131  ARML  134
               L
Sbjct  187  GIRL  190

>PPTG_04647
Length=327

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query  76   LRAFMDQAVSGKD--TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            L A+ D  V  K   T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+  A
Sbjct  141  LTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPA  199

>PHYRA_83494
Length=224

 Score = 48.1 bits (113),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            D  VDYSSC+G CT   +W+  +  +    WQ Y NCVPL+ S    + AA+++
Sbjct  88   DMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLTGSGSTTQTAASST  137

>PPTG_04622
Length=273

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query  89   TAVDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            T VDYSSCS G C L ++W+  + +     WQVYK+CVPL+  A 
Sbjct  157  TPVDYSSCSTGGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPAE  201

>PYAR_14256
Length=199

 Score = 47.4 bits (111),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 3/47 (6%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL-STSARMLEG  136
            VD+S+C GSC L ++W+G++       WQ YKNC+PL    +R ++G
Sbjct  136  VDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPLGGAQSRSIDG  180

>PHYRA_77971
Length=230

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            VDYSSC+G CT   +W+G +  +    WQ Y NCVPLS +    +  A+ S
Sbjct  155  VDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQASGS  201

>PHYRA_85794
Length=230

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 4/51 (8%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            VDYSSC+G CT   +W+G +  +    WQ Y NCVPLS +    +  A+ S
Sbjct  155  VDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQASGS  201

>PYU1_G005325
Length=207

 Score = 47.4 bits (111),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D+S+C G+C L ++W+G++   G   WQ YKNC+PL
Sbjct  141  IDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>PYIR_16444
Length=182

 Score = 47.0 bits (110),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +D+SSC G+C L +FW+G++       WQVYKNCVP+ 
Sbjct  145  IDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVPVK  180

>PHYRA_83500
Length=394

 Score = 47.8 bits (112),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 29/53 (55%), Gaps = 4/53 (8%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANA  140
            D  VDYSSC+G CTL  +W+  +  +    WQ Y NC PLS S    +  + A
Sbjct  151  DMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSGSGSATQTQSTA  199

>PYIR_24743
Length=357

 Score = 47.8 bits (112),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (56%), Gaps = 11/61 (18%)

Query  74   DTLRAFMDQAVSGKDTA-------VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVP  126
            D  R F D+  +G  T+       VD+SSC  +C L ++W+ +       +WQVYKNCVP
Sbjct  143  DDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLALH----EPTWQVYKNCVP  198

Query  127  L  127
            L
Sbjct  199  L  199

>PHYCA_534473
Length=1050

 Score = 47.4 bits (111),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  89   TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+  A
Sbjct  929  TPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQVYKDCVPLTGPA  972

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (67%), Gaps = 1/39 (3%)

Query  91   VDYSSCS-GSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VDYSSC+ G C   ++W+ ++       WQVYKNC+PL+
Sbjct  626  VDYSSCAAGGCMFRYYWLALQRRDSKTLWQVYKNCIPLT  664

 Score = 33.9 bits (76),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQ  119
            VDYSSC SG C L ++W+ ++ LKG  + Q
Sbjct  156  VDYSSCASGGCMLRFYWLALQRLKGGGASQ  185

 Score = 30.4 bits (67),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 19/69 (28%), Positives = 31/69 (45%), Gaps = 10/69 (14%)

Query  53   LEDQGFATQEDFNSWRSANGYDTLRAFMDQAVSGKDTAVDYSSC-SGSCTLYWFWMGVRY  111
            L+D+   + +D  S       +T+  F           VDYSSC SG C   ++W+ ++ 
Sbjct  334  LDDKMVLSNDDCQSAYGDGTQETISVFK---------PVDYSSCASGGCMFRFYWLALQR  384

Query  112  LKGAYSWQV  120
            L G  + Q 
Sbjct  385  LDGGGASQT  393

>PHYSO_484051
Length=285

 Score = 47.0 bits (110),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query  89   TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+  A 
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPAE  201

>PHYKE_10578
Length=239

 Score = 46.6 bits (109),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 6/50 (12%)

Query  85   SGK--DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            SGK  +  +DYSSC+G C L ++W+G +  +    WQ Y NCVPL+ S +
Sbjct  146  SGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLTGSGK  191

>PHYRA_73581
Length=293

 Score = 47.0 bits (110),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            +DYSSCS S C L ++W+  +     Y WQ+YK+CVPL+  A 
Sbjct  166  IDYSSCSASGCMLRFYWLAFQGSNDGYVWQIYKHCVPLTGPAE  208

>PPTG_07507
Length=299

 Score = 47.0 bits (110),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VD+SSC+G CTL  +W+G +  +    WQ Y NCVPL  S 
Sbjct  153  VDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSG  189

>PHYRA_73584
Length=287

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  89   TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+  A
Sbjct  154  TPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQVYKDCVPLTGPA  197

>PPTG_07509
Length=299

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VD+SSC+G CTL  +W+G +  +    WQ Y NCVPL  S 
Sbjct  153  VDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSG  189

>PPTG_18166
Length=445

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 4/41 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VD+SSC+G CTL  +W+  +  +    WQ Y NCVPLS S+
Sbjct  152  VDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNCVPLSGSS  188

>PHYKE_2937
Length=366

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 3/61 (5%)

Query  74   DTLRAFMD--QAVSGKDTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            D + A+ D  Q  +   T VDYSSCS S C L ++W+  + +  +  WQVYK+CVPL+  
Sbjct  144  DCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQVYKDCVPLTGP  203

Query  131  A  131
            A
Sbjct  204  A  204

>SDRG_07565
Length=278

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 5/52 (10%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            VDYSSC GS C L ++W+ +   +    WQVYKNCVPL  + + ++    +S
Sbjct  213  VDYSSCGGSGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVKAVGPSS  260

>PHYSO_459106
Length=223

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC SG C   ++W+ ++       WQVYKNC+PL+  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRRDSKTYWQVYKNCIPLTGPA  198

>PYAP_18709
Length=235

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 33/60 (55%), Gaps = 7/60 (12%)

Query  74   DTLRAFMDQAV-----SGKDTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            D  RAF +        S     +D+ +C GSC L ++W+G++   G   WQ YKNC+PL+
Sbjct  118  DNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PHYCA_98479
Length=276

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  VDYSSC G CTL  +W+G +  +    WQ Y NCVPL
Sbjct  151  DMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PYAR_14261
Length=150

 Score = 45.4 bits (106),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFG  146
            +++S+C GSC L ++W+G++       WQ YKNCVPL       +    A   A G
Sbjct  26   INFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPLGGGGGGGKTEDKADGKADG  79

>PYAR_14260
Length=212

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 2/37 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            V++S+C GSC L ++W+G++       WQ YKNCVPL
Sbjct  117  VNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  151

>PYU1_G007364
Length=316

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 28/38 (74%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VD+SSC+G C + ++W+ ++      +WQ+YKNC+PL+
Sbjct  168  VDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIPLA  201

>PHYKE_10295
Length=292

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +DYSSCSG CT  ++WM +       +WQVYK C P++
Sbjct  154  IDYSSCSGDCTFTFYWMALHEP----NWQVYKQCAPIT  187

>PHYCA_12942
Length=353

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  +DYSSC+G+C L  +W+G +  +    WQ Y NCVPL
Sbjct  144  DMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PPTG_04620
Length=342

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 1/39 (3%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +DYSSC SG C   ++W+ ++       WQVYKNC+PLS
Sbjct  159  MDYSSCKSGGCMFRFYWLALQRRDSKTLWQVYKNCIPLS  197

>PHYSO_324755
Length=262

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  89   TAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+  A
Sbjct  128  TPVDYSSCSTSGCMLRFYWLAFQGVDSEIVWQVYKDCVPLTGPA  171

>PPTG_07511
Length=183

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 4/42 (10%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
             VDYSSC+G+C    +W+G R  +    WQ Y NCVPLS S 
Sbjct  65   PVDYSSCNGNCIFSIYWLGFRNAQ----WQAYINCVPLSGSG  102

>PHYRA_86016
Length=236

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            VDYSSC+G CTL  +W+  +  +    WQ Y NCVPL  S
Sbjct  90   VDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGS  125

>PHYRA_86752
Length=300

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            VDYSSC+G CTL  +W+  +  +    WQ Y NCVPL  S
Sbjct  154  VDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGS  189

>PYIW_19151
Length=248

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 2/41 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VD+S C G C + ++W+G++       WQVYK+CVP+S+SA
Sbjct  142  VDWSLCKGECMIRFYWLGLQA--SGTRWQVYKSCVPVSSSA  180

>PHYRA_73606
Length=366

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query  74   DTLRAFMD--QAVSGKDTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            D + A+ D  Q  +   T VDYSSCS S C L ++W+  + +     WQVYK+CVPL+
Sbjct  140  DCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVWQVYKDCVPLT  197

>CCA17179
Length=185

 Score = 44.7 bits (104),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (7%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
             +D+S+C+  C L +FW+ +   +    WQVYKNC+P++ +   L   +       GN
Sbjct  124  PIDFSTCTNGCLLQFFWLALHEPQ----WQVYKNCIPIAPNGIKLASISPNMNPGVGN  177

>PHYCA_18657
Length=295

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC+G CT   +W+G +  +    WQ Y NCVPLS + 
Sbjct  240  VDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  276

>PHALS_03179
Length=372

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 3/60 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPLSTS-ARMLEGAANASAIAFGN  147
            VDYSSC +G C  + ++W+  + +KG   WQ YKNC+PL  S   + EG  +A   +  N
Sbjct  194  VDYSSCANGGCKEMRFYWLAFQGIKGITFWQSYKNCIPLQGSGGGVTEGFGDAEQSSDNN  253

>H310_06362
Length=197

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VD+SSC GSCT+ ++W+ +        WQVYKNC PL
Sbjct  132  VDFSSCIGSCTIRFYWLALH----EDLWQVYKNCAPL  164

>PHALS_05394
Length=288

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 4/78 (5%)

Query  74   DTLRAFMDQAVSGKDT--AVDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            D   A+ D+A+  K     +DYSSC G  C L ++W+ ++ +     WQ YKNC+ +  S
Sbjct  139  DCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNCISIKGS  198

Query  131  ARMLEGA-ANASAIAFGN  147
            +    G  A+ S +A  N
Sbjct  199  SGGEVGRDADPSQLANAN  216

>PHALS_04411
Length=262

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 2/59 (3%)

Query  90   AVDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
             V YS C SG   L ++W+ ++ L+G   WQ YKNC+PL T      G +NA   ++G+
Sbjct  155  PVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPL-TGPGSGGGDSNAGKDSYGD  212

 Score = 30.4 bits (67),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 17/63 (27%), Positives = 26/63 (41%), Gaps = 11/63 (17%)

Query  28  HQYVILPKPTWTSEDHDVWYSPLAFL---------EDQGFATQEDFNSWRSANGYDTLRA  78
           H Y+  P PTW S++ + W   +  L          D+G  +   F    + N Y  +R 
Sbjct  24  HGYIAKPPPTWKSKETNKWVVEIKPLWDGPWDKSKGDEGLLST--FKELAAKNNYKNVRT  81

Query  79  FMD  81
            MD
Sbjct  82  LMD  84

>SDRG_08129
Length=218

 Score = 44.3 bits (103),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 5/46 (11%)

Query  91   VDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
            VDYSSC+G  C L ++W+ +   +    WQVYKNCVPL  + + ++
Sbjct  151  VDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVK  192

>PITG_04947
Length=298

 Score = 44.7 bits (104),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  91   VDYSSC-SGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +DYSSC SG C   ++W+ ++       WQVYKNC+PL
Sbjct  132  MDYSSCKSGGCMFRFYWLALQRRDQKTLWQVYKNCIPL  169

>PHYRA_77293
Length=302

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +D+SSCSG CT  ++WM +       +WQVYK C P++
Sbjct  154  IDFSSCSGDCTFTFYWMAMHEP----NWQVYKQCAPIA  187

>SDRG_08137
Length=282

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 5/46 (11%)

Query  91   VDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
            VDYSSC+G  C L ++W+ +   +    WQVYKNCVPL  + + ++
Sbjct  215  VDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVK  256

>PPTG_10186
Length=270

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (52%), Gaps = 10/66 (15%)

Query  74   DTLRAFMDQAVSGKDTA------VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            DT+    D  V+   T        D+S CSG CTL ++W+ +       +WQ+YK CVP+
Sbjct  138  DTMVDHQDDCVAAYGTGYPASVKADFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPI  193

Query  128  STSARM  133
              ++ M
Sbjct  194  VNNSGM  199

>HYAP_14170
Length=266

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 4/36 (11%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D+S CSG CTL ++W+ +  +    +WQVYK CVP+
Sbjct  149  DFSRCSGVCTLRFYWLALHEV----NWQVYKQCVPI  180

>PYVX_14662
Length=540

 Score = 44.7 bits (104),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC SG C  + ++W+  + + G   WQVYKNC+PL
Sbjct  155  VDYSSCNSGGCKEMRFYWLAFQGVDGDTVWQVYKNCIPL  193

>PYVX_21643
Length=260

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 4/43 (9%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            +  +DYSSCSG C   ++W+ +       +WQVYK C P+S S
Sbjct  150  EIPIDYSSCSGDCDFTFYWLALH----EPNWQVYKQCAPISNS  188

>PHYRA_86151
Length=170

 Score = 43.5 bits (101),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)

Query  50  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83
           L+FLE +GF TQE+F  ++  NGY +LR F+D+A
Sbjct  29  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKA  62

>PYU1_G005985
Length=200

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 26/45 (58%), Gaps = 4/45 (9%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
            V++S C G CTL ++W+ +       +WQVYK CVP+    + L 
Sbjct  159  VNFSVCQGKCTLTFYWLALH----EPTWQVYKQCVPIENQGKRLR  199

>PHYCA_122958
Length=260

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 4/36 (11%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            DYS CSG CTL ++W+ +       +WQ+YK CVP+
Sbjct  159  DYSQCSGDCTLRFYWLALH----EPNWQIYKQCVPI  190

>PHYKE_1913
Length=280

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +DYSSC+G CTL  +W+  +  +    WQ Y NCVPL
Sbjct  154  IDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PITG_20312
Length=270

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARM  133
            D+S CSG CTL ++W+ +       +WQ+YK CVP+  ++ M
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPIMNNSGM  199

>PITG_20631
Length=270

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 4/42 (10%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARM  133
            D+S CSG CTL ++W+ +       +WQ+YK CVP+  ++ M
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPIMNNSGM  199

>PHYRA_87941
Length=157

 Score = 43.5 bits (101),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)

Query  50  LAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83
           L+FLE +GF TQE+F  ++  NGY +LR F+D+A
Sbjct  16  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKA  49

>PPTG_01148
Length=295

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VD+SSCSG CT  ++W+ +       +WQVYK C P++
Sbjct  154  VDFSSCSGDCTFTFYWLALHEP----NWQVYKQCAPIT  187

>PYVX_24563
Length=254

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 4/39 (10%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            D+S CSGSCTL ++W+ +       +WQ+YK C P++ S
Sbjct  158  DFSKCSGSCTLRFYWLALH----EPNWQIYKQCAPITNS  192

>PYAP_18221
Length=226

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 4/41 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYS C G+C L ++W+ +   K    WQ YK CVP+   A
Sbjct  160  VDYSKCKGTCRLTFYWLALHSQK----WQAYKQCVPIKYGA  196

>PYU1_G007476
Length=195

 Score = 43.5 bits (101),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARML  134
            VD+SSC G+C L  +W+G  +      WQ YK CVP+    + L
Sbjct  150  VDFSSCKGTCMLRMYWLG--FQDQGQRWQTYKYCVPVKKGGKRL  191

>H257_13550
Length=266

 Score = 43.9 bits (102),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VD++SC GSCT+ ++W+ +        WQVYKNC PL
Sbjct  187  VDFASCVGSCTIRFYWIALHQ----DLWQVYKNCAPL  219

>PHALS_06480
Length=159

 Score = 42.7 bits (99),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 0/53 (0%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           Q V+ P P +  +  D     LA+LE+QG  T  +  SW   + Y++LRA +D
Sbjct  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87

>PHYRA_84732
Length=265

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 30/48 (63%), Gaps = 5/48 (10%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVP-LSTSARMLEG  136
            + D+S CSG CTL ++W+ +       +WQVYK CVP ++ S   ++G
Sbjct  160  SADFSKCSGDCTLRFYWLALH----EPNWQVYKQCVPVVNNSGTQVQG  203

>PITG_01966
Length=327

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            +D+SSCSG CT  ++W+ +       +WQVYK C P++
Sbjct  187  IDFSSCSGDCTFTFYWLALHEP----NWQVYKQCAPIT  220

>SDRG_17317
Length=122

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query  90   AVDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
             +DYSSCSG  C L ++W+ +        WQVYKNCVPL  +  
Sbjct  74   PIDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPLEGNGE  113

>PHYCA_69583
Length=224

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (56%), Gaps = 7/59 (12%)

Query  91   VDYSSCSGS-CTLYWFWMGVR-YLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
            +DYSSCS S C   ++W+  +    G Y WQ+YK+C+PL+       GA  +S +   N
Sbjct  160  IDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLTG-----PGAGKSSTVGASN  213

>PHYSO_329293
Length=310

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
             DYSSC G C L ++W+ +       +WQ+YK CVP++
Sbjct  155  ADYSSCKGDCLLVFYWLALHEP----NWQIYKQCVPIT  188

>PHYSO_488921
Length=296

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
             DYSSC G C L ++W+ +       +WQ+YK CVP++
Sbjct  155  ADYSSCKGDCLLVFYWLALHEP----NWQIYKQCVPIT  188

>PHYSO_342364
Length=194

 Score = 42.7 bits (99),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  91   VDYSSCS--GSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYS C   G C + ++W+G + L     WQ YKNC+PL
Sbjct  154  VDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

>SPRG_19916
Length=305

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 5/51 (10%)

Query  83   AVSGKDTAVDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            A    +  +DYSSCSG  C L ++W+ +        WQVYKNCVPL  + +
Sbjct  145  AKPAANLPIDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPLEGNGQ  191

>PHYSO_262844
Length=276

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +DYS+CSG CT  ++W+ +       +WQVYK C P+
Sbjct  154  IDYSACSGDCTFTFYWLALHEP----NWQVYKQCAPI  186

>PHYKE_8390
Length=130

 Score = 42.0 bits (97),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  29  QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD  81
           Q V+ P P +  +  D     LA+L++QG  T  +   W +++GYD+LRA +D
Sbjct  31  QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLD  83

>PYIR_20481
Length=277

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +  VDYS C G C L ++W+ +       +WQ+YK CVP+
Sbjct  151  EIPVDYSKCKGKCQLTFYWLALH----EPNWQIYKQCVPI  186

>PYAP_22257
Length=247

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 29/57 (51%), Gaps = 8/57 (14%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
            V+YS C G C L ++W+ +   +    WQVYKNCVP+        G   +S    GN
Sbjct  151  VNYSVCKGECMLRFYWLALHEPE----WQVYKNCVPIVNKG----GKGPSSGACTGN  199

>PHYKE_2539
Length=258

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEG  136
            D+S CSG CTL ++W+ +       +WQ+YK CVP+  ++   E 
Sbjct  149  DFSKCSGDCTLRFYWIALH----EPNWQIYKQCVPVVNNSGAQEA  189

>PYU1_G005868
Length=267

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +  VDYS C G C L ++W+ +       +WQ+YK CVP+
Sbjct  151  EIPVDYSVCKGKCQLTFYWLALHEP----NWQIYKQCVPI  186

>PPTG_07520
Length=294

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  VD+SSC+G C L  +W+  +  +    WQ Y NCVPL
Sbjct  149  DMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PPTG_07516
Length=294

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  VD+SSC+G C L  +W+  +  +    WQ Y NCVPL
Sbjct  149  DMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYCA_97965
Length=288

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +VD+SSC+G CTL  +W+  +  +    WQ Y NCVPL
Sbjct  155  SVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PHYSO_476077
Length=268

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 4/36 (11%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D+S CSG CTL ++W+ +       +WQ+YK CVP+
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPV  193

>PHYSO_472009
Length=268

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 4/36 (11%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D+S CSG CTL ++W+ +       +WQ+YK CVP+
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPV  193

>PHYCA_12943
Length=287

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 4/38 (11%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +VD+SSC+G CTL  +W+  +  +    WQ Y NCVPL
Sbjct  155  SVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PYIW_18794
Length=247

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 3/48 (6%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST-SARMLEGA  137
            +D+SSC   C L ++W+G++  +GA  WQ YKNCVP++  S+R ++ A
Sbjct  184  IDWSSCKSKCVLRFYWLGLQ-DQGAL-WQSYKNCVPITAGSSRSIDDA  229

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVY  121
            +D+SSC+  C L ++W+G++   G   WQ Y
Sbjct  126  IDWSSCASKCVLRFYWLGLQ--DGGERWQSY  154

>PPTG_07521
Length=281

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  VDYSSC+  CTL  +W+  +      +WQ Y NCVPL
Sbjct  151  DMPVDYSSCTEDCTLTIYWLAFQN----ANWQAYINCVPL  186

>PYAR_17163
Length=114

 Score = 40.8 bits (94),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEG  136
            +  V +S+C G+CTL ++W+ +   +    WQVYK C  L  + RML G
Sbjct  71   EIPVSFSACKGTCTLTFYWLALHEPQ----WQVYKQCA-LIKNGRMLRG  114

>PITG_11956
Length=339

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 53/112 (47%), Gaps = 16/112 (14%)

Query  28   HQYVILPKPTWTSEDHD-VWYSPLAFLEDQGF------ATQED---FNSWRSANGYDTLR  77
            H Y+ +PK  +T++  D   Y       D GF      A +++   F     A+ Y +L+
Sbjct  41   HGYLTIPKVRFTAQAGDPTQYIASIQASDSGFSGTFNGAPKDNVAAFTKAFKASKYTSLK  100

Query  78   AF-MDQAVSGKDT-AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
             F  D+A  G      D  +C G+ TL ++WM +     + SWQVY NC PL
Sbjct  101  EFFTDKAKIGVPVLPFDREACMGATTLTFYWMAMH----SESWQVYVNCAPL  148

>PYVX_16673
Length=681

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 27/43 (63%), Gaps = 4/43 (9%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            +  +DYSSC+G CT  ++W+ +   +    WQ++K C P++ S
Sbjct  592  EIPIDYSSCTGDCTFTFYWLPLHEPE----WQIFKQCAPITRS  630

>PYIW_15526
Length=256

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYS C G+C L ++W+ V   K    WQVYK CV +
Sbjct  156  VDYSVCKGTCRLTFYWLAVHSPK----WQVYKGCVAI  188

>PHYKE_5749
Length=300

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D  VDYSSC+G C    +W+  +  +    WQ Y NCVPL
Sbjct  152  DMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PHALS_03176
Length=207

 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 2/43 (5%)

Query  91   VDYSSCS-GSCT-LYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC+ G C  + ++W+  + + G   WQ YKNC+PL  S+
Sbjct  153  VDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSYKNCIPLQGSS  195

>SPRG_22161
Length=300

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  83   AVSGKDTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            A    +  VDYSSC  + C L ++W+ +        WQVYKNCVPL  + +    A   +
Sbjct  145  AKPAANLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKNCVPLKGNGQQPTSAPKPT  200

Query  142  A  142
            A
Sbjct  201  A  201

>SDRG_17448
Length=262

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  91   VDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            VDYSSC+G  C L ++W+ +   +    WQVYKNCVPL  + +
Sbjct  49   VDYSSCAGDGCMLRFYWIALHQPE----WQVYKNCVPLQGNGQ  87

>PYAR_17166
Length=114

 Score = 40.4 bits (93),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEG  136
            +  V +S+C G+CTL ++W+ +   +    WQVYK C  L  + RML G
Sbjct  71   EMPVSFSACQGTCTLTFYWLALHEPQ----WQVYKQCA-LIKNGRMLRG  114

>PHYSO_255975
Length=187

 Score = 41.2 bits (95),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 29/48 (60%), Gaps = 6/48 (13%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL--STSARMLEGA  137
            ++S C G CTL ++W+ +   K    WQ+YK CVP+  ++ AR L  A
Sbjct  144  NFSKCLGDCTLRFYWLALHEPK----WQIYKQCVPIVNNSGARALRTA  187

>PHYRA_83499
Length=473

 Score = 42.0 bits (97),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (56%), Gaps = 4/45 (9%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
            VDYSSC+G CTL  +W+  +  +    WQ Y NCV L  S    +
Sbjct  154  VDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQ  194

 Score = 36.6 bits (83),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 4/34 (12%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVY  121
            D  +DYSSC+G+CTL  +W+G +  +    WQ Y
Sbjct  384  DMPIDYSSCNGACTLAIYWLGFQNEQ----WQAY  413

>PYIW_18065
Length=308

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 5/38 (13%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D+SSC    CTL ++W+ ++  K    WQ+YKNCVPL
Sbjct  157  IDFSSCKKPGCTLKFYWLTLQEPK----WQIYKNCVPL  190

>PHYKE_10296
Length=512

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 10/57 (18%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
             DYSSC G C   ++W+ +        WQ+YK CVP++       G +    +A GN
Sbjct  435  TDYSSCKGDCLFVFYWLALHQA----DWQIYKQCVPITN------GGSGQKEVADGN  481

 Score = 41.6 bits (96),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (61%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
             DYSSC G C   ++W+ +   +    WQ+YK CVP++
Sbjct  155  TDYSSCKGDCLFVFYWLALHQAE----WQIYKQCVPIT  188

>PHYKE_6001
Length=289

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC  G C  + ++W+  + + G   WQ YKNC+PL  S 
Sbjct  154  VDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPLEGSG  196

>PYIR_16443
Length=275

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 3/35 (9%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVY-KNC  124
            +D+SSC GSC L WFW+G++       WQVY K+C
Sbjct  145  IDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PHYCA_14560
Length=300

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 4/42 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
             DYSSC G C   ++W+ +        WQ+YK CVP++ + +
Sbjct  155  ADYSSCKGDCLFVFYWLALHEPD----WQIYKQCVPITNNGK  192

>PHYCA_103479
Length=314

 Score = 41.2 bits (95),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            DYSSC G C   ++W+ +       +WQ+YK CVP++
Sbjct  156  DYSSCKGDCLFSFYWLALHEP----NWQIYKQCVPIT  188

>PPTG_01153
Length=317

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (53%), Gaps = 4/53 (8%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAI  143
             DYSSC G C   ++W+ +       +WQ+YK CVP++ +         +S++
Sbjct  155  ADYSSCKGDCLFAFYWLALHEP----NWQIYKQCVPITNNGSGASTTTQSSSV  203

>PYU1_G005866
Length=194

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (68%), Gaps = 4/40 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
            V+YS C G+C L ++W+ +       +WQ+YK+CVP++ S
Sbjct  159  VNYSVCKGNCILTFYWLALH----EPNWQIYKHCVPVNYS  194

>PHYKE_6079
Length=302

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 20/68 (29%)

Query  74   DTLRAFMDQAVSGKDTAVDYSS-----------CSGSCTLYWFWMGVRYLKGAYSWQVYK  122
            D +R F D     KD A DY+S           C G+ TL ++W+ +     + +WQVY 
Sbjct  141  DDVRVFQD-----KDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYV  191

Query  123  NCVPLSTS  130
            NC PL T+
Sbjct  192  NCAPLETT  199

>PHYRA_77290
Length=309

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTS  130
             D+SSC G C   ++W+ +       +WQ+YK CVP++ S
Sbjct  157  ADFSSCKGDCLFVFYWLALHEP----NWQIYKQCVPITNS  192

>PITG_05271
Length=278

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 27/43 (63%), Gaps = 2/43 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            VDYSSC +G C  + ++W+  + + G   WQ YK+C+PL  S 
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPLEGSG  196

>SPRG_07799
Length=345

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 4/38 (11%)

Query  90   AVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            A+D + C+G+ TL +FW+ +     + SWQVYKNCV L
Sbjct  154  AIDTTKCAGAKTLRFFWLALH----SSSWQVYKNCVAL  187

>SPRG_19917
Length=241

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (57%), Gaps = 5/46 (11%)

Query  83   AVSGKDTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            A    +  VDYSSC    C L ++W+ +   +    WQVYKNCVPL
Sbjct  145  AKPAANLPVDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>SDRG_17318
Length=241

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 5/41 (12%)

Query  88   DTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +  VDYSSC    C L ++W+ +   +    WQVYKNCVPL
Sbjct  150  NLPVDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>PHYCA_562062
Length=237

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VD+SSCSG CT  ++W+ +       +WQVYK C  ++
Sbjct  155  VDFSSCSGDCTFTFYWLALH----EPNWQVYKQCAAIT  188

>PYAP_18584
Length=210

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 23/40 (58%), Gaps = 4/40 (10%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +  VDYS C G C L ++W+ +       +WQ+YK C P+
Sbjct  156  ELPVDYSVCKGKCQLTFYWLALH----EPNWQIYKQCAPI  191

>PYIW_25463
Length=216

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131
            +  + Y++C G+C L ++W+ +   K    WQ YK+CVP+   A
Sbjct  155  NIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCVPIKAGA  194

>PYU1_G005867
Length=200

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 31/46 (67%), Gaps = 5/46 (11%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  135
            ++Y++C  S CTL ++W+ +       +WQ+YK+CVP++ S ++ +
Sbjct  159  INYAACKTSKCTLTFYWLALH----EPNWQIYKHCVPITNSKKLRD  200

>PHYSO_340332
Length=295

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC +G C  + ++W+  + + G   WQ YK+C+PL
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PYIR_20483
Length=287

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
             D+S C G+C + ++W+ +   K    WQ+YK CVP+
Sbjct  162  TDFSVCKGTCRVTFYWLALHSQK----WQIYKQCVPV  194

>PHYSO_340333
Length=284

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC +G C  + ++W+  + + G   WQ YK+C+PL
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>SPRG_07796
Length=322

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query  74   DTLRAFMDQAVSGKDTA----VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST  129
            D+ R F +   +    +    +D + C+G+  L   W+ +       SWQVY NCVPLS 
Sbjct  130  DSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLALH----TPSWQVYINCVPLSG  185

Query  130  SARMLEGAANAS  141
            S  ++  AA+ S
Sbjct  186  STVVIPPAASPS  197

>PHYCA_534296
Length=309

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC +G C  + ++W+  + + G   WQ YK+C+PL
Sbjct  128  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  166

>PHYSO_488139
Length=265

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 5/39 (13%)

Query  91   VDYSSCSG-SCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
            VDYS+C G  C   ++W+ V     +  WQ+YK CVP+S
Sbjct  158  VDYSACKGDKCLFVFYWLAVH----SPEWQIYKQCVPIS  192

>PYIW_20715
Length=264

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 5/43 (12%)

Query  88   DTAVDYSS-CSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST  129
            +  VDY+  C G C L ++W+ +   K    WQ+YK CVP+ +
Sbjct  138  EIKVDYAKVCKGKCQLTFYWLALHEPK----WQIYKQCVPIQS  176

>PYIW_27477
Length=180

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (4%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141
            +D+S+C G C L WFW+G++       WQVY          R  EG+   +
Sbjct  122  IDFSACKGKCMLRWFWLGLQ--DSGKRWQVYIPGHDHQGPGRHHEGSGQGN  170

>PYAR_21941
Length=61

 Score = 36.6 bits (83),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 6/41 (15%)

Query  90   AVDYSSCSG--SCTLYWFWMGVRYLKGAYSWQVYKNCVPLS  128
             VDYS C    +CTL ++W+ +       +WQVYK CVP++
Sbjct  15   PVDYSVCQSGQTCTLTFYWLALH----EPNWQVYKQCVPIT  51

>SDRG_00948
Length=352

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            +D + C+G+ TL +FW+ +     + SWQVYKNCV L
Sbjct  155  IDTAKCAGAKTLRFFWLALH----SSSWQVYKNCVAL  187

>PHYRA_78689
Length=296

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  91   VDYSSC-SGSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC SG C  + ++W+  + L     WQ YK+C+PL
Sbjct  154  VDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>SPRG_07797
Length=318

 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 8/62 (13%)

Query  74   DTLRAFMDQAVSGK----DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST  129
            D +R F D   +        ++D S CSG+  L   W+ +     +  WQVYKNCV LS 
Sbjct  130  DNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----SPQWQVYKNCVNLSG  185

Query  130  SA  131
            +A
Sbjct  186  AA  187

>PYIR_24421
Length=213

 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 8/56 (14%)

Query  92   DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANASAIAFGN  147
            D S CSG+  L ++W+ +     + +WQVY NC PLS +    +G   A A A GN
Sbjct  136  DKSKCSGASMLRFYWVALH----SSTWQVYINCAPLSGA----KGNNKAPAPAKGN  183

>PPTG_03160
Length=379

 Score = 38.9 bits (89),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (51%), Gaps = 10/61 (16%)

Query  74   DTLRAFMDQAVSGKDTAV------DYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            D +R F D   +   T V      D  +C G+ TL ++WM +     + SWQVY NC PL
Sbjct  138  DDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAMH----SSSWQVYVNCAPL  193

Query  128  S  128
            +
Sbjct  194  A  194

>PPTG_04617
Length=496

 Score = 38.9 bits (89),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 1/39 (3%)

Query  91   VDYSSCSGSCTLYWF-WMGVRYLKGAYSWQVYKNCVPLS  128
            +DYSSCS S  +Y F W+  +     Y  Q+Y++CVPL+
Sbjct  131  IDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLT  169

>PHYCA_14563
Length=296

 Score = 38.5 bits (88),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 54/118 (46%), Gaps = 23/118 (19%)

Query  28   HQYVILPKPTWTS-EDHDVWYSPLAFLEDQGFA----TQEDFNSWR------SANGYDTL  76
            H Y+  PK T+   ED+  + +  +   ++GF       E  N+ +      SA GY +L
Sbjct  149  HGYLSQPKATFKPVEDYTKYVATTSANINKGFDGGVYNHEPVNNAKQFAEHWSATGYSSL  208

Query  77   RAFMDQAVSG----KDTA--VDYSSCSGSCTLYWFWMGVRYLKG-AYSWQVYKNCVPL  127
            R  +D  V G     DTA  VD SS S       +W    Y +G   S  VYKNCVP+
Sbjct  209  REMLDTLVPGCGNSDDTASPVDVSSFSE-----MWWQNNEYKEGFLESHHVYKNCVPI  261

>PYAP_18226
Length=226

 Score = 38.1 bits (87),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 22/65 (34%), Positives = 29/65 (45%), Gaps = 11/65 (17%)

Query  74   DTLRAFMDQAVSGK------DTAVDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVP  126
            D  R F +   +G          VDYS C  S C L ++W+ +   K    WQ YK CVP
Sbjct  138  DNTRVFQNNDCAGNYKSYPASLPVDYSKCKSSKCMLRFYWLALHSEK----WQAYKQCVP  193

Query  127  LSTSA  131
            +   A
Sbjct  194  IKYGA  198

>SDRG_08782
Length=450

 Score = 38.5 bits (88),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  91   VDYSSCSGS-CTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSAR  132
            VDYSSC  + C L ++W+ +        WQVYKNCVPL  + +
Sbjct  152  VDYSSCGANGCMLRFYWLALHEPM----WQVYKNCVPLKGNGQ  190

>PYU1_G005869
Length=259

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
             D+S C G+C + ++W+ +     + +WQ+YK CVP+
Sbjct  160  TDFSVCKGTCRVTFYWLALH----SPNWQIYKQCVPV  192

>PYIR_15187
Length=207

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  91   VDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127
            V++S C   CTL ++W+ +       +WQVYK CVP+
Sbjct  164  VNFSLCKDKCTLTFYWLALH----EPTWQVYKQCVPI  196

>PHYSO_255056
Length=269

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  92   DYSSCSGSCTLYWFWMGVR-YLKGAYSWQVYKNCVPLS  128
            DY S +G C   ++W+  +    G Y WQ+YKNC+PL+
Sbjct  150  DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PPTG_14221
Length=275

 Score = 38.1 bits (87),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  90   AVDYSSCS-GSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
             VDYSSC+ G C  + ++W+  + L     WQ YK+C+PL
Sbjct  153  PVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKDCIPL  192

>PHYSO_438103
Length=238

 Score = 38.1 bits (87),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  91   VDYSSCS-GSCT-LYWFWMGVRYLKGAYSWQVYKNCVPL  127
            VDYSSC+ G C  + ++W+  + L     WQ YK+C+PL
Sbjct  153  VDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

Lambda      K        H        a         alpha
   0.319    0.131    0.436    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4284931392

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40