Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_18175147521471477045e-96
PYVX_18179534611471225302e-69
PHYCA_14368528562191414131e-50
PYVX_18176568762011793929e-48
PITG_18450147522031993832e-46
PHYKE_8388568762052073693e-44
PYVX_18174854042042043512e-41
PPTG_17121568762021803493e-41
PHYSO_477820568762022033432e-40
PHYCA_511409568762041793415e-40
PPTG_10643457052501793212e-36
PHYSO_246676457051871523102e-35
PPTG_17122147522042023112e-35
PHYCA_102852242061951933042e-34
PHYSO_284086147522041823033e-34
PHYKE_8389147522042053023e-34
PHYSO_254168462841701402942e-33
PYU1_G001741854041991972963e-33
PPTG_10048213141901682936e-33
PHYKE_3446231281991902921e-32
PHYCA_129425147522042022852e-31
PHYRA_82864231281931732842e-31
PHYRA_81106147522021812842e-31
PYU1_G001742932042132052842e-31
PHYRA_78625541464341312937e-31
PHYSO_49997823128174952788e-31
PHYSO_50157582077174952788e-31
PHYRA_78626578954731312931e-30
PHYCA_14369109792481902812e-30
PPTG_10634720132081682772e-30
PHYRA_81107568762022032772e-30
PHYRA_85631109792281892782e-30
PHYRA_84190720132061782763e-30
PITG_1352010979171952733e-30
PHYSO_34159910979185772744e-30
PPTG_10635528561991722729e-30
PHYKE_81047713586672622e-29
PHYKE_7718109792201832703e-29
PYIR_25089854042621702716e-29
PPTG_1063610979246772663e-28
PITG_1981815643147972532e-27
PPTG_14254445761881742511e-26
PPTG_1526423128194632502e-26
PPTG_1736623913194632502e-26
PHALS_00498109791991722502e-26
PHYCA_10255045705268862524e-26
PHYCA_102624720131951942476e-26
PYU1_G001744568762131942452e-25
PHYSO_417649445761851682432e-25
PYIR_26626147522121932417e-25
PHYSO_53642460691197732362e-24
PHYSO_50703158653197732362e-24
PHALS_03284309411881732353e-24
PHYSO_340369526762001602283e-23
PHYKE_9185445762811812309e-23
PHYSO_34159652856231772261e-22
PHYSO_262732469371881542162e-21
PYU1_G001740147522061852146e-21
PHYSO_34337653237172582056e-20
PYIW_18791854041941641972e-18
PHYCA_510817445761881771962e-18
PYIW_1879293204125841895e-18
PPTG_088208662250881931e-17
PHYKE_771752856568411981e-17
PYIW_187905687686541831e-17
PYVX_18173449665001671982e-17
PYAP_22278932042891831906e-17
PHYSO_527908600641741551856e-17
PHYCA_53693413059831661892e-16
PPTG_14255469372681651844e-16
PYIR_26546866052391711816e-16
PHYSO_35340153461146411767e-16
PYU1_G00173993203266511819e-16
PYU1_G001738534612261611737e-15
PHYCA_53732344966200411701e-14
PPTG_1712314753201401682e-14
PYAP_22273932032681681704e-14
PITG_1845214753856381701e-13
PITG_104998662323541681e-13
PYAP_22279854042231791642e-13
PHYRA_8110553461201411622e-13
HYAP_0709653461251741624e-13
PYAP_24689101439252751608e-13
PYAP_24691101441145751532e-12
PYAR_2409693203227431545e-12
PYAP_1813199172226521511e-11
PHYRA_9518452672937291541e-11
PYIW_1878893203244431432e-10
PYU1_G00532484534191531332e-09
PYU1_G00532646349191531332e-09
PYU1_G0053284233191531332e-09
PYAP_1871194356210581343e-09
PYU1_G00532394355251611335e-09
PYIR_164354233304371336e-09
PHYKE_1057877880239511301e-08
PYAR_20617104048254441292e-08
PITG_049494235337421302e-08
PYU1_G00532594356207441273e-08
PITG_049484234232421264e-08
PHYCA_1303654235266391265e-08
PHYSO_342361529821551371235e-08
PHYRA_8579472619230601255e-08
PHYRA_7797170555230601255e-08
PHYRA_7465169969344391258e-08
PHYSO_4855244234278531258e-08
PPTG_0751120433183501229e-08
PYAR_1426194356150441219e-08
PHYKE_39134234321391241e-07
PHYRA_791403807424561241e-07
PPTG_046194234276421231e-07
PYAR_1426084534212441221e-07
PYAR_1425694355199441211e-07
PPTG_046184235326421231e-07
PHYCA_186573807295561222e-07
PHYKE_280975282291391222e-07
PHYSO_4839554235320421222e-07
PYAP_1870994355235451212e-07
PPTG_0750971814299621203e-07
PPTG_075073807299621203e-07
PYU1_G0066729480057381114e-07
PYU1_G0146904234295371194e-07
PHYRA_735834234630421204e-07
PHYRA_8350071814394561196e-07
PHYCA_1294221331353441196e-07
PHYCA_9847981950276411178e-07
PHYRA_8601672746236601178e-07
PHYRA_8675273236300601179e-07
PHYRA_8615172836170531141e-06
PHYRA_735824235326421171e-06
PHYRA_8794174106157531131e-06
PHYRA_7360719434343441161e-06
PYIR_164444234182371141e-06
PHYRA_8349446435224531151e-06
SDRG_07565124412278521152e-06
PHYKE_191373236280451152e-06
PHALS_053924235367421152e-06
PYIW_1915183191248411142e-06
PHYRA_7358169693293601143e-06
PPTG_046204233342391133e-06
PYAP_1822194496226521123e-06
PPTG_0462269696273451133e-06
PPTG_1816624206445411134e-06
PHYSO_34236452983194431105e-06
PHYCA_53116319434314441115e-06
PYIR_2474385164357371116e-06
PHYKE_102951729292381116e-06
PHYSO_324755504352621031107e-06
PYU1_G00736485164316451107e-06
SDRG_08129136331218471098e-06
SDRG_08137136334282471099e-06
PYU1_G00747653913195441089e-06
PHYSO_48405157198285451099e-06
PITG_049474233298381091e-05
PHYSO_48892157461296371091e-05
PHYSO_32929351032310371091e-05
PHYCA_53447342331050441091e-05
H310_063621730197371071e-05
CCI473811729211831071e-05
PYIW_1806585164308461081e-05
PHALS_0317930883372431091e-05
PHYCA_9796540187288451081e-05
PHYCA_1294336971287451081e-05
PYIW_18794166885247481072e-05
PHYRA_735844233287441082e-05
PHALS_053944234288421072e-05
PYU1_G00598582077200451062e-05
PHYKE_293757198366441072e-05
PHYRA_772931729302461072e-05
PHYRA_8349920433473601072e-05
PPTG_0464719434327441072e-05
PHYSO_45910619434223421062e-05
PYU1_G0058681729267371062e-05
PYIR_204811729277371062e-05
PYVX_216431729260481063e-05
PYAP_22257100361247371053e-05
H257_135501730266371053e-05
PYIW_155261730256371053e-05
PHYCA_10347951032314371054e-05
PHYRA_7360657198366411054e-05
PHYCA_1456057461300411054e-05
PITG_019661729327381054e-05
PHYKE_253916173258471044e-05
PPTG_0115394495317521045e-05
CCA171791729185481025e-05
PHYKE_1029657461512371045e-05
HYAP_1417016173266361036e-05
PHYSO_25597546424187571026e-05
PPTG_1018616173270421036e-05
PPTG_0751646435294451036e-05
PYVX_1466251086540391046e-05
PPTG_075203814294451036e-05
PHYRA_7729057461309401036e-05
PITG_2031215981270421037e-05
PPTG_011481729295381037e-05
PITG_2063116173270421037e-05
SDRG_173171617312243997e-05
PHYSO_2628441729276371037e-05
PHYCA_12295816173260361027e-05
PYVX_2456316173254391028e-05
PITG_1195697913391211038e-05
SPRG_221611730300571021e-04
PYIW_25463165039216511011e-04
SPRG_1991616173305431021e-04
PHYKE_57493807300451021e-04
PYVX_166731731681401021e-04
PHYRA_8473216173265451011e-04
PYU1_G00586657461194401001e-04
PHYCA_6958346349224401001e-04
PYU1_G00586794495200461001e-04
PHALS_03176447820743992e-04
PYAR_17163172911449962e-04
PYIR_204831730287361002e-04
PPTG_0752145030281411002e-04
PYU1_G00587216173297531002e-04
PYIR_164438239927535992e-04
PYU1_G0058719449628453992e-04
PYAP_18584172921051982e-04
PHYKE_6001447828943992e-04
PHYSO_4760771617326836982e-04
PHYSO_4720091598126836982e-04
SDRG_1744813848926243983e-04
PHYRA_867517323516340963e-04
PHYSO_488139173026539974e-04
PYIW_20715172926442974e-04
PHALS_044119449626239974e-04
PYIR_235858453424037965e-04
PITG_05271447827843975e-04
PYAR_17166173011453926e-04
PYU1_G005869173025936966e-04
PHALS_064805346115953937e-04
PYIR_151878207720737948e-04
PHYSO_340332447829539940.001
PHYCA_1322554346812858910.001
PHYRA_77291173025238940.001
PYU1_G0058735103221445930.001
PHYSO_3403335267128439940.001
PHYCA_5342965267130939930.001
PPTG_181762421226341930.001
PHYCA_14559173025141930.001
PYAR_219411045566150870.001
SPRG_1991713394624138930.001
SDRG_1731813394624138930.001
PPTG_01152173026241920.002
PYAP_182268406222659920.002
PHYCA_562062172923749920.002
PPTG_011475746126341920.002
PHYSO_5339036046520844910.002
PHYKE_60795977330239910.003
PHYSO_2550564634926938910.003
PYIW_274778239918031890.003
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18175

Length=147
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18175                                                            275        5e-96
PYVX_18179                                                            208        2e-69
PHYCA_14368                                                           163        1e-50
PYVX_18176                                                            155        9e-48
PITG_18450                                                            152        2e-46
PHYKE_8388                                                            146        3e-44
PYVX_18174                                                            139        2e-41
PPTG_17121                                                            139        3e-41
PHYSO_477820                                                          136        2e-40
PHYCA_511409                                                          135        5e-40
PPTG_10643                                                            128        2e-36
PHYSO_246676                                                          124        2e-35
PPTG_17122                                                            124        2e-35
PHYCA_102852                                                          121        2e-34
PHYSO_284086                                                          121        3e-34
PHYKE_8389                                                            120        3e-34
PHYSO_254168                                                          117        2e-33
PYU1_G001741                                                          118        3e-33
PPTG_10048                                                            117        6e-33
PHYKE_3446                                                            117        1e-32
PHYCA_129425                                                          114        2e-31
PHYRA_82864                                                           114        2e-31
PHYRA_81106                                                           114        2e-31
PYU1_G001742                                                          114        2e-31
PHYRA_78625                                                           117        7e-31
PHYSO_499978                                                          111        8e-31
PHYSO_501575                                                          111        8e-31
PHYRA_78626                                                           117        1e-30
PHYCA_14369                                                           112        2e-30
PPTG_10634                                                            111        2e-30
PHYRA_81107                                                           111        2e-30
PHYRA_85631                                                           111        2e-30
PHYRA_84190                                                           110        3e-30
PITG_13520                                                            109        3e-30
PHYSO_341599                                                          110        4e-30
PPTG_10635                                                            109        9e-30
PHYKE_8104                                                            105        2e-29
PHYKE_7718                                                            108        3e-29
PYIR_25089                                                            108        6e-29
PPTG_10636                                                            107        3e-28
PITG_19818                                                            102        2e-27
PPTG_14254                                                            101        1e-26
PPTG_15264                                                            100        2e-26
PPTG_17366                                                            100        2e-26
PHALS_00498                                                           100        2e-26
PHYCA_102550                                                          101        4e-26
PHYCA_102624                                                          99.8       6e-26
PYU1_G001744                                                          99.0       2e-25
PHYSO_417649                                                          98.2       2e-25
PYIR_26626                                                            97.4       7e-25
PHYSO_536424                                                          95.5       2e-24
PHYSO_507031                                                          95.5       2e-24
PHALS_03284                                                           95.1       3e-24
PHYSO_340369                                                          92.4       3e-23
PHYKE_9185                                                            93.2       9e-23
PHYSO_341596                                                          91.7       1e-22
PHYSO_262732                                                          87.8       2e-21
PYU1_G001740                                                          87.0       6e-21
PHYSO_343376                                                          83.6       6e-20
PYIW_18791                                                            80.5       2e-18
PHYCA_510817                                                          80.1       2e-18
PYIW_18792                                                            77.4       5e-18
PPTG_08820                                                            79.0       1e-17
PHYKE_7717                                                            80.9       1e-17
PYIW_18790                                                            75.1       1e-17
PYVX_18173                                                            80.9       2e-17
PYAP_22278                                                            77.8       6e-17
PHYSO_527908                                                          75.9       6e-17
PHYCA_536934                                                          77.4       2e-16
PPTG_14255                                                            75.5       4e-16
PYIR_26546                                                            74.3       6e-16
PHYSO_353401                                                          72.4       7e-16
PYU1_G001739                                                          74.3       9e-16
PYU1_G001738                                                          71.2       7e-15
PHYCA_537323                                                          70.1       1e-14
PPTG_17123                                                            69.3       2e-14
PYAP_22273                                                            70.1       4e-14
PITG_18452                                                            70.1       1e-13
PITG_10499                                                            69.3       1e-13
PYAP_22279                                                            67.8       2e-13
PHYRA_81105                                                           67.0       2e-13
HYAP_07096                                                            67.0       4e-13
PYAP_24689                                                            66.2       8e-13
PYAP_24691                                                            63.5       2e-12
PYAR_24096                                                            63.9       5e-12
PYAP_18131                                                            62.8       1e-11
PHYRA_95184                                                           63.9       1e-11
PYIW_18788                                                            59.7       2e-10
PYU1_G005324                                                          55.8       2e-09
PYU1_G005326                                                          55.8       2e-09
PYU1_G005328                                                          55.8       2e-09
PYAP_18711                                                            56.2       3e-09
PYU1_G005323                                                          55.8       5e-09
PYIR_16435                                                            55.8       6e-09
PHYKE_10578                                                           54.7       1e-08
PYAR_20617                                                            54.3       2e-08
PITG_04949                                                            54.7       2e-08
PYU1_G005325                                                          53.5       3e-08
PITG_04948                                                            53.1       4e-08
PHYCA_130365                                                          53.1       5e-08
PHYSO_342361                                                          52.0       5e-08
PHYRA_85794                                                           52.8       5e-08
PHYRA_77971                                                           52.8       5e-08
PHYRA_74651                                                           52.8       8e-08
PHYSO_485524                                                          52.8       8e-08
PPTG_07511                                                            51.6       9e-08
PYAR_14261                                                            51.2       9e-08
PHYKE_3913                                                            52.4       1e-07
PHYRA_79140                                                           52.4       1e-07
PPTG_04619                                                            52.0       1e-07
PYAR_14260                                                            51.6       1e-07
PYAR_14256                                                            51.2       1e-07
PPTG_04618                                                            52.0       1e-07
PHYCA_18657                                                           51.6       2e-07
PHYKE_2809                                                            51.6       2e-07
PHYSO_483955                                                          51.6       2e-07
PYAP_18709                                                            51.2       2e-07
PPTG_07509                                                            50.8       3e-07
PPTG_07507                                                            50.8       3e-07
PYU1_G006672                                                          47.4       4e-07
PYU1_G014690                                                          50.4       4e-07
PHYRA_73583                                                           50.8       4e-07
PHYRA_83500                                                           50.4       6e-07
PHYCA_12942                                                           50.4       6e-07
PHYCA_98479                                                           49.7       8e-07
PHYRA_86016                                                           49.7       8e-07
PHYRA_86752                                                           49.7       9e-07
PHYRA_86151                                                           48.5       1e-06
PHYRA_73582                                                           49.7       1e-06
PHYRA_87941                                                           48.1       1e-06
PHYRA_73607                                                           49.3       1e-06
PYIR_16444                                                            48.5       1e-06
PHYRA_83494                                                           48.9       1e-06
SDRG_07565                                                            48.9       2e-06
PHYKE_1913                                                            48.9       2e-06
PHALS_05392                                                           48.9       2e-06
PYIW_19151                                                            48.5       2e-06
PHYRA_73581                                                           48.5       3e-06
PPTG_04620                                                            48.1       3e-06
PYAP_18221                                                            47.8       3e-06
PPTG_04622                                                            48.1       3e-06
PPTG_18166                                                            48.1       4e-06
PHYSO_342364                                                          47.0       5e-06
PHYCA_531163                                                          47.4       5e-06
PYIR_24743                                                            47.4       6e-06
PHYKE_10295                                                           47.4       6e-06
PHYSO_324755                                                          47.0       7e-06
PYU1_G007364                                                          47.0       7e-06
SDRG_08129                                                            46.6       8e-06
SDRG_08137                                                            46.6       9e-06
PYU1_G007476                                                          46.2       9e-06
PHYSO_484051                                                          46.6       9e-06
PITG_04947                                                            46.6       1e-05
PHYSO_488921                                                          46.6       1e-05
PHYSO_329293                                                          46.6       1e-05
PHYCA_534473                                                          46.6       1e-05
H310_06362                                                            45.8       1e-05
CCI47381                                                              45.8       1e-05
PYIW_18065                                                            46.2       1e-05
PHALS_03179                                                           46.6       1e-05
PHYCA_97965                                                           46.2       1e-05
PHYCA_12943                                                           46.2       1e-05
PYIW_18794                                                            45.8       2e-05
PHYRA_73584                                                           46.2       2e-05
PHALS_05394                                                           45.8       2e-05
PYU1_G005985                                                          45.4       2e-05
PHYKE_2937                                                            45.8       2e-05
PHYRA_77293                                                           45.8       2e-05
PHYRA_83499                                                           45.8       2e-05
PPTG_04647                                                            45.8       2e-05
PHYSO_459106                                                          45.4       2e-05
PYU1_G005868                                                          45.4       2e-05
PYIR_20481                                                            45.4       2e-05
PYVX_21643                                                            45.4       3e-05
PYAP_22257                                                            45.1       3e-05
H257_13550                                                            45.1       3e-05
PYIW_15526                                                            45.1       3e-05
PHYCA_103479                                                          45.1       4e-05
PHYRA_73606                                                           45.1       4e-05
PHYCA_14560                                                           45.1       4e-05
PITG_01966                                                            45.1       4e-05
PHYKE_2539                                                            44.7       4e-05
PPTG_01153                                                            44.7       5e-05
CCA17179                                                              43.9       5e-05
PHYKE_10296                                                           44.7       5e-05
HYAP_14170                                                            44.3       6e-05
PHYSO_255975                                                          43.9       6e-05
PPTG_10186                                                            44.3       6e-05
PPTG_07516                                                            44.3       6e-05
PYVX_14662                                                            44.7       6e-05
PPTG_07520                                                            44.3       6e-05
PHYRA_77290                                                           44.3       6e-05
PITG_20312                                                            44.3       7e-05
PPTG_01148                                                            44.3       7e-05
PITG_20631                                                            44.3       7e-05
SDRG_17317                                                            42.7       7e-05
PHYSO_262844                                                          44.3       7e-05
PHYCA_122958                                                          43.9       7e-05
PYVX_24563                                                            43.9       8e-05
PITG_11956                                                            44.3       8e-05
SPRG_22161                                                            43.9       1e-04
PYIW_25463                                                            43.5       1e-04
SPRG_19916                                                            43.9       1e-04
PHYKE_5749                                                            43.9       1e-04
PYVX_16673                                                            43.9       1e-04
PHYRA_84732                                                           43.5       1e-04
PYU1_G005866                                                          43.1       1e-04
PHYCA_69583                                                           43.1       1e-04
PYU1_G005867                                                          43.1       1e-04
PHALS_03176                                                           42.7       2e-04
PYAR_17163                                                            41.6       2e-04
PYIR_20483                                                            43.1       2e-04
PPTG_07521                                                            43.1       2e-04
PYU1_G005872                                                          43.1       2e-04
PYIR_16443                                                            42.7       2e-04
PYU1_G005871                                                          42.7       2e-04
PYAP_18584                                                            42.4       2e-04
PHYKE_6001                                                            42.7       2e-04
PHYSO_476077                                                          42.4       2e-04
PHYSO_472009                                                          42.4       2e-04
SDRG_17448                                                            42.4       3e-04
PHYRA_86751                                                           41.6       3e-04
PHYSO_488139                                                          42.0       4e-04
PYIW_20715                                                            42.0       4e-04
PHALS_04411                                                           42.0       4e-04
PYIR_23585                                                            41.6       5e-04
PITG_05271                                                            42.0       5e-04
PYAR_17166                                                            40.0       6e-04
PYU1_G005869                                                          41.6       6e-04
PHALS_06480                                                           40.4       7e-04
PYIR_15187                                                            40.8       8e-04
PHYSO_340332                                                          40.8       0.001
PHYCA_132255                                                          39.7       0.001
PHYRA_77291                                                           40.8       0.001
PYU1_G005873                                                          40.4       0.001
PHYSO_340333                                                          40.8       0.001
PHYCA_534296                                                          40.4       0.001
PPTG_18176                                                            40.4       0.001
PHYCA_14559                                                           40.4       0.001
PYAR_21941                                                            38.1       0.001
SPRG_19917                                                            40.4       0.001
SDRG_17318                                                            40.4       0.001
PPTG_01152                                                            40.0       0.002
PYAP_18226                                                            40.0       0.002
PHYCA_562062                                                          40.0       0.002
PPTG_01147                                                            40.0       0.002
PHYSO_533903                                                          39.7       0.002
PHYKE_6079                                                            39.7       0.003
PHYSO_255056                                                          39.7       0.003
PYIW_27477                                                            38.9       0.003
PPTG_03160                                                            39.3       0.003
PHYRA_78161                                                           39.3       0.004
SPRG_07799                                                            39.3       0.004
SDRG_08782                                                            39.3       0.004
PHYSO_438103                                                          38.9       0.004
PHALS_03177                                                           38.9       0.004
PHYKE_6078                                                            38.9       0.004
PPTG_14221                                                            38.9       0.004
PPTG_04617                                                            39.3       0.005
PHYKE_8390                                                            37.7       0.005
PYAR_21940                                                            38.9       0.005
PHYCA_127270                                                          38.5       0.006
PHYRA_78689                                                           38.5       0.006
PITG_01969                                                            38.1       0.007
PYVX_22511                                                            38.5       0.007
PHYSO_318693                                                          38.5       0.008
PHYRA_78176                                                           38.1       0.008
PHYCA_552912                                                          38.1       0.009
PHYKE_3912                                                            37.7       0.010
PHYSO_374518                                                          37.0       0.010
PYIW_15528                                                            38.1       0.010
PYAP_22462                                                            37.7       0.011
PHYRA_78177                                                           37.7       0.011
PHYCA_19598                                                           37.7       0.012
SDRG_16535                                                            37.7       0.013
SPRG_07627                                                            37.7       0.013
SDRG_00948                                                            37.7       0.014
PPTG_03161                                                            37.7       0.014
PHYSO_533682                                                          37.4       0.015
PPTG_03143                                                            37.4       0.015
SDRG_15426                                                            37.4       0.017
PHYSO_524101                                                          37.4       0.018
PPTG_03156                                                            37.4       0.019
PPTG_03138                                                            37.0       0.019
PHALS_10635                                                           37.0       0.020
PITG_11936                                                            37.0       0.021
PHYCA_19612                                                           37.0       0.024
PHYCA_120062                                                          36.6       0.027
PYAP_21398                                                            35.8       0.028
PHALS_05110                                                           36.2       0.029
SPRG_07796                                                            36.6       0.033
PPTG_04803                                                            36.2       0.033
PHYCA_18729                                                           36.6       0.034
PYIR_24421                                                            36.2       0.035
PHYSO_246481                                                          36.2       0.036
PHYSO_375794                                                          35.4       0.037
PPTG_03148                                                            36.2       0.038
PYAP_20456                                                            36.2       0.039
PHYKE_2379                                                            36.2       0.040
PHYRA_84947                                                           36.2       0.043
PHALS_01460                                                           36.2       0.043
PHYRA_78169                                                           36.2       0.044
PYAP_18713                                                            35.8       0.046
HYAP_11925                                                            35.8       0.048
PYIR_14463                                                            35.8       0.052
PHALS_02044                                                           35.8       0.056
PPTG_04801                                                            35.8       0.056
PYAP_16347                                                            35.4       0.060
PHYSO_525076                                                          35.8       0.062
PITG_11942                                                            35.4       0.071
PHYRA_77292                                                           35.0       0.071
PYVX_20789                                                            35.4       0.072
PYVX_20783                                                            35.4       0.073
PYIR_22187                                                            35.0       0.082
PYAP_23672                                                            35.0       0.083
PYAP_16994                                                            35.0       0.084
PPTG_09880                                                            35.0       0.084
PYIR_23622                                                            35.0       0.085
PHALS_08575                                                           35.0       0.086
PYIW_13243                                                            35.0       0.092
PYIW_16810                                                            35.0       0.095
PYAR_23252                                                            35.0       0.099
PHYCA_14558                                                           34.7       0.10 
PYAR_18165                                                            35.0       0.10 
SPRG_07826                                                            35.0       0.11 
SPRG_07795                                                            35.0       0.11 
PHYSO_318690                                                          34.7       0.11 
PHYCA_19606                                                           35.0       0.12 
PHYCA_12944                                                           34.3       0.13 
PYVX_21174                                                            33.5       0.13 
PITG_08202                                                            34.3       0.14 
PHYKE_7446                                                            34.7       0.15 
PHYKE_6069                                                            34.3       0.16 
PHALS_02041                                                           34.3       0.17 
PYIR_19612                                                            34.3       0.17 
PYIR_25571                                                            34.3       0.18 
H310_05432                                                            34.3       0.19 
PYAP_19712                                                            33.9       0.23 
PHYRA_78162                                                           33.9       0.24 
PYIW_25642                                                            33.1       0.27 
PYU1_G001518                                                          33.9       0.27 
PITG_11935                                                            33.9       0.27 
PYIR_23689                                                            33.5       0.28 
PYIW_16208                                                            33.5       0.30 
PITG_11957                                                            33.5       0.30 
H310_05433                                                            33.5       0.31 
SPRG_07797                                                            33.5       0.32 
PPTG_17795                                                            32.7       0.33 
PYIW_21963                                                            33.5       0.34 
PYU1_G006673                                                          32.7       0.34 
PYAP_20161                                                            33.1       0.36 
PYIW_21964                                                            33.5       0.37 
PYAP_19707                                                            33.1       0.37 
PHYCA_112615                                                          33.1       0.37 
PYVX_21438                                                            33.1       0.38 
PYIR_26519                                                            33.1       0.39 
PYIR_22134                                                            33.1       0.40 
PHYCA_123316                                                          33.1       0.40 
H257_11264                                                            33.1       0.43 
H257_11265                                                            33.1       0.44 
PYIW_23029                                                            32.3       0.44 
PPTG_03153                                                            33.1       0.45 
PPTG_17796                                                            32.0       0.46 
PYIW_17867                                                            33.1       0.47 
PHYCA_19608                                                           33.1       0.48 
PYIW_24289                                                            32.3       0.59 
PITG_11931                                                            32.7       0.62 
PHYKE_6076                                                            32.7       0.63 
PHYSO_374025                                                          32.7       0.65 
PHYKE_6066                                                            32.7       0.67 
SDRG_16534                                                            32.3       0.72 
PYU1_G001514                                                          32.7       0.73 
PPTG_03139                                                            32.3       0.75 
PHYRA_78174                                                           32.3       0.77 
PHYRA_78168                                                           32.3       0.81 
PPTG_03144                                                            32.3       0.89 
PPTG_10073                                                            32.0       0.91 
PHYRA_78167                                                           32.3       0.93 
H310_05438                                                            32.0       1.0  
PYU1_G005878                                                          30.4       1.0  
PYVX_19277                                                            32.0       1.1  
PYU1_G001517                                                          32.0       1.1  
H257_11258                                                            32.0       1.1  
PHYCA_14563                                                           32.0       1.1  
PYVX_23997                                                            31.6       1.1  
PHYCA_10470                                                           32.0       1.2  
PHYSO_339832                                                          32.0       1.2  
CCI46093                                                              32.0       1.2  
PYAP_18254                                                            32.0       1.2  
PYU1_G001525                                                          32.0       1.3  
PHYRA_78172                                                           32.0       1.3  
SDRG_00972                                                            32.0       1.3  
PHYKE_6077                                                            31.6       1.3  
PYVX_22510                                                            32.0       1.3  
SPRG_07825                                                            31.6       1.4  
PYIR_22137                                                            31.6       1.4  
PYAR_16493                                                            31.6       1.4  
PPTG_13879                                                            31.6       1.5  
PHYRA_78165                                                           31.6       1.6  
PHYRA_86201                                                           31.6       1.7  
PYU1_G007242                                                          31.2       1.7  
PYAP_18710                                                            29.6       1.8  
PHYRA_86241                                                           31.2       1.9  
PPTG_03140                                                            31.2       1.9  
PHYRA_78164                                                           31.2       1.9  
H257_11273                                                            31.2       2.0  
PYU1_G005862                                                          30.8       2.0  
PYIW_24288                                                            30.8       2.1  
PYAP_16351                                                            31.2       2.2  
PPTG_20376                                                            30.8       2.2  
H257_05653                                                            30.4       2.3  
PHYRA_78175                                                           31.2       2.3  
PYAP_18307                                                            30.8       2.3  
PHYKE_7445                                                            31.2       2.3  
PHYCA_19611                                                           31.2       2.4  
PPTG_17798                                                            30.4       2.4  
PYU1_G006404                                                          30.8       2.5  
PPTG_03145                                                            30.8       2.6  
PYAR_21271                                                            30.8       2.6  
PHALS_02037                                                           30.8       3.0  
PHYCA_6388                                                            30.4       3.2  
PYIW_24287                                                            30.4       3.3  
PYVX_24274                                                            30.4       3.3  
PYVX_22508                                                            30.4       3.3  
PYAR_21246                                                            30.8       3.5  
PITG_11937                                                            30.4       3.5  
PYIR_22136                                                            30.4       3.6  
CCI42055                                                              30.8       3.6  
PHYRA_80750                                                           30.4       3.9  
PYAP_23673                                                            30.4       4.0  
PYU1_G006403                                                          30.0       4.1  
PYU1_G001528                                                          30.4       4.1  
PYAR_15391                                                            30.0       4.4  
PYVX_22509                                                            30.0       4.6  
HYAP_11923                                                            30.4       4.6  
PYIR_25275                                                            29.6       4.7  
PYU1_G001527                                                          30.0       4.7  
PYU1_G001523                                                          30.0       4.7  
PYIW_25573                                                            30.0       4.8  
CCI47989                                                              30.0       4.9  
PHYCA_15124                                                           30.0       5.1  
PYU1_G001526                                                          30.0       5.4  
PHYSO_533747                                                          29.6       5.5  
PYU1_G001524                                                          29.6       5.8  
PYVX_21644                                                            29.6       6.2  
H257_11306                                                            29.6       6.3  
HYAP_01683                                                            29.6       6.4  
PYIR_22135                                                            29.6       6.5  
PHYSO_318683                                                          29.6       6.5  
PITG_11944                                                            29.6       6.8  
PYIR_25334                                                            29.3       7.7  
PYIW_24971                                                            27.7       8.4  
PYU1_G006405                                                          29.3       8.9  
PYIR_24867                                                            29.3       8.9  
H257_11271                                                            29.3       9.1  
PHYSO_329176                                                          29.3       9.9  

>PYVX_18175
Length=147

 Score = 275 bits (704),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/147 (100%), Positives = 147/147 (100%), Gaps = 0/147 (0%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAPSLTTVATVAAVATAASVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT
Sbjct  1    MAPSLTTVATVAAVATAASVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60

Query  61   QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
            QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY
Sbjct  61   QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120

Query  121  KNCVPLSTSARMLEAASNESALIIDEN  147
            KNCVPLSTSARMLEAASNESALIIDEN
Sbjct  121  KNCVPLSTSARMLEAASNESALIIDEN  147

>PYVX_18179
Length=147

 Score = 208 bits (530),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 109/122 (89%), Gaps = 5/122 (4%)

Query  24   VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD--  81
            VADAHQYVILP+P+WT+ D DVWYSPLAFLE+QGF TQEDF++WR ANGY TLR+FMD  
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQA  83

Query  82   -SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNES  140
             SGK  DTA+DYSSC GSCTLYW+WMGVRYLKGAYSWQVYKNCVPLSTSARMLE A+N S
Sbjct  84   VSGK--DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSARMLEGAANAS  141

Query  141  AL  142
            A+
Sbjct  142  AI  143

>PHYCA_14368
Length=219

 Score = 163 bits (413),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 97/141 (69%), Gaps = 19/141 (13%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
            ++L   A+AHQ V+LP+P WTT+D+D  Y+PLAFLENQGFKTQ+DF++WR  N YK+LR 
Sbjct  19   ALLDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRD  78

Query  79   FMDSGKYT---------------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNC  123
            FMD+ KYT               D  +DYSSCKG+CTL WYW+G+R+LK  YSWQVYK C
Sbjct  79   FMDNAKYTVTDGADFSCGFTDPKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKAC  138

Query  124  VPLS----TSARMLEAASNES  140
            +PLS    T A    A S E+
Sbjct  139  IPLSGSGGTEAGTTPAGSGET  159

>PYVX_18176
Length=201

 Score = 155 bits (392),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 96/179 (54%), Gaps = 59/179 (33%)

Query  24   VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83
            VADAHQYVILP P+W T D+DV Y+PLAFLE+QGF TQEDF+AWR  NGY +LR+FMD  
Sbjct  21   VADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGA  80

Query  84   KYTDT-------------------------------------------AIDYSSCKGS--  98
             YT T                                            + Y +C  S  
Sbjct  81   SYTVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSIS  140

Query  99   --------------CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALI  143
                          CTLYW+WMGVRYL   YSWQVYKNCVPLS SAR LE A+N SA++
Sbjct  141  GKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAVV  199

>PITG_18450
Length=203

 Score = 152 bits (383),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 108/199 (54%), Gaps = 56/199 (28%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAPS+ +   VAAV ++  +L P A AHQ V+LP P++TT D+D  Y+PL FLE QG++T
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  61   QEDFSAWRRANGYKTLRSF-----------------------------MDSGKYTDTA--  89
             EDF+ WRR NGYKTLR F                             M S  YT     
Sbjct  61   VEDFNGWRRNNGYKTLRDFMEYTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPC  120

Query  90   -------------------------IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCV  124
                                     +DYSSCKG+CTL WYW+GVR+LK AYSWQ+YK C+
Sbjct  121  EVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACI  180

Query  125  PLSTSARMLEAASNESALI  143
            PLS SAR LE A+N+S + 
Sbjct  181  PLSASARRLEVAANKSVVF  199

>PHYKE_8388
Length=205

 Score = 146 bits (369),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 111/207 (54%), Gaps = 62/207 (30%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            M PS  +   VAAV ++A+++ P+A+AHQ V+LP P++TT D+   Y+PLAFLE+QGF T
Sbjct  1    MTPSFASSLLVAAVLSSAALIAPIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFST  60

Query  61   QEDFSAWRRANGYKTLRSFMDSGKYT----------------------------------  86
            QEDF+AWR  NGY +LR+F D   YT                                  
Sbjct  61   QEDFTAWRSDNGYASLRAFNDDASYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTH  120

Query  87   ---------DTAI-DYSSCKGS----------------CTLYWYWMGVRYLKGAYSWQVY  120
                     DT +  Y++C  S                CTLYW+WMGVRYLK  YSWQVY
Sbjct  121  DGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVY  180

Query  121  KNCVPLSTSARMLEAASNESALIIDEN  147
            K CVPLS SAR LE A NES  +I EN
Sbjct  181  KACVPLSASARRLEGAVNES--VIFEN  205

>PYVX_18174
Length=204

 Score = 139 bits (351),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 114/204 (56%), Gaps = 63/204 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ----  56
            MAPS + VA+ AA A   ++L  VADAHQYVILP+P+WTT+DRDVWY+PLAFLE+Q    
Sbjct  1    MAPSFSVVASAAAAAAGVALLATVADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFET  60

Query  57   -----------GFKTQEDF----------------------------SAWRRANGY----  73
                       G+KT   F                             A  R+ GY    
Sbjct  61   VEDFNAWRRSNGYKTLRAFMDQASYTVTDGADQTCGFTEIDGTPQPIPANFRSTGYTHDG  120

Query  74   ------KTLRSFMD-------SGKYTDTAIDYSSCK-GSCTLYWYWMGVRYLKGAYSWQV  119
                   + R + +       SGK  DTAIDYS    G+CTLYWYWMGVRYL  AYSWQV
Sbjct  121  PCEIWLDSTRVYANDNCHEAISGK--DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQV  178

Query  120  YKNCVPLSTSARMLEAASNESALI  143
            YKNCVPLSTSARMLE A+N SA+I
Sbjct  179  YKNCVPLSTSARMLEGAANASAII  202

>PPTG_17121
Length=202

 Score = 139 bits (349),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 97/180 (54%), Gaps = 60/180 (33%)

Query  24   VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83
            +A+AHQ V+L  P++TT D+D  Y+PLAFLE+QGF TQEDF+AWR+ NGY +LR+F D  
Sbjct  21   LANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDGA  80

Query  84   KYT-------------------------------------------DTAI-DYSSCK---  96
             YT                                           DT +  Y +C    
Sbjct  81   SYTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAI  140

Query  97   ---------GSCT----LYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALI  143
                      SCT    LYW+W+GVRYLK  YSWQ+YK CVPLSTSAR LE A+NESA+I
Sbjct  141  SGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSARRLEGAANESAII  200

>PHYSO_477820
Length=202

 Score = 136 bits (343),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 108/203 (53%), Gaps = 63/203 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAPSL +  + AAV + A++L   A AHQ V+LP P++TT D+   Y+PLAFLE+QGF T
Sbjct  1    MAPSLVSSLSAAAVLSGAALL---AGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFAT  57

Query  61   QEDFSAWRRANGYKTLRSFMDSGKYT----------------------------------  86
            QEDF+AWR  NGY +LR+F D   YT                                  
Sbjct  58   QEDFTAWRTDNGYDSLRAFNDGASYTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTH  117

Query  87   ---------DTAI-DYSSCK------------GSCT----LYWYWMGVRYLKGAYSWQVY  120
                     DT +  Y +C              SCT    LYW+W+GVRYLK  YSWQ+Y
Sbjct  118  DGPCEVWLDDTMVMQYDNCHESISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIY  177

Query  121  KNCVPLSTSARMLEAASNESALI  143
            K CVPLSTSAR LE A+NESA +
Sbjct  178  KACVPLSTSARRLEGATNESARL  200

>PHYCA_511409
Length=204

 Score = 135 bits (341),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 95/179 (53%), Gaps = 60/179 (34%)

Query  24   VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83
            +ADAHQ V+LP P++TT D+   Y+PLAFLE+QGF TQEDF+AWR+ NGY +LR+F D  
Sbjct  23   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDGA  82

Query  84   KYT-------------------------------------------DTAI-DYSSCK---  96
             YT                                           DT +  Y +C    
Sbjct  83   SYTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAI  142

Query  97   ---------GSCT----LYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142
                      SCT    LYW+W+GVRYLK  YSWQ+YK CVPLS SAR LE A+NESA+
Sbjct  143  SGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAI  201

>PPTG_10643
Length=250

 Score = 128 bits (321),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 85/179 (47%), Gaps = 60/179 (34%)

Query  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDS  82
            P  DAHQ V+LP+P WTT+D+D  Y+PLAFLENQGFK QEDF+AW + NGYK+LR FMD 
Sbjct  23   PTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR  82

Query  83   GKYTDTAIDYSSC-------------------------KGSCTLY---------------  102
             KY  T     SC                          G C +Y               
Sbjct  83   AKYEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEK  142

Query  103  --------------------WYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
                                WYW+G+R+LK AYSWQVYK C+PL  S  + + A   S 
Sbjct  143  FPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVSQTAPVTSG  201

>PHYSO_246676
Length=187

 Score = 124 bits (310),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 87/152 (57%), Gaps = 29/152 (19%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
            ++  P ADAHQ V+LP+P WTT+D+   Y+PLAFLENQGFKTQEDF+AWR+ NGY+TLR 
Sbjct  2    ALPAPTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRD  61

Query  79   FMDSGKY-----TDTAIDYSSCKGSCT-----------------LYWYWMGVRYLKGAYS  116
            FMD  KY      D +  ++  KG+                   L    + +  +K +YS
Sbjct  62   FMDKAKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASLVLDGMKNSYS  121

Query  117  WQVYKNCVPLSTSA-------RMLEAASNESA  141
            W+VYK C+PLS S        R   A SN SA
Sbjct  122  WKVYKACIPLSGSGGTSQESTRTPNAPSNSSA  153

>PPTG_17122
Length=204

 Score = 124 bits (311),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 106/202 (52%), Gaps = 59/202 (29%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGF--  58
            MAPSL +  +VAAV ++A++L P ++AHQ V+LP P++TT ++D  Y+PLAFLENQG+  
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  59   -------------KTQEDF-----------------------------SAWRRANGYK--  74
                         KT  DF                                 R+ GY   
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHD  120

Query  75   -------TLRSFMDSGKYTDTA------IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYK  121
                     +  + S    +T       +DYSSC G+CTL WYW+GVRYLK AYSWQ+YK
Sbjct  121  GPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYK  180

Query  122  NCVPLSTSARMLEAASNESALI  143
             C+PLS SAR LE+A+NES  +
Sbjct  181  ACIPLSASARRLESAANESVAL  202

>PHYCA_102852
Length=195

 Score = 121 bits (304),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 98/193 (51%), Gaps = 60/193 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            M  SL +  TVA+  ++ ++L P ADAHQ V+LP+P WTT+D+D  Y+PLAFLEN+GF T
Sbjct  1    MISSLVSTLTVASTLSSMALLAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTT  60

Query  61   QEDFSAWRRANGYKTLRSFMDSGKYTDT--------------------------------  88
            QEDF+AWR  NGYK+LR FMD  KY  T                                
Sbjct  61   QEDFTAWRTENGYKSLRDFMDRAKYPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTH  120

Query  89   ------------AIDYSSC------KG------SC--TLYWYW--MGVRYLKGAYSWQVY  120
                         +D  +C      KG      SC  T   YW  +GVR+LK  YSWQVY
Sbjct  121  DGPCEVWLDDTMVLDGENCHEKFPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVY  180

Query  121  KNCVPLSTSARML  133
            K C+PL+   R L
Sbjct  181  KACIPLTAGQRNL  193

>PHYSO_284086
Length=204

 Score = 121 bits (303),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 92/182 (51%), Gaps = 63/182 (35%)

Query  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF---  64
            P ADAHQ V+LP P++TT D+   Y+PLAFLENQ               G+KT   F   
Sbjct  23   PTADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG  82

Query  65   SAWRRANGYKTLRSFMD-------------------------------------------  81
            +++  A+G      F D                                           
Sbjct  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
            SGK  D  +DYSSCKGSCTL WYW+GVR+LK  YSWQVYK CVPLSTSAR LEAA+NESA
Sbjct  143  SGKTYD--LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSARRLEAAANESA  200

Query  142  LI  143
             +
Sbjct  201  AL  202

>PHYKE_8389
Length=204

 Score = 120 bits (302),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 103/205 (50%), Gaps = 65/205 (32%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLEN-----  55
            MAPSL +++  A +++A ++L P ADAHQ V+LP P++TT D+D  Y+PLAFLEN     
Sbjct  1    MAPSLASLSVAAVLSSA-ALLAPTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFET  59

Query  56   ----------QGFKTQEDF------------------------------SAWRRANGY--  73
                       G+KT   F                                  R+ GY  
Sbjct  60   VDDFNAWRRNNGYKTLRAFMDGAKYTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTH  119

Query  74   --------KTLRSFMD-------SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQ  118
                     T R           SGK  D  IDYSSC G+CTL WYW+GVR+LK  YSWQ
Sbjct  120  DGPCEVWLDTTRVLTHDNCHEAISGK--DYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQ  177

Query  119  VYKNCVPLSTSARMLEAASNESALI  143
            VYK CVPLS SAR L+ A+NESA I
Sbjct  178  VYKACVPLSASARRLKGAANESAAI  202

>PHYSO_254168
Length=170

 Score = 117 bits (294),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 74/140 (53%), Gaps = 47/140 (34%)

Query  42   DRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKYTDT-------------  88
            D+D  Y+PLAFLE QGF TQE F A RR NGYKTLR FMD GKYT T             
Sbjct  30   DKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGKYTVTQGADYFCGWTNPK  89

Query  89   --------------------------------AIDYSSC--KGSCTLYWYWMGVRYLKGA  114
                                             IDYSSC  KG CT++WYW+GVR+LK +
Sbjct  90   GTPQPIPRSTGYTHDGPCEIWLDDVRVLERSPTIDYSSCEKKGGCTMHWYWLGVRFLKNS  149

Query  115  YSWQVYKNCVPLSTSARMLE  134
            YSWQVYK C+PL+ + + L 
Sbjct  150  YSWQVYKECIPLTAAPKRLR  169

>PYU1_G001741
Length=199

 Score = 118 bits (296),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 102/197 (52%), Gaps = 61/197 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAPS+T      A+ ++A++    ADAHQYV+LP P++T   R   ++PLAFLENQGF+T
Sbjct  1    MAPSITKSLVFGALVSSATLYN-TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFET  59

Query  61   QEDFSA-------------------------------WRRANGYK------TLRS-----  78
              DF+A                               W + +G +      T+RS     
Sbjct  60   TADFNAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTH  119

Query  79   ------FMDSGKY------------TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                  ++DS +             T   IDYSSCKGSCTL WYWMG+R+LKG YSWQVY
Sbjct  120  DGPCEVWLDSTRVMKGNNCHTEFTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVY  179

Query  121  KNCVPLSTSARMLEAAS  137
            KNCVP+ +S R+ +  S
Sbjct  180  KNCVPIGSSRRLGDGNS  196

>PPTG_10048
Length=190

 Score = 117 bits (293),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 83/168 (49%), Gaps = 60/168 (36%)

Query  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDS  82
            P+ +AHQ V+ P P W T +RD  ++PLAFLE+QGFKTQEDF +WR  NGYKTLR FM+ 
Sbjct  20   PLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH  79

Query  83   GKYTDTAIDYSSC-------------------------KGSCTLY---------------  102
             KYT T     SC                         +G C ++               
Sbjct  80   AKYTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVS  139

Query  103  --------------------WYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
                                WYW+GVR+LK +YSWQVYK C+PL+T++
Sbjct  140  LPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PHYKE_3446
Length=199

 Score = 117 bits (292),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 96/190 (51%), Gaps = 60/190 (32%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAP L +V TV A  + A+V+ P+ DAHQ V+LP+P W T  +++ Y+PLAFLENQGF T
Sbjct  1    MAPPLASVFTVVAALSGAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFAT  60

Query  61   QED------------------------------FSAWRRANGYK-------TLRS-----  78
            QED                              F  W   NG          +RS     
Sbjct  61   QEDANAWRRDNGYKTLRAFMDMAKYQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTH  120

Query  79   ------------FMDSGKYTDT------AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                         ++SG   +T       IDYS+C+G+C L WYW+GVR+LK +YSWQVY
Sbjct  121  DGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVY  180

Query  121  KNCVPLSTSA  130
            K C+PL++ +
Sbjct  181  KACIPLTSGS  190

>PHYCA_129425
Length=204

 Score = 114 bits (285),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 104/202 (51%), Gaps = 59/202 (29%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ----  56
            MAPSL +  TVAA  ++A++L P ADAHQ V+LP P++TT ++D  Y+PLAFLE+Q    
Sbjct  1    MAPSLLSSLTVAAALSSAALLAPTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT  60

Query  57   -----------GFKTQEDF-----------------------------SAWRRANGYK--  74
                       G+KT   F                                 R+ GY   
Sbjct  61   VEDFNGWRRSNGYKTLRAFMDGAKYTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHD  120

Query  75   -TLRSFMDSGKYTDT------------AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYK  121
                 ++DS +   +             +DYSSCKGSC L WYW+G R+LK  +SWQVYK
Sbjct  121  GPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYK  180

Query  122  NCVPLSTSARMLEAASNESALI  143
             C+PLS+SAR LE A+NESA I
Sbjct  181  ACIPLSSSARRLEGAANESAAI  202

>PHYRA_82864
Length=193

 Score = 114 bits (284),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 82/173 (47%), Gaps = 59/173 (34%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQED---------------  63
            ++L P ADAHQ V+LP+P WTT ++D  Y+PLAFLE QGF TQ D               
Sbjct  19   ALLAPTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRD  78

Query  64   ---------------FSAWRRANG--YKTLRSFMDSGKYT--------------------  86
                           F  W   NG         M S  YT                    
Sbjct  79   FMDRAKYTVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNC  138

Query  87   -------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARM  132
                   D  IDYSSCKG+CTL+WYW+GVR+LK +YSWQVYK C+ L++  R+
Sbjct  139  HEQFPDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQRL  191

>PHYRA_81106
Length=202

 Score = 114 bits (284),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 89/181 (49%), Gaps = 63/181 (35%)

Query  23   PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF---  64
            P+ DAHQ V+LP P++TT  +D  Y+PLAFLENQ               G+KT   F   
Sbjct  23   PMTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG  82

Query  65   SAWRRANGYKTLRSF---------------MDSGKYT-----------------------  86
            + +  A+G      F               M S  YT                       
Sbjct  83   AKYTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  87   ----DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142
                D  IDYSSC G+CTL+WYWMGVRYLK AYSWQVYK CVPLS SAR L   +NESA+
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARRL---TNESAV  199

Query  143  I  143
            I
Sbjct  200  I  200

>PYU1_G001742
Length=213

 Score = 114 bits (284),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/205 (40%), Positives = 105/205 (51%), Gaps = 64/205 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
            MAPS+ T + V A A +++ L   ADAHQYV+LP P++T   R   ++PLAFLENQG+KT
Sbjct  1    MAPSIVTKSLVLAAAVSSAALFESADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKT  60

Query  61   QEDFSA-------------------------------WRRANGYK------TLRS-----  78
              DF+A                               W + +G +      T+RS     
Sbjct  61   TVDFNAYYKAKGYKTLRAFMDDPKAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTH  120

Query  79   ------FMDSGKY------------TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                  ++DS +             T   IDYSSCKGSCTL WYWMG+R+LKG YSWQVY
Sbjct  121  DGPCEVWLDSTRVMKGNNCHSEFPGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVY  180

Query  121  KNCVPLSTSARMLE---AASNESAL  142
            KNCVP+    R+LE   A  N + L
Sbjct  181  KNCVPIG-GKRLLEEQFAEGNSTEL  204

>PHYRA_78625
Length=434

 Score = 117 bits (293),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 20/131 (15%)

Query  25   ADAHQYVILPQPSWTTSDRDV-----WYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSF  79
            A+AHQ V +P P+WT S+         ++PL+FLE +GF+TQE+F+ ++  NGY +LR F
Sbjct  238  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  297

Query  80   MDSGKY-------------TDTA--IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCV  124
            +D  KY             TD    +DYS C  SC LYWYW+G RYLKG+YSWQVYK C+
Sbjct  298  LDKAKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  357

Query  125  PLSTSARMLEA  135
             L + +   EA
Sbjct  358  LLYSGSGAPEA  368

>PHYSO_499978
Length=174

 Score = 111 bits (278),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 0/95 (0%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
           MAPSL +   VA V ++A++L P ADAHQ V+ P+P WTT+D++  Y+PLAFLENQGF T
Sbjct  1   MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61  QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSC  95
           Q+DF  WR  NGYKTLR FMD GKYT T     SC
Sbjct  61  QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSC  95

>PHYSO_501575
Length=174

 Score = 111 bits (278),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 69/95 (73%), Gaps = 0/95 (0%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
           MAPSL +   VA V ++A++L P ADAHQ V+ P+P WTT+D++  Y+PLAFLENQGF T
Sbjct  1   MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61  QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSC  95
           Q+DF  WR  NGYKTLR FMD GKYT T     SC
Sbjct  61  QQDFREWRTKNGYKTLRDFMDHGKYTVTKGADFSC  95

>PHYRA_78626
Length=473

 Score = 117 bits (293),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 81/131 (62%), Gaps = 20/131 (15%)

Query  25   ADAHQYVILPQPSWTTSDRDV-----WYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSF  79
            A+AHQ V +P P+WT S+         ++PL+FLE +GF+TQE+F+ ++  NGY +LR F
Sbjct  277  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  336

Query  80   MDSGKY-------------TDTA--IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCV  124
            +D  KY             TD    +DYS C  SC LYWYW+G RYLKG+YSWQVYK C+
Sbjct  337  LDKAKYKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  396

Query  125  PLSTSARMLEA  135
             L + +   EA
Sbjct  397  LLYSGSGAPEA  407

>PHYCA_14369
Length=248

 Score = 112 bits (281),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 91/190 (48%), Gaps = 60/190 (32%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ----  56
            M  SL +   V +  ++ + L P ADAHQ V+LP+P WTT+D+D  Y+PLAFLENQ    
Sbjct  1    MVSSLVSTLAVVSTLSSIAFLAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  57   -----------GFKTQEDF---SAWRRANGYKTLRSFMD---------------SGKYT-  86
                       G+K+  DF   + +   NG      F D               S  YT 
Sbjct  61   QQDFTAWRNENGYKSLRDFMDRAKYTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTH  120

Query  87   --------------------------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                                      D  +DYSSCKG+CTL WYW+GVR+LK AYSWQVY
Sbjct  121  DGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVY  180

Query  121  KNCVPLSTSA  130
            K C+PL+ S 
Sbjct  181  KACIPLAGSG  190

>PPTG_10634
Length=208

 Score = 111 bits (277),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 85/168 (51%), Gaps = 60/168 (36%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
            ++L    DAHQ V+LP+P WTT+D++  Y+PLAFLEN+GF TQEDF+AWR+ NGYK+LR 
Sbjct  19   ALLALTVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  78

Query  79   FMDSGKY--TDTA------------------------------------------IDYSS  94
            F+D+ KY  TD A                                          +D  +
Sbjct  79   FLDNAKYPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDN  138

Query  95   CK------------GSC--TLYWYW--MGVRYLKGAYSWQVYKNCVPL  126
            C              SC  T   YW  +GVR+LK  YSWQVYK C+PL
Sbjct  139  CHEKFPGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PHYRA_81107
Length=202

 Score = 111 bits (277),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 100/203 (49%), Gaps = 63/203 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFL-------  53
            MAPS  +  +   V ++A++L   ADAHQ V+LP P++TT D+   Y+PLAFL       
Sbjct  1    MAPSFVSSLSAGIVLSSAALL---ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFST  57

Query  54   --------ENQGF---KTQEDFSAWRRANGYKTLRSFMD---------------SGKYT-  86
                    E  G+   +  +D +++  ++G      F D               S  YT 
Sbjct  58   QEDFTAWREENGYDSLRAFDDGASYTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTH  117

Query  87   --------------------------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                                      D  IDYSSC  +CTLYW+WMGVRYL  AYSWQVY
Sbjct  118  DGPCEVWLDDTMVMQYDNCHEVISGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVY  177

Query  121  KNCVPLSTSARMLEAASNESALI  143
            K CVPLS SAR LE A+NESA++
Sbjct  178  KACVPLSASARRLEGAANESAIL  200

>PHYRA_85631
Length=228

 Score = 111 bits (278),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 89/189 (47%), Gaps = 66/189 (35%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGF---------------KTQED  63
            ++L P ADAHQ V+LP+P WTT D+D  Y+PLAFLEN+GF               K+  D
Sbjct  19   ALLAPTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRD  78

Query  64   F---SAWRRANGYKTLRSFMD---------------SGKYT-------------------  86
            F   + +  A+G      F D               S  YT                   
Sbjct  79   FMDNAKYNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDN  138

Query  87   --------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL------STSARM  132
                    D  +DYSSCKG+CTL WYW+G+R+LK  YSWQVYK C+PL      S SA  
Sbjct  139  CHEKFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPA  198

Query  133  LEAASNESA  141
             EA S E +
Sbjct  199  TEAPSTEGS  207

>PHYRA_84190
Length=206

 Score = 110 bits (276),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 85/178 (48%), Gaps = 60/178 (34%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQG---------------FKTQED  63
            ++L P ADAHQ V+LP+P WTT D+D  Y+PLAFLEN+G               +K+  D
Sbjct  2    ALLAPTADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRD  61

Query  64   F---SAWRRANGYKTLRSFMD---------------SGKYT-------------------  86
            F   + +   NG      F D               S  YT                   
Sbjct  62   FMDNAKYSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGEN  121

Query  87   --------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAA  136
                    D  +DYSSCKG+CTL WYWMGVR+LK  YSWQVYK C+PL+  +   E+A
Sbjct  122  CHEKFPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESA  179

>PITG_13520
Length=171

 Score = 109 bits (273),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 67/95 (71%), Gaps = 0/95 (0%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
           M  SL +   VA+  ++ ++L P ADAHQ V+LP+P WTT D+D  Y+PLAFLENQGFKT
Sbjct  1   MVSSLVSTLAVASTLSSIALLAPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKT  60

Query  61  QEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSC  95
           Q+DF AWR  NGYK+LR FMD  KY  T+    SC
Sbjct  61  QQDFKAWRDENGYKSLRDFMDRAKYDVTSGADFSC  95

>PHYSO_341599
Length=185

 Score = 110 bits (274),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 0/77 (0%)

Query  19  SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
           ++L P ADAHQ V+LP+P WTT+D++  Y+PLAFLENQGFKTQEDF+AWR+ NGYK+LR 
Sbjct  2   AMLAPTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRD  61

Query  79  FMDSGKYTDTAIDYSSC  95
           FMD  KY  T+    SC
Sbjct  62  FMDRAKYDVTSGADFSC  78

>PPTG_10635
Length=199

 Score = 109 bits (272),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 85/172 (49%), Gaps = 60/172 (35%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQED  63
            ++L P+ADAHQ V+LP+P WTT+D+D  Y+PLAFLENQ               G+K+  D
Sbjct  2    ALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRD  61

Query  64   F---SAWRRANGYKTLRSFMD---------------SGKYT-------------------  86
            F   + +   +G      F D               S  YT                   
Sbjct  62   FMDRAKYEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDN  121

Query  87   --------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
                    D  +DYSSCKGSCTL WYW+GVR+LK +YSWQVYK C+PL+  A
Sbjct  122  CHEKFPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGA  173

>PHYKE_8104
Length=86

 Score = 105 bits (262),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 0/67 (0%)

Query  19  SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
           ++L P ADAHQ V+LP+P+WTT+D+D  Y+PLAFLE +GF  QEDF AWR  NGYK+LR 
Sbjct  19  ALLAPTADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRD  78

Query  79  FMDSGKY  85
           FMD+ KY
Sbjct  79  FMDNAKY  85

>PHYKE_7718
Length=220

 Score = 108 bits (270),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 88/183 (48%), Gaps = 60/183 (33%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQG---------------FKTQED  63
            ++L P+ADAHQ V+LP+P+WTT D+D  Y+PLAFLE +G               +K+  D
Sbjct  23   ALLAPIADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRD  82

Query  64   F---SAWRRANGYKTLRSFMD---------------SGKYT-------------------  86
            F   + +   +G  +   F D               S  YT                   
Sbjct  83   FMDNAKYSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDN  142

Query  87   --------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASN  138
                    D  IDYS+CKG+CTL WYW+GVR+LK +YSWQVYK C+PL+ S      AS 
Sbjct  143  CHEAFPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSGGGAPVASG  202

Query  139  ESA  141
              A
Sbjct  203  SLA  205

>PYIR_25089
Length=262

 Score = 108 bits (271),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 85/170 (50%), Gaps = 62/170 (36%)

Query  26   DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT-------------------QEDFSA  66
            DAHQYVILP P++T   R   ++PLAFLENQGFKT                    +D SA
Sbjct  26   DAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSA  85

Query  67   WRRANGY-------------------KTLRS-----------FMDSGKY-----------  85
            ++ A+G                     T+RS           ++D  +            
Sbjct  86   YKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFP  145

Query  86   -TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  134
             T   IDYSSCKGSC L WYWMG+R+LKG YSWQVYKNCVP+ T +R L+
Sbjct  146  GTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV-TGSRSLD  194

>PPTG_10636
Length=246

 Score = 107 bits (266),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 48/77 (62%), Positives = 60/77 (78%), Gaps = 0/77 (0%)

Query  19  SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
           ++L P+ADAHQ V+LP+P WTT+D+D  Y+PLAFLENQGFKTQEDF +WR  N YK+LR 
Sbjct  19  ALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRD  78

Query  79  FMDSGKYTDTAIDYSSC  95
           FMD+ KY  T+    SC
Sbjct  79  FMDNAKYEVTSGADFSC  95

 Score = 75.9 bits (185),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)

Query  87   DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAAS  137
            D  +DYSSCKG+CTL WYW+G+R+LK  YSWQVYK C+PLS S       S
Sbjct  147  DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGEATPTTS  197

>PITG_19818
Length=147

 Score = 102 bits (253),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 59/97 (61%), Gaps = 8/97 (8%)

Query  20   VLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSF  79
             + P ADAHQ V+LP+P WTT D+D  Y+PLAFLENQGFK Q+DF AWR  NGYK+LR F
Sbjct  18   AVRPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDF  77

Query  80   MDSGKY------TDTAIDYSSCKGSC--TLYWYWMGV  108
            MD           D  +  ++ +  C  T  W WM  
Sbjct  78   MDRANLFRRVTPCDRLVTRTTDRARCGSTTRWCWMAT  114

>PPTG_14254
Length=188

 Score = 101 bits (251),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 67/174 (39%)

Query  19   SVLGPVADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFSAWRRANG  72
            S+L    +AHQ V +P P+WT ++      R++W +PL+FLE +GFKTQE+F+ ++  NG
Sbjct  14   SMLLHATEAHQVVNVPAPTWTRANSTSKERRELW-NPLSFLEKEGFKTQENFTQFQVDNG  72

Query  73   YKTLRSFMDSGKYTDT--------------------------------------------  88
            YK+LR FMD  KY  T                                            
Sbjct  73   YKSLRDFMDRAKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKL  132

Query  89   AIDYSSCKGS----------------CTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            A+ Y +C  S                C LYWYW+GVR LKG YSWQVYK C+P+
Sbjct  133  ALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PPTG_15264
Length=194

 Score = 100 bits (250),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)

Query  26  DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY  85
           DAHQ V+ P+P WTT ++D+ Y+PLAFLE QGF+TQEDF+AWRR NGYKTLR FMD  KY
Sbjct  23  DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  82

Query  86  TDT  88
           T T
Sbjct  83  TVT  85

>PPTG_17366
Length=194

 Score = 100 bits (250),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)

Query  26  DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY  85
           DAHQ V+ P+P WTT ++D+ Y+PLAFLE QGF+TQEDF+AWRR NGYKTLR FMD  KY
Sbjct  23  DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAKY  82

Query  86  TDT  88
           T T
Sbjct  83  TVT  85

>PHALS_00498
Length=199

 Score = 100 bits (250),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 77/172 (45%), Gaps = 60/172 (35%)

Query  20   VLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQG---------------FKTQEDF  64
            +L P   AHQ V+LP+P W T+D+D  Y+PLAFLENQ                FKT  DF
Sbjct  20   LLAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDF  79

Query  65   ---SAWRRANGYKTLRSFMD---------------SGKYT--------------------  86
               + +    G      F D               S  YT                    
Sbjct  80   MDNAKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  87   -------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
                   D  IDYSSCK +C L WYW+GVR+LK  YSWQVYK C+PLS SA+
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSAK  191

>PHYCA_102550
Length=268

 Score = 101 bits (252),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
           M  SL +  TVA+  ++ ++L P A AHQ V+LP P W T +RD  + PLAFLE+QGFKT
Sbjct  1   MVSSLVSTLTVASTLSSMALLAPTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKT  60

Query  61  QEDFSAWRRANGYKTLRSFMDSGKYT  86
           Q+DF+AWR  NGYK+LR FMD  KYT
Sbjct  61  QQDFTAWRNENGYKSLRDFMDRAKYT  86

>PHYCA_102624
Length=195

 Score = 99.8 bits (247),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 86/194 (44%), Gaps = 60/194 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLE------  54
            M  SL +   VA+  ++ ++L P A AHQ V+LP+P W T +RD  + PL FLE      
Sbjct  1    MVSSLVSTLVVASTLSSMALLAPTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKT  60

Query  55   ---------NQGFKTQEDF---SAWRRANGYKTLRSFMD---------------SGKYT-  86
                       G+K+  DF   + +  + G      F D               S  YT 
Sbjct  61   QADFTAWRKENGYKSLRDFMDNAKYPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTH  120

Query  87   --------------------------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
                                      D  IDYS CKG CTLYWYW+GVR+LK  YSWQVY
Sbjct  121  DGPCEVWIDDTMVMEGDNCHEKFPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVY  180

Query  121  KNCVPLSTSARMLE  134
            K C+PL++  R L 
Sbjct  181  KECIPLTSEQRSLR  194

>PYU1_G001744
Length=213

 Score = 99.0 bits (245),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 94/194 (48%), Gaps = 61/194 (31%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ----  56
            MAPS+ T + V A A +++ L   ADAHQYV+LP P++T   R   ++PLAFLENQ    
Sbjct  1    MAPSIVTKSLVLAAAVSSAALFESADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKT  60

Query  57   -----------GFKTQEDF----------------SAWRRANGYK------TLRS--FMD  81
                       G+K+   F                  W + +G +      T+RS  +  
Sbjct  61   TADFNAYYKAKGYKSLRAFMDDKKAYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTH  120

Query  82   SGKY---------------------TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
             G                       T   I Y+SCKGSCTL WYWMG+R+LKG YSWQVY
Sbjct  121  DGPCEVWLDNTLVMKGNNCHSEFPGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVY  180

Query  121  KNCVPLSTSARMLE  134
            KNCVP+    R+LE
Sbjct  181  KNCVPIG-GKRLLE  193

>PHYSO_417649
Length=185

 Score = 98.2 bits (243),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 79/168 (47%), Gaps = 67/168 (40%)

Query  25   ADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
             +AHQ V +P P+WT ++      R++W +PL+FLE +GFKTQE+F+ ++  NGYK+LR 
Sbjct  18   VEAHQVVYVPSPTWTRANSTASERRELW-NPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  76

Query  79   FMDSGKYTDT--------------------------------------------AIDYSS  94
            FM+  KY  T                                            A+ Y +
Sbjct  77   FMERAKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  136

Query  95   CKGS----------------CTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            C  S                C LYWYW+GVR LKG +SWQVYK C+PL
Sbjct  137  CHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PYIR_26626
Length=212

 Score = 97.4 bits (241),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/193 (35%), Positives = 97/193 (50%), Gaps = 61/193 (32%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQG---  57
            MAPS+     +AA+ ++A++     DAHQ VILP P++T  D++V+++PLAFLENQG   
Sbjct  1    MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60

Query  58   ------------FKTQEDFSAWRRA-----------------NGYK------TLRS----  78
                        +KT   F   ++A                 NG +      T+RS    
Sbjct  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120

Query  79   -------FMDSGKYTDT------------AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQV  119
                   ++D+ K                +I Y+SCKGSCTL WYWMG+R+LK  +SWQV
Sbjct  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180

Query  120  YKNCVPLSTSARM  132
            YK CVP+ +  R+
Sbjct  181  YKECVPIGSGRRL  193

>PHYSO_536424
Length=197

 Score = 95.5 bits (236),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)

Query  23  PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDS  82
           P    HQ V+LP+P WTT+D++  Y+PLAFLEN+GF TQEDF+AWR+ NGYK+LR FMD 
Sbjct  18  PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83  GKYTDTAIDYSSC  95
            KY  T+    SC
Sbjct  78  AKYDVTSGADFSC  90

>PHYSO_507031
Length=197

 Score = 95.5 bits (236),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)

Query  23  PVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDS  82
           P    HQ V+LP+P WTT+D++  Y+PLAFLEN+GF TQEDF+AWR+ NGYK+LR FMD 
Sbjct  18  PDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR  77

Query  83  GKYTDTAIDYSSC  95
            KY  T+    SC
Sbjct  78  AKYDVTSGADFSC  90

>PHALS_03284
Length=188

 Score = 95.1 bits (235),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 81/173 (47%), Gaps = 60/173 (35%)

Query  19   SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------GFKTQEDFSAWR-  68
            ++L P   AHQ ++LP+P W T+D+D  Y+PLAFLENQ         G+  + ++++ R 
Sbjct  5    ALLAPNVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRD  64

Query  69   ---RANGYKTLRSFMDSG-----------------KYT----------------------  86
               RAN   T  +  D G                 ++T                      
Sbjct  65   FLKRANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSN  124

Query  87   --------DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
                    D  +DYSSCK +C +YWYW+ VR LK  YSWQVYK C+PL+ S +
Sbjct  125  CHNDFPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSGK  177

>PHYSO_340369
Length=200

 Score = 92.4 bits (228),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 75/160 (47%), Gaps = 54/160 (34%)

Query  20   VLGP-VADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFSAWRRANG  72
            VL P +  A+Q V +P P+WT ++      R +W  PLA+ E+QGF T  +F+ W+  NG
Sbjct  16   VLHPAITRANQVVHIPAPTWTAANSTTDEQRKLWM-PLAYQEDQGFNTSSNFTQWQLTNG  74

Query  73   YKTLRSFMDSGKYTDTA-------------------------------------------  89
            +KTLR FMD+G Y+ T+                                           
Sbjct  75   FKTLRDFMDNGNYSVTSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNM  134

Query  90   ---IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
               +DYS C  SC +YWY +GV      YSW+VYK C+PL
Sbjct  135  TYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PHYKE_9185
Length=281

 Score = 93.2 bits (230),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 82/181 (45%), Gaps = 74/181 (41%)

Query  19   SVLGPVA-------DAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFS  65
            +VLG  A       +AHQ V +P P+WT  +      R++W +PL+FLE +G KTQE+F+
Sbjct  9    AVLGSAALLQYSTTEAHQVVYIPSPTWTRPNSTSKERRELW-NPLSFLEKEGIKTQENFT  67

Query  66   AWRRANGYKTLRSFMDSGKY------------TDT-------------------------  88
             ++  N Y +LR FMD  KY            TD                          
Sbjct  68   QYQVDNNYASLRDFMDKAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCE  127

Query  89   -------AIDYSSCKGSCT----------------LYWYWMGVRYLKGAYSWQVYKNCVP  125
                   A+ Y +C  S T                LYWYW+GVR LKG+YSWQ+YK C+P
Sbjct  128  IYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIP  187

Query  126  L  126
            L
Sbjct  188  L  188

>PHYSO_341596
Length=231

 Score = 91.7 bits (226),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 54/77 (70%), Gaps = 8/77 (10%)

Query  19  SVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
           ++L P ADAHQ V+L        D+D  Y+PLAFLENQGF+TQEDF++WR  NGYK+LR 
Sbjct  19  AMLAPTADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRD  70

Query  79  FMDSGKYTDTAIDYSSC  95
           FMD  KYT T+    SC
Sbjct  71  FMDKAKYTVTSGADFSC  87

>PHYSO_262732
Length=188

 Score = 87.8 bits (216),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 76/154 (49%), Gaps = 53/154 (34%)

Query  25   ADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQ-EDF-------------  64
            A+AHQ V +P P+WT ++      R++W +PLAFLENQGF+T   DF             
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELW-NPLAFLENQGFQTHLRDFMDNAKYTVTEGAD  77

Query  65   --SAWR---------------RANGY------------KTLRSFMDSGK-YTDTA--IDY  92
                W                R +GY            K   S+++  +  TD    +DY
Sbjct  78   QACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDY  137

Query  93   SSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S C  SCTLYWYW+GVR+L   YSWQVYK C+P+
Sbjct  138  SGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PYU1_G001740
Length=206

 Score = 87.0 bits (214),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 89/185 (48%), Gaps = 59/185 (32%)

Query  1    MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFL-------  53
            MAPS      +AA+ +AA++   VADAHQ VILP P++T   +D  +SPLAFL       
Sbjct  1    MAPSAIKSVALAAIVSAAALCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60

Query  54   --------ENQGFKT----QEDFSAWR-------------------------RANGY---  73
                    +++G+K+     +D  A++                         R  GY   
Sbjct  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120

Query  74   -------KTLRSFMDSGKYTD-----TAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYK  121
                      +    S  + D      A+ Y++CKGSCTL WYWMG+R+LKG +SWQVYK
Sbjct  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYK  180

Query  122  NCVPL  126
             CVPL
Sbjct  181  ECVPL  185

>PHYSO_343376
Length=172

 Score = 83.6 bits (205),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 44/58 (76%), Gaps = 0/58 (0%)

Query  38  WTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSC  95
           WTT+D++  Y+PLAFLENQGF TQ+DF AWR  NGYKTLR FMD GKYT T     SC
Sbjct  36  WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGKYTVTKGADFSC  93

>PYIW_18791
Length=194

 Score = 80.5 bits (197),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 72/164 (44%), Gaps = 61/164 (37%)

Query  25   ADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------GFKTQEDFSAWR-------  68
            ADAHQ V +P+P+WT + +  +++PL+FLE           GF   + +S  R       
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  69   ----RANGYKTLRSFMDSGK---------------YTD----------------------  87
                 +N    L  + D  K               YT                       
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  88   ----TAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
                T +DYS+CKG CT+ WYW+G+RYLK  +SWQVYKNC+ L+
Sbjct  139  VSNTTKVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHYCA_510817
Length=188

 Score = 80.1 bits (196),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 77/177 (44%), Gaps = 73/177 (41%)

Query  19   SVLGPVADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFSAWRRANG  72
            S+L    +AHQ V +P P+WT  +      R++W +PL+FLE +GFKTQE+F+ ++  NG
Sbjct  14   SMLLQSTEAHQVVYVPSPTWTRPNSTSKERRELW-NPLSFLEKEGFKTQENFTQYQVDNG  72

Query  73   YKTLRSFMDSGKY-----TDTAIDYSSCK--------------------GSCTLYWYWMG  107
            YK+LR FM+  KY      D A  +S  K                    G C +   WMG
Sbjct  73   YKSLRDFMEKAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEI---WMG  129

Query  108  --------------------------------------VRYLKGAYSWQVYKNCVPL  126
                                                  VR LKG YSWQVYK C+PL
Sbjct  130  DKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PYIW_18792
Length=125

 Score = 77.4 bits (189),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 55/84 (65%), Gaps = 4/84 (5%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKT  60
           MAPS+T    +A   ++A+++    DAHQYV LP P+WT   R   ++PLAFLE QG+K 
Sbjct  1   MAPSITKSLVLAVAVSSAALV----DAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKC  56

Query  61  QEDFSAWRRANGYKTLRSFMDSGK  84
             DF+A+ ++ GYK LR FMD  K
Sbjct  57  TADFTAYYKSKGYKNLRGFMDDKK  80

>PPTG_08820
Length=250

 Score = 79.0 bits (193),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 2/88 (2%)

Query  1   MAPSLttvatvaavataaSVLGPVADAHQYVILPQPSWT--TSDRDVWYSPLAFLENQGF  58
           MA +L +  TV      +++L    DAHQ ++ P+P W    +DRD  + PLAFLE+QGF
Sbjct  1   MAHALVSTLTVVVALFGSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGF  60

Query  59  KTQEDFSAWRRANGYKTLRSFMDSGKYT  86
             Q DF+ WR  +GYK LR FMD  KYT
Sbjct  61  PCQADFNGWRAQSGYKNLRDFMDRAKYT  88

>PHYKE_7717
Length=568

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 30/41 (73%), Positives = 36/41 (88%), Gaps = 0/41 (0%)

Query  87   DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            D  IDYS+CKG+CTL WYW+GVR+LK AYSWQVYK C+PL+
Sbjct  6    DYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PYIW_18790
Length=86

 Score = 75.1 bits (183),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)

Query  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDS  82
           +YV+LP+P+WT   R   ++PLAFLENQGFKT  DF A+ R  GYKTLR FMD 
Sbjct  3   RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDD  56

>PYVX_18173
Length=500

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 71/167 (43%), Gaps = 64/167 (38%)

Query  23   PVADAHQYVILPQPSWTTSDRDVWYSPLA---------------FLENQGFKTQEDF---  64
            P A AHQ VILP P++T   +D  + PLA               +L+  GF +   F   
Sbjct  230  PQAMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  289

Query  65   ---------------------------SAWRRANGYK---TLRSFMD-------------  81
                                           R+ GY        ++D             
Sbjct  290  DSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEV  349

Query  82   -SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
             SGK  D  +DYS+C GSCTLYWYW+GVRYLK  YSWQVYK CVP+S
Sbjct  350  ISGKTYD--LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 67.4 bits (163),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 60/163 (37%), Gaps = 61/163 (37%)

Query  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLR-----------  77
            Q V+ P P +     D   SP+A+LE QG  T  +   W    GY TLR           
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  78   ------------------------SFMDSGKYTDT-------------------------  88
                                    SF+ SG   D                          
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  89   -AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
              IDYS C  SC + W+W+G++Y    YSWQV+KNC+ LS SA
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200

>PYAP_22278
Length=289

 Score = 77.8 bits (190),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 80/183 (44%), Gaps = 70/183 (38%)

Query  26   DAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF------  64
            DAHQ V +P P++T +DR+V ++PLAFLENQ               G KT  D+      
Sbjct  23   DAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKAN  82

Query  65   --------------------------SAWRRANGY-------------KTLRSFM-----  80
                                      +   R+ GY             + L S+      
Sbjct  83   YKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHR  142

Query  81   DSG-KYTDTAIDYSSCKGSCTLYWYWMGVRYLKG-AYSWQVYKNCVPL---STSARMLEA  135
            D G K     ID+S CKG+C L WYW+G R + G  +SWQ+YK CVPL    T+AR ++A
Sbjct  143  DVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGTAARSIDA  202

Query  136  ASN  138
              +
Sbjct  203  EDD  205

>PHYSO_527908
Length=174

 Score = 75.9 bits (185),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 67/155 (43%), Gaps = 67/155 (43%)

Query  25   ADAHQYVILPQPSWTTSD------RDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRS  78
             DAHQ V +P P+WT ++      +++W  PLAFLE QGF TQ +F+ +   NGYK+LR 
Sbjct  19   VDAHQVVHVPTPTWTRANSTSAECQELW-KPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  77

Query  79   FMDSGKYTDT--------------------------------------------AIDYSS  94
            FMD+G Y+ T                                            ++ Y +
Sbjct  78   FMDNGNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPN  137

Query  95   CKGS----------------CTLYWYWMGVRYLKG  113
            C  S                C LYWYW+GVR++KG
Sbjct  138  CHESITSQPFKLDYSACGDSCVLYWYWLGVRFIKG  172

>PHYCA_536934
Length=983

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 73/166 (44%), Gaps = 65/166 (39%)

Query  26   DAHQYVILPQPSWT-----TSDRDVWYSPLAFLENQG---------------FKTQEDF-  64
            +AHQ V +P P+WT     +++R V ++PL+FLE +G               +K   DF 
Sbjct  37   EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  96

Query  65   --------------SAWRRANGYK-------TLR--------------------SFMDSG  83
                            W   NG         T+R                    S+++  
Sbjct  97   DNAKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  156

Query  84   K-YTDTA--IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +  TD    +DYS C  SC LYWYW+GVRYLK  YSWQVYK C+PL
Sbjct  157  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PPTG_14255
Length=268

 Score = 75.5 bits (184),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 73/165 (44%), Gaps = 65/165 (39%)

Query  27   AHQYVILPQPSWT-----TSDRDVWYSPLAFLENQ---------------GFKTQEDF--  64
            AHQ V +P P+WT     +++R V ++PL+FLE +               G+K+  DF  
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  65   -------------SAWRRANGYK-------TLR--------------------SFMDSGK  84
                           W    G         T+R                    S+++  +
Sbjct  81   NAKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  140

Query  85   -YTDTA--IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
              TD    +DYS+C  SC LYWYW+GVRYLK  YSWQVYK C+PL
Sbjct  141  SITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PYIR_26546
Length=239

 Score = 74.3 bits (181),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 70/171 (41%), Gaps = 64/171 (37%)

Query  20   VLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFLENQ----------------GFKTQED  63
            +L   A AHQ V+LP+P+WT   +   + P+A+LE Q                GFKT  +
Sbjct  20   LLDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMRE  79

Query  64   F----SAWR---------------------------RANGY----------KTLRSFMDS  82
            F      +R                           R  GY            ++ F   
Sbjct  80   FMDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGK  139

Query  83   GKYTDTA-------IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
              + D A       +D+SSC G CT+YWYWMG+R    + SWQ+YK C+PL
Sbjct  140  NCHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_353401
Length=146

 Score = 72.4 bits (176),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 37/41 (90%), Gaps = 0/41 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            IDYS+C  SCTL+WYW+G++Y++GAYSWQVYKNCV LS +A
Sbjct  104  IDYSACGDSCTLWWYWLGIKYVEGAYSWQVYKNCVALSKTA  144

 Score = 32.7 bits (73),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  50  LAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
           LA+L+ QG  T  +  +W + +GY +LR+ +D
Sbjct  3   LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLD  34

>PYU1_G001739
Length=266

 Score = 74.3 bits (181),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNES  140
            +DYSSCKGSCTL WYW+GVRYLK  YSWQ+YK CV LS +A    +AS  +
Sbjct  147  LDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNASGSASASTPA  197

 Score = 63.9 bits (154),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 0/68 (0%)

Query  24  VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83
           V DAHQ +I P+P +    +D  + PLAFLENQG  T  D + + +  GY  LR+ MD  
Sbjct  20  VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79

Query  84  KYTDTAID  91
           K  +   D
Sbjct  80  KLYEVNTD  87

>PYU1_G001738
Length=226

 Score = 71.2 bits (173),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 61/161 (38%), Gaps = 61/161 (38%)

Query  27   AHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSF-------  79
            A   V+ P+P +     +   +P+A LE QG KT  D S + +  GY  LR+        
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  80   ------MDSGKYTDTAI-------------------------------------------  90
                  +D   YTD  +                                           
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  91   -----DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
                 DYSSCKGSC L WYW+G++ +   YSWQVYK CV L
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYCA_537323
Length=200

 Score = 70.1 bits (170),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  SCTL WYW+G++Y++G YSWQVYKNCV L T+A
Sbjct  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

 Score = 35.8 bits (81),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 0/53 (0%)

Query  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
           Q V  P P +     D     LA+L+ QG  T  +  +W   +GY +LR+ +D
Sbjct  36  QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88

>PPTG_17123
Length=201

 Score = 69.3 bits (168),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            +DYSSC  +CTL WYW+G++Y++G YSWQVYKNCV LST+
Sbjct  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

 Score = 38.9 bits (89),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (51%), Gaps = 3/65 (5%)

Query  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG---KY  85
            Q V+ P P +     D     LA+L+ QG  T  +  +W + +GY +LR+ +D     K 
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  86   TDTAI  90
            T+ AI
Sbjct  97   TEEAI  101

>PYAP_22273
Length=268

 Score = 70.1 bits (170),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 68/168 (40%), Gaps = 65/168 (39%)

Query  24   VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGF---------------KTQEDF----  64
            + +AHQ V  P+  +T +DR   + P A LENQG+               KT  DF    
Sbjct  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81

Query  65   SAWRRANGYKTLRSFMD-----------------------------------SGK-----  84
             A++   G      + D                                   SGK     
Sbjct  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141

Query  85   -----YTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
                 +TD  IDYS+CKG C L WYW+G+R +   YSWQ+YK C+PL+
Sbjct  142  ISEKAFTDK-IDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PITG_18452
Length=856

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC GSC L WYW+G++Y++G YSWQVYKNCV LS
Sbjct  814  VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

 Score = 39.3 bits (90),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (5%)

Query  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG---KY  85
            Q V+ P P +     D     LA+L+ QG  T  +  +W +  GY +LR+ +D     K 
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  86   TDTAI  90
            T+ AI
Sbjct  752  TEEAI  756

>PITG_10499
Length=323

 Score = 69.3 bits (168),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 2/54 (4%)

Query  34  PQPSWT--TSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY  85
           P+P W    +DRD  + PLAFLE+QGF  QEDF+ WR  NGYK LR FMD  KY
Sbjct  4   PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKY  57

 Score = 61.6 bits (148),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 2/40 (5%)

Query  90   IDYSSC--KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            ID+SSC  KG CTLYW+W+G+R++K  +SWQVYK C+ L+
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PYAP_22279
Length=223

 Score = 67.8 bits (164),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 67/179 (37%), Gaps = 68/179 (38%)

Query  28   HQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDF--------  64
            HQ + +P P+ TT DR+   +PLAFLENQ               G KT  DF        
Sbjct  22   HQRITIPAPTLTT-DRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  65   ---------SAWRRANGYKT---LRSFMDSGKYTDTA-----------------------  89
                       +   NG +        M S  YT                          
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  90   --------IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS-ARMLEAASNE  139
                    ID+S CKG+C L WYW+  R +   +SWQVYK CVPL  S AR L+    E
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAARSLDDEEEE  199

>PHYRA_81105
Length=201

 Score = 67.0 bits (162),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            IDYS+C  +C L WYW+G++Y++GAYSWQVYKNC+ L   A
Sbjct  159  IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

 Score = 39.3 bits (90),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
           Q V+ P P +     D     LA+L+ QG  T  +   W + +GY +LRS +D
Sbjct  37  QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLD  89

>HYAP_07096
Length=251

 Score = 67.0 bits (162),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)

Query  53   LENQGFKTQEDFSAWRRANGYKTLRSFMDSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLK  112
            LE+ G+        W       + R+      +    +DYSSC  SCTL WYW+G++Y+ 
Sbjct  172  LESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMD  231

Query  113  GAYSWQVYKNCVPL  126
            G YSWQVYKNC+ L
Sbjct  232  GIYSWQVYKNCIGL  245

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
            Q V+ P P +   D  +    LA+L+ QG  T  +  +W++ +GY +LR+ +D
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLD  138

>PYAP_24689
Length=252

 Score = 66.2 bits (160),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 41/75 (55%), Gaps = 8/75 (11%)

Query  73   YKTLRSFMDS------GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +   R F+D+      G  T   IDYS C+G C L +YW+G++   G   WQ YKNCVPL
Sbjct  121  FDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPL  178

Query  127  STSARMLEAASNESA  141
                RMLE   +E A
Sbjct  179  GNDKRMLEEGGDEVA  193

>PYAP_24691
Length=145

 Score = 63.5 bits (153),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 8/75 (11%)

Query  73   YKTLRSFMDS------GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +   R F +S      G  T   IDYS CKG+C L +YW+G++   G   WQ YKNCVP+
Sbjct  11   FDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQSYKNCVPI  68

Query  127  STSARMLEAASNESA  141
                RML    +E+ 
Sbjct  69   GNGKRMLAEGDDEAT  83

>PYAR_24096
Length=227

 Score = 63.9 bits (154),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%)

Query  85   YTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +TD  IDYS+CKG+C L WYW+G+R    +YSWQ+YK C+PLS
Sbjct  148  FTDK-IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

 Score = 63.5 bits (153),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 0/56 (0%)

Query  26  DAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
           +AHQ V LP   +T ++R+  + P A LE QG+KT  DF+A+ +AN YKTLR FMD
Sbjct  25  EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMD  80

>PYAP_18131
Length=226

 Score = 62.8 bits (151),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 3/52 (6%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL---STSARMLEAASN  138
            ID+S CKG C + WYW+G+R L   +SWQVYK C+P+    T+AR ++A  +
Sbjct  75   IDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTAARSIDAEDD  126

>PHYRA_95184
Length=937

 Score = 63.9 bits (154),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)

Query  98   SCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            SC LYWYW+GVRYLKG+YSWQVYK C+PL
Sbjct  2    SCILYWYWLGVRYLKGSYSWQVYKECIPL  30

>PYIW_18788
Length=244

 Score = 59.7 bits (143),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 1/43 (2%)

Query  86   TDTAIDYSSCKGSCTLYWYWMGV-RYLKGAYSWQVYKNCVPLS  127
            T T +DYSSCKG CTL WY + V +   G+YSW+VYKNCV LS
Sbjct  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

 Score = 33.1 bits (74),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 19/68 (28%), Positives = 31/68 (46%), Gaps = 0/68 (0%)

Query  24  VADAHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSG  83
           V  A+  V  P+P +         + +A LE+Q   T  D + + +  GY +LR+ +D  
Sbjct  23  VVVANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDE  82

Query  84  KYTDTAID  91
              D  ID
Sbjct  83  TLYDVNID  90

>PYU1_G005324
Length=191

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  134
            G  T   ID+S+CKG+C L +YW+G++   G   WQ YKNCVPL +S  R LE
Sbjct  134  GSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PYU1_G005326
Length=191

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  134
            G  T   ID+S+CKG+C L +YW+G++   G   WQ YKNCVPL +S  R LE
Sbjct  134  GSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PYU1_G005328
Length=191

 Score = 55.8 bits (133),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 3/53 (6%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLE  134
            G  T   ID+S+CKG+C L +YW+G++   G   WQ YKNCVPL +S  R LE
Sbjct  134  GSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPLKSSKLRSLE  184

>PYAP_18711
Length=210

 Score = 56.2 bits (134),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 4/58 (7%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL--STSARMLEAASN  138
            G  T   IDYS CKG+C L +YW+G++   G   WQ YKNCVP+  +T +R ++A  +
Sbjct  134  GSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIGSATKSRSIDAEED  189

>PYU1_G005323
Length=251

 Score = 55.8 bits (133),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 8/61 (13%)

Query  73   YKTLRSFMDS------GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +  +R+F D       G  T   +D+S+CKGSC L +YW+G++   G   WQ YKNC+PL
Sbjct  117  FDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPL  174

Query  127  S  127
            +
Sbjct  175  T  175

>PYIR_16435
Length=304

 Score = 55.8 bits (133),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 2/37 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            ID+SSCKGSC L W+W+G++       WQVYKNCVPL
Sbjct  148  IDFSSCKGSCMLRWFWLGLQ--DSGERWQVYKNCVPL  182

>PHYKE_10578
Length=239

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 4/51 (8%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            +SGK ++  IDYSSC G C L +YW+G +  +    WQ Y NCVPL+ S +
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQNEQ----WQSYVNCVPLTGSGK  191

>PYAR_20617
Length=254

 Score = 54.3 bits (129),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  T  A+D+S C GSC L +YW+G++   G   WQ YKNCVPL
Sbjct  134  GSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>PITG_04949
Length=337

 Score = 54.7 bits (130),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C L +YW+ ++ LKG   WQ YKNC+PL+  A
Sbjct  156  VDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPLTGPA  197

>PYU1_G005325
Length=207

 Score = 53.5 bits (127),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 2/44 (5%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  T   ID+S+CKG+C L +YW+G++   G   WQ YKNC+PL
Sbjct  134  GSATSFKIDFSACKGNCMLRFYWLGLQ--DGGKRWQSYKNCIPL  175

>PITG_04948
Length=232

 Score = 53.1 bits (126),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C L +YW+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNCIPLSGPA  198

>PHYCA_130365
Length=266

 Score = 53.1 bits (126),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 1/39 (3%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC  G C L +YW+G++ L G   WQ YKNC+PL+
Sbjct  155  VDYSSCASGGCMLRFYWLGLQRLDGKTVWQAYKNCIPLT  193

>PHYSO_342361
Length=155

 Score = 52.0 bits (123),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 61/137 (45%), Gaps = 35/137 (26%)

Query  23   PVADAHQYVILPQPS--------WTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYK  74
            P ADAH Y+ +PQ          W+     VW S   +   Q  K+ + F++ + ++ YK
Sbjct  19   PGADAHGYIYVPQSQFKGGANSQWSVQIDPVWPSKDWYGNTQ--KSVQVFNSLKGSHNYK  76

Query  75   TLRSFMD-SGKY----------------------TDTAIDYSSCK--GSCTLYWYWMGVR  109
             LR+ +D + KY                      T+  +DYS CK  G C + +Y +  +
Sbjct  77   DLRTLLDDTSKYGPNCGYTNPNGTPYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYCLAFQ  136

Query  110  YLKGAYSWQVYKNCVPL  126
             L     WQ YK+C+PL
Sbjct  137  ALGKKTVWQTYKDCIPL  153

>PHYRA_85794
Length=230

 Score = 52.8 bits (125),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNES  140
            DSG  ++  +DYSSC G CT   YW+G +  +    WQ Y NCVPLS +    +  ++ S
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQASGS  201

>PHYRA_77971
Length=230

 Score = 52.8 bits (125),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNES  140
            DSG  ++  +DYSSC G CT   YW+G +  +    WQ Y NCVPLS +    +  ++ S
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGETTQTQASGS  201

>PHYRA_74651
Length=344

 Score = 52.8 bits (125),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 1/39 (3%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC  G CTL +YW+  + L  +  WQVYKNCVPL+
Sbjct  159  VDYSSCPSGGCTLRFYWLAFQGLDSSTVWQVYKNCVPLT  197

>PHYSO_485524
Length=278

 Score = 52.8 bits (125),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 1/53 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
            +DYSSC  G C   +YW+ ++ L G   WQVYKNC+PLS  A    + S  SA
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCIPLSGPAGGGASQSTPSA  209

>PPTG_07511
Length=183

 Score = 51.6 bits (122),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            DSG+ +   +DYSSC G+C    YW+G R  +    WQ Y NCVPLS S 
Sbjct  57   DSGEMSVMPVDYSSCNGNCIFSIYWLGFRNAQ----WQAYINCVPLSGSG  102

>PYAR_14261
Length=150

 Score = 51.2 bits (121),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  T   I++S+CKGSC L +YW+G++       WQ YKNCVPL
Sbjct  19   GSSTSVKINFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  60

>PHYKE_3913
Length=321

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 1/39 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC  G C   +YWM ++ L G   WQVYKNCVPL+
Sbjct  184  VDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCVPLT  222

>PHYRA_79140
Length=424

 Score = 52.4 bits (124),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAAS  137
            S + +D  +DYSSC G CTL  YW+  +  +    WQ Y NCVPLS S    +  S
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLSGSGSATQTQS  197

>PPTG_04619
Length=276

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C   +YW+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCIPLSGPA  198

>PYAR_14260
Length=212

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  T   +++S+CKGSC L +YW+G++       WQ YKNCVPL
Sbjct  110  GSSTSVKVNFSACKGSCMLRFYWLGLQ--DSGTRWQSYKNCVPL  151

>PYAR_14256
Length=199

 Score = 51.2 bits (121),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 2/44 (5%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  T   +D+S+CKGSC L +YW+G++       WQ YKNC+PL
Sbjct  129  GSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPL  170

>PPTG_04618
Length=326

 Score = 52.0 bits (123),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C L +YW+ ++ L G   WQ YKNC+PL+  A
Sbjct  156  VDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

>PHYCA_18657
Length=295

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 4/56 (7%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAA  136
            DSG  ++  +DYSSC G CT   YW+G +  +    WQ Y NCVPLS +    +++
Sbjct  231  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTGATTQSS  282

>PHYKE_2809
Length=291

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 1/39 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC  G C   +YW+ ++ L G   WQVYKNCVPLS
Sbjct  144  VDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCVPLS  182

>PHYSO_483955
Length=320

 Score = 51.6 bits (122),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C L +YW+ ++ L G   WQ YKNC+PL+  A
Sbjct  156  VDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPLTGPA  197

 Score = 30.4 bits (67),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (48%), Gaps = 13/65 (20%)

Query  27  AHQYVILPQPSWTTSDRDVWYSPL------AFLENQG----FKTQEDFSAWRRANGYKTL  76
           AH Y+  P+PSW     + W   +       + E++G      T ++ SA   AN YK +
Sbjct  23  AHGYIAKPEPSWKDKKTNDWVVEIEPQWKGGWDESKGDEGLLATFKELSA---ANNYKDV  79

Query  77  RSFMD  81
           RS MD
Sbjct  80  RSLMD  84

>PYAP_18709
Length=235

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 30/45 (67%), Gaps = 2/45 (4%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            G  T   +D+ +CKGSC L +YW+G++   G   WQ YKNC+PL+
Sbjct  133  GSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLN  175

>PPTG_07509
Length=299

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 6/62 (10%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL--STSARMLEAASNE  139
            S K ++  +D+SSC G CTL  YW+G +  +    WQ Y NCVPL  S SA   +A++  
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSATQTQASTGG  200

Query  140  SA  141
            S 
Sbjct  201  SG  202

>PPTG_07507
Length=299

 Score = 50.8 bits (120),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 6/62 (10%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL--STSARMLEAASNE  139
            S K ++  +D+SSC G CTL  YW+G +  +    WQ Y NCVPL  S SA   +A++  
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCVPLQGSGSATQTQASTGG  200

Query  140  SA  141
            S 
Sbjct  201  SG  202

>PYU1_G006672
Length=57

 Score = 47.4 bits (111),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 4/38 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +D+SSCKGSC L +YW+G +       WQVYKNCV L 
Sbjct  24   VDFSSCKGSCMLRFYWLGFQ----NEQWQVYKNCVRLK  57

>PYU1_G014690
Length=295

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            ID+SSCK +C L ++W+G++       WQVYKNCVPL
Sbjct  144  IDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKNCVPL  178

>PHYRA_73583
Length=630

 Score = 50.8 bits (120),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C   +YW+ ++ L G   WQVYKNC+PLS  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNCIPLSGPA  198

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            IDYSSC  G C   ++W+ ++       WQVYKNCVPLS  A
Sbjct  458  IDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNCVPLSGPA  499

>PHYRA_83500
Length=394

 Score = 50.4 bits (119),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 4/56 (7%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAAS  137
            S + +D  +DYSSC G CTL  YW+  +  +    WQ Y NC PLS S    +  S
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSGSGSATQTQS  197

>PHYCA_12942
Length=353

 Score = 50.4 bits (119),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 4/44 (9%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            G  +D  IDYSSC G+C L  YW+G +  +    WQ Y NCVPL
Sbjct  140  GDTSDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PHYCA_98479
Length=276

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 4/41 (10%)

Query  86   TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +D  +DYSSCKG CTL  YW+G +  +    WQ Y NCVPL
Sbjct  150  SDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PHYRA_86016
Length=236

 Score = 49.7 bits (117),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 4/60 (7%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
            S K ++  +DYSSC G CTL  YW+  +  +    WQ Y NCVPL  S    +  +  S+
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQTSS  137

>PHYRA_86752
Length=300

 Score = 49.7 bits (117),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 4/60 (7%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
            S K ++  +DYSSC G CTL  YW+  +  +    WQ Y NCVPL  S    +  +  S+
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQTSS  201

>PHYRA_86151
Length=170

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query  50  LAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY-----TDTAIDYSSCKG  97
           L+FLE +GF+TQE+F  ++  NGY +LR F+D  KY      D A  +S  KG
Sbjct  29  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKG  81

>PHYRA_73582
Length=326

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYS C  G C L +YW+ ++ L G   WQ YKNC+PL+  A
Sbjct  155  VDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPLTGPA  196

 Score = 30.4 bits (67),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 28/66 (42%), Gaps = 7/66 (11%)

Query  27  AHQYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQED-------FSAWRRANGYKTLRSF  79
           AH Y+  P P+W   + + W   +A L   G+   +        F      N YK L++ 
Sbjct  23  AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  82

Query  80  MDSGKY  85
           MD  ++
Sbjct  83  MDGPEF  88

>PHYRA_87941
Length=157

 Score = 48.1 bits (113),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query  50  LAFLENQGFKTQEDFSAWRRANGYKTLRSFMDSGKY-----TDTAIDYSSCKG  97
           L+FLE +GF+TQE+F  ++  NGY +LR F+D  KY      D A  +S  KG
Sbjct  16  LSFLEKEGFETQENFMQFQVDNGYTSLRDFLDKAKYKVSDGADQACGWSDPKG  68

>PHYRA_73607
Length=343

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +  +  WQVYKNCVPL+  A
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQVYKNCVPLTGPA  200

>PYIR_16444
Length=182

 Score = 48.5 bits (114),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 2/37 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            ID+SSCKG+C L ++W+G++       WQVYKNCVP+
Sbjct  145  IDWSSCKGNCMLRFFWLGLQ--DQGKRWQVYKNCVPV  179

>PHYRA_83494
Length=224

 Score = 48.9 bits (115),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 30/53 (57%), Gaps = 4/53 (8%)

Query  86   TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASN  138
            +D  +DYSSC G CT   YW+  +  +    WQ Y NCVPL+ S    + A++
Sbjct  87   SDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLTGSGSTTQTAAS  135

>SDRG_07565
Length=278

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 5/52 (10%)

Query  90   IDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNES  140
            +DYSSC GS C L +YW+ +   +    WQVYKNCVPL  + + ++A    S
Sbjct  213  VDYSSCGGSGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVKAVGPSS  260

>PHYKE_1913
Length=280

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S K ++  IDYSSC G CTL  YW+  +  +    WQ Y NCVPL
Sbjct  146  SNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINCVPL  186

>PHALS_05392
Length=367

 Score = 48.9 bits (115),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC    C L +YW+ ++ L G   WQ YKNC+PL+  A
Sbjct  239  VDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKNCIPLNGPA  280

>PYIW_19151
Length=248

 Score = 48.5 bits (114),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 2/41 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +D+S CKG C + +YW+G++       WQVYK+CVP+S+SA
Sbjct  142  VDWSLCKGECMIRFYWLGLQ--ASGTRWQVYKSCVPVSSSA  180

>PHYRA_73581
Length=293

 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query  73   YKTLRSFMDSGKYTDTAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            Y T++S +         IDYSSC  S C L +YW+  +     Y WQ+YK+CVPL+  A 
Sbjct  156  YATMKSVLKP-------IDYSSCSASGCMLRFYWLAFQGSNDGYVWQIYKHCVPLTGPAE  208

>PPTG_04620
Length=342

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 1/39 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSCK G C   +YW+ ++       WQVYKNC+PLS
Sbjct  159  MDYSSCKSGGCMFRFYWLALQRRDSKTLWQVYKNCIPLS  197

>PYAP_18221
Length=226

 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 5/52 (10%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA-RMLEAASNES  140
            +DYS CKG+C L +YW+ +   K    WQ YK CVP+   A R ++    ES
Sbjct  160  VDYSKCKGTCRLTFYWLALHSQK----WQAYKQCVPIKYGASRSMDEEDEES  207

>PPTG_04622
Length=273

 Score = 48.1 bits (113),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  88   TAIDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            T +DYSSC  G C L +YW+  + +     WQVYK+CVPL+  A 
Sbjct  157  TPVDYSSCSTGGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPAE  201

>PPTG_18166
Length=445

 Score = 48.1 bits (113),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 4/41 (10%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +D+SSC G CTL  YW+  +  +    WQ Y NCVPLS S+
Sbjct  152  VDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNCVPLSGSS  188

>PHYSO_342364
Length=194

 Score = 47.0 bits (110),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 2/43 (5%)

Query  86   TDTAIDYSSCK--GSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            T+  +DYS CK  G C + +YW+G + L     WQ YKNC+PL
Sbjct  150  TEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 10/84 (12%)

Query  23  PVADAHQYVILPQ--------PSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYK  74
           P ADAH Y+ +PQ          W+     VW S   +   Q  K+ + F++ + ++ YK
Sbjct  19  PGADAHGYIYVPQSQFFGGENSQWSVQIPPVWPSNDWYGNTQ--KSVQVFNSLKTSHNYK  76

Query  75  TLRSFMDSGKYTDTAIDYSSCKGS  98
            LR+ +D+         Y++  G+
Sbjct  77  DLRTLLDNTAVYGPNCGYTNPNGT  100

>PHYCA_531163
Length=314

 Score = 47.4 bits (111),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +  A  WQVYK+CVPL+  A
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSAIVWQVYKDCVPLTGPA  200

>PYIR_24743
Length=357

 Score = 47.4 bits (111),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +D+SSCK +C L +YW+ +       +WQVYKNCVPL
Sbjct  167  VDFSSCKENCMLRFYWLALH----EPTWQVYKNCVPL  199

>PHYKE_10295
Length=292

 Score = 47.4 bits (111),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            IDYSSC G CT  +YWM +       +WQVYK C P++
Sbjct  154  IDYSSCSGDCTFTFYWMALHEP----NWQVYKQCAPIT  187

>PHYSO_324755
Length=262

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 45/103 (44%), Gaps = 36/103 (35%)

Query  64   FSAWRRANGYKTLRSFMDSGK--------YTD---------------------------T  88
            ++A + +NGY  +R+ +DS          YTD                           T
Sbjct  69   YTALKSSNGYSDIRTLLDSDTSLYGADCGYTDRTSLRRTPQRLETPPYGDGTQETASVFT  128

Query  89   AIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
             +DYSSC  S C L +YW+  + +     WQVYK+CVPL+  A
Sbjct  129  PVDYSSCSTSGCMLRFYWLAFQGVDSEIVWQVYKDCVPLTGPA  171

>PYU1_G007364
Length=316

 Score = 47.0 bits (110),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            G      +D+SSC G C + +YW+ ++      +WQ+YKNC+PL+
Sbjct  161  GNPAQMKVDFSSCTGKCVMRFYWLTLQEP----AWQIYKNCIPLA  201

>SDRG_08129
Length=218

 Score = 46.6 bits (109),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 5/47 (11%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEA  135
            +DYSSC G  C L +YW+ +   +    WQVYKNCVPL  + + ++A
Sbjct  151  VDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVKA  193

>SDRG_08137
Length=282

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 5/47 (11%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEA  135
            +DYSSC G  C L +YW+ +   +    WQVYKNCVPL  + + ++A
Sbjct  215  VDYSSCAGDGCMLRFYWLALHQPQ----WQVYKNCVPLQGNGQAVKA  257

>PYU1_G007476
Length=195

 Score = 46.2 bits (108),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARML  133
            +D+SSCKG+C L  YW+G  +      WQ YK CVP+    + L
Sbjct  150  VDFSSCKGTCMLRMYWLG--FQDQGQRWQTYKYCVPVKKGGKRL  191

>PHYSO_484051
Length=285

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            T +DYSSC  S C L +YW+  + +     WQVYK+CVPL+  A 
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPAE  201

>PITG_04947
Length=298

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSCK G C   +YW+ ++       WQVYKNC+PL
Sbjct  132  MDYSSCKSGGCMFRFYWLALQRRDQKTLWQVYKNCIPL  169

>PHYSO_488921
Length=296

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            DYSSCKG C L +YW+ +       +WQ+YK CVP++
Sbjct  156  DYSSCKGDCLLVFYWLALHEP----NWQIYKQCVPIT  188

>PHYSO_329293
Length=310

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            DYSSCKG C L +YW+ +       +WQ+YK CVP++
Sbjct  156  DYSSCKGDCLLVFYWLALHEP----NWQIYKQCVPIT  188

>PHYCA_534473
Length=1050

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +     WQVYK+CVPL+  A
Sbjct  929  TPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQVYKDCVPLTGPA  972

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYSSC  G C   +YW+ ++       WQVYKNC+PL+
Sbjct  626  VDYSSCAAGGCMFRYYWLALQRRDSKTLWQVYKNCIPLT  664

 Score = 33.5 bits (75),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQ  118
            +DYSSC  G C L +YW+ ++ LKG  + Q
Sbjct  156  VDYSSCASGGCMLRFYWLALQRLKGGGASQ  185

 Score = 30.0 bits (66),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 12/31 (39%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQV  119
            +DYSSC  G C   +YW+ ++ L G  + Q 
Sbjct  363  VDYSSCASGGCMFRFYWLALQRLDGGGASQT  393

>H310_06362
Length=197

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +D+SSC GSCT+ +YW+ +        WQVYKNC PL
Sbjct  132  VDFSSCIGSCTIRFYWLALH----EDLWQVYKNCAPL  164

>CCI47381
Length=211

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 42/83 (51%), Gaps = 19/83 (23%)

Query  77   RSFMD---SGKYTDTA----IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL---  126
            R F D   +G +T +     I++SSC G C L ++W+ +   +    WQVYKNC+P+   
Sbjct  131  RVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYKNCIPIAPN  186

Query  127  -----STSARMLEAASNESALII  144
                 S S  M     N++A +I
Sbjct  187  GIRLASISPSMNSETKNQTAPLI  209

>PYIW_18065
Length=308

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 29/46 (63%), Gaps = 5/46 (11%)

Query  82   SGKYTDTAIDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +G      ID+SSCK   CTL +YW+ ++  K    WQ+YKNCVPL
Sbjct  149  TGSKAKIPIDFSSCKKPGCTLKFYWLTLQEPK----WQIYKNCVPL  190

>PHALS_03179
Length=372

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 2/43 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C  + +YW+  + +KG   WQ YKNC+PL  S 
Sbjct  194  VDYSSCANGGCKEMRFYWLAFQGIKGITFWQSYKNCIPLQGSG  236

>PHYCA_97965
Length=288

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S K ++ ++D+SSC G CTL  YW+  +  +    WQ Y NCVPL
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PHYCA_12943
Length=287

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S K ++ ++D+SSC G CTL  YW+  +  +    WQ Y NCVPL
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCVPL  188

>PYIW_18794
Length=247

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 3/48 (6%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLST-SARMLEAA  136
            ID+SSCK  C L +YW+G++  +GA  WQ YKNCVP++  S+R ++ A
Sbjct  184  IDWSSCKSKCVLRFYWLGLQ-DQGAL-WQSYKNCVPITAGSSRSIDDA  229

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
            ID+SSC   C L +YW+G++   G   WQ Y
Sbjct  126  IDWSSCASKCVLRFYWLGLQ--DGGERWQSY  154

>PHYRA_73584
Length=287

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +     WQVYK+CVPL+  A
Sbjct  154  TPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQVYKDCVPLTGPA  197

>PHALS_05394
Length=288

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query  90   IDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            IDYSSCKG  C L +YW+ ++ +     WQ YKNC+ +  S+
Sbjct  158  IDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNCISIKGSS  199

>PYU1_G005985
Length=200

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  134
            +++S C+G CTL +YW+ +       +WQVYK CVP+    + L 
Sbjct  159  VNFSVCQGKCTLTFYWLALH----EPTWQVYKQCVPIENQGKRLR  199

>PHYKE_2937
Length=366

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 29/44 (66%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +  +  WQVYK+CVPL+  A
Sbjct  161  TPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQVYKDCVPLTGPA  204

>PHYRA_77293
Length=302

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (59%), Gaps = 4/46 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +G   +  ID+SSC G CT  +YWM +       +WQVYK C P++
Sbjct  146  TGYPAEIPIDFSSCSGDCTFTFYWMAMHEP----NWQVYKQCAPIA  187

>PHYRA_83499
Length=473

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 31/60 (52%), Gaps = 4/60 (7%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESA  141
            S K ++  +DYSSC G CTL  YW+  +  +    WQ Y NCV L  S    +  +  S+
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQTQTQTSS  201

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
            DSG  +D  IDYSSC G+CTL  YW+G +  +    WQ Y
Sbjct  378  DSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAY  413

>PPTG_04647
Length=327

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 1/44 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            T +DYSSC  S C L +YW+  + +     WQVYK+CVPL+  A
Sbjct  156  TPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQVYKDCVPLTGPA  199

>PHYSO_459106
Length=223

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (62%), Gaps = 1/42 (2%)

Query  90   IDYSSC-KGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C   +YW+ ++       WQVYKNC+PL+  A
Sbjct  157  VDYSSCASGGCMFRFYWLALQRRDSKTYWQVYKNCIPLTGPA  198

>PYU1_G005868
Length=267

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYS CKG C L +YW+ +       +WQ+YK CVP+
Sbjct  154  VDYSVCKGKCQLTFYWLALHEP----NWQIYKQCVPI  186

>PYIR_20481
Length=277

 Score = 45.4 bits (106),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYS CKG C L +YW+ +       +WQ+YK CVP+
Sbjct  154  VDYSKCKGKCQLTFYWLALH----EPNWQIYKQCVPI  186

>PYVX_21643
Length=260

 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            +G   +  IDYSSC G C   +YW+ +       +WQVYK C P+S S
Sbjct  145  TGYPAEIPIDYSSCSGDCDFTFYWLALH----EPNWQVYKQCAPISNS  188

>PYAP_22257
Length=247

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            ++YS CKG C L +YW+ +   +    WQVYKNCVP+
Sbjct  151  VNYSVCKGECMLRFYWLALHEPE----WQVYKNCVPI  183

>H257_13550
Length=266

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 25/37 (68%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +D++SC GSCT+ +YW+ +        WQVYKNC PL
Sbjct  187  VDFASCVGSCTIRFYWIALHQ----DLWQVYKNCAPL  219

>PYIW_15526
Length=256

 Score = 45.1 bits (105),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYS CKG+C L +YW+ V   K    WQVYK CV +
Sbjct  156  VDYSVCKGTCRLTFYWLAVHSPK----WQVYKGCVAI  188

>PHYCA_103479
Length=314

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            DYSSCKG C   +YW+ +       +WQ+YK CVP++
Sbjct  156  DYSSCKGDCLFSFYWLALHEP----NWQIYKQCVPIT  188

>PHYRA_73606
Length=366

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 1/41 (2%)

Query  88   TAIDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            T +DYSSC  S C L +YW+  + +     WQVYK+CVPL+
Sbjct  157  TPVDYSSCSTSGCMLRFYWLAFQGVDSEIVWQVYKDCVPLT  197

>PHYCA_14560
Length=300

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 4/41 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            DYSSCKG C   +YW+ +        WQ+YK CVP++ + +
Sbjct  156  DYSSCKGDCLFVFYWLALHEPD----WQIYKQCVPITNNGK  192

>PITG_01966
Length=327

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            ID+SSC G CT  +YW+ +       +WQVYK C P++
Sbjct  187  IDFSSCSGDCTFTFYWLALHEP----NWQVYKQCAPIT  220

>PHYKE_2539
Length=258

 Score = 44.7 bits (104),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (60%), Gaps = 4/47 (9%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAAS  137
            D+S C G CTL +YW+ +       +WQ+YK CVP+  ++   EA +
Sbjct  149  DFSKCSGDCTLRFYWIALHEP----NWQIYKQCVPVVNNSGAQEAGT  191

>PPTG_01153
Length=317

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 4/52 (8%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142
            DYSSCKG C   +YW+ +       +WQ+YK CVP++ +       +  S++
Sbjct  156  DYSSCKGDCLFAFYWLALHEP----NWQIYKQCVPITNNGSGASTTTQSSSV  203

>CCA17179
Length=185

 Score = 43.9 bits (102),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 4/48 (8%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAAS  137
            ID+S+C   C L ++W+ +   +    WQVYKNC+P++ +   L + S
Sbjct  125  IDFSTCTNGCLLQFFWLALHEPQ----WQVYKNCIPIAPNGIKLASIS  168

>PHYKE_10296
Length=512

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            DYSSCKG C   +YW+ +   +    WQ+YK CVP++
Sbjct  156  DYSSCKGDCLFVFYWLALHQAE----WQIYKQCVPIT  188

 Score = 44.7 bits (104),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 29/54 (54%), Gaps = 6/54 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLST--SARMLEAASNESAL  142
            DYSSCKG C   +YW+ +        WQ+YK CVP++   S +   A  NE  +
Sbjct  436  DYSSCKGDCLFVFYWLALHQA----DWQIYKQCVPITNGGSGQKEVADGNEDEI  485

>HYAP_14170
Length=266

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (67%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            D+S C G CTL +YW+ +  +    +WQVYK CVP+
Sbjct  149  DFSRCSGVCTLRFYWLALHEV----NWQVYKQCVPI  180

>PHYSO_255975
Length=187

 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL--STSARMLEAA  136
            +G       ++S C G CTL +YW+ +   K    WQ+YK CVP+  ++ AR L  A
Sbjct  135  AGTQIKVPANFSKCLGDCTLRFYWLALHEPK----WQIYKQCVPIVNNSGARALRTA  187

>PPTG_10186
Length=270

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARM  132
            D+S C G CTL +YW+ +       +WQ+YK CVP+  ++ M
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPIVNNSGM  199

>PPTG_07516
Length=294

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S + +D  +D+SSC G C L  YW+  +  +    WQ Y NCVPL
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PYVX_14662
Length=540

 Score = 44.7 bits (104),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 2/39 (5%)

Query  90   IDYSSCK-GSC-TLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC  G C  + +YW+  + + G   WQVYKNC+PL
Sbjct  155  VDYSSCNSGGCKEMRFYWLAFQGVDGDTVWQVYKNCIPL  193

>PPTG_07520
Length=294

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S + +D  +D+SSC G C L  YW+  +  +    WQ Y NCVPL
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCVPL  184

>PHYRA_77290
Length=309

 Score = 44.3 bits (103),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            D+SSCKG C   +YW+ +        WQ+YK CVP++ S 
Sbjct  158  DFSSCKGDCLFVFYWLALHEPN----WQIYKQCVPITNSG  193

>PITG_20312
Length=270

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARM  132
            D+S C G CTL +YW+ +       +WQ+YK CVP+  ++ M
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPIMNNSGM  199

>PPTG_01148
Length=295

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +D+SSC G CT  +YW+ +       +WQVYK C P++
Sbjct  154  VDFSSCSGDCTFTFYWLALHEP----NWQVYKQCAPIT  187

>PITG_20631
Length=270

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARM  132
            D+S C G CTL +YW+ +       +WQ+YK CVP+  ++ M
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPIMNNSGM  199

>SDRG_17317
Length=122

 Score = 42.7 bits (99),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 25/43 (58%), Gaps = 5/43 (12%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            IDYSSC G  C L +YW+ +        WQVYKNCVPL  +  
Sbjct  75   IDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPLEGNGE  113

>PHYSO_262844
Length=276

 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            IDYS+C G CT  +YW+ +       +WQVYK C P+
Sbjct  154  IDYSACSGDCTFTFYWLALHEP----NWQVYKQCAPI  186

>PHYCA_122958
Length=260

 Score = 43.9 bits (102),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            DYS C G CTL +YW+ +       +WQ+YK CVP+
Sbjct  159  DYSQCSGDCTLRFYWLALH----EPNWQIYKQCVPI  190

>PYVX_24563
Length=254

 Score = 43.9 bits (102),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            D+S C GSCTL +YW+ +       +WQ+YK C P++ S
Sbjct  158  DFSKCSGSCTLRFYWLALH----EPNWQIYKQCAPITNS  192

>PITG_11956
Length=339

 Score = 44.3 bits (103),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 27/121 (22%)

Query  24   VADAHQYVILPQPSWTTSDRD-VWYSPLAFLENQGFK------TQEDFSAWRRA---NGY  73
            V + H Y+ +P+  +T    D   Y       + GF        +++ +A+ +A   + Y
Sbjct  37   VVNGHGYLTIPKVRFTAQAGDPTQYIASIQASDSGFSGTFNGAPKDNVAAFTKAFKASKY  96

Query  74   KTLRSFMDSGKYTDTA--------IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVP  125
             +L+ F     +TD A         D  +C G+ TL +YWM +     + SWQVY NC P
Sbjct  97   TSLKEF-----FTDKAKIGVPVLPFDREACMGATTLTFYWMAMH----SESWQVYVNCAP  147

Query  126  L  126
            L
Sbjct  148  L  148

>SPRG_22161
Length=300

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 5/57 (9%)

Query  90   IDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALIID  145
            +DYSSC  + C L +YW+ +        WQVYKNCVPL  + +   +A   +A  ++
Sbjct  153  VDYSSCGANGCMLRFYWLALH----EPMWQVYKNCVPLKGNGQQPTSAPKPTAKPVN  205

>PYIW_25463
Length=216

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (67%), Gaps = 5/51 (10%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL-STSARMLEAASNE  139
            + Y++CKG+C L +YW+ +   K    WQ YK+CVP+ + +AR +++  ++
Sbjct  158  MSYAACKGTCRLTFYWLALHSQK----WQAYKHCVPIKAGAARSMDSEDDD  204

>SPRG_19916
Length=305

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            IDYSSC G  C L +YW+ +        WQVYKNCVPL  + +
Sbjct  153  IDYSSCSGDGCMLRFYWLALHEPM----WQVYKNCVPLEGNGQ  191

>PHYKE_5749
Length=300

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (56%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            S + +D  +DYSSC G C    YW+  +  +    WQ Y NCVPL
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQNAQ----WQTYINCVPL  187

>PYVX_16673
Length=681

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            IDYSSC G CT  +YW+ +   +    WQ++K C P++ S
Sbjct  595  IDYSSCTGDCTFTFYWLPLHEPE----WQIFKQCAPITRS  630

>PHYRA_84732
Length=265

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (58%), Gaps = 4/45 (9%)

Query  82   SGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            SG     + D+S C G CTL +YW+ +       +WQVYK CVP+
Sbjct  153  SGYPASVSADFSKCSGDCTLRFYWLALH----EPNWQVYKQCVPV  193

>PYU1_G005866
Length=194

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 28/40 (70%), Gaps = 4/40 (10%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            ++YS CKG+C L +YW+ +       +WQ+YK+CVP++ S
Sbjct  159  VNYSVCKGNCILTFYWLALH----EPNWQIYKHCVPVNYS  194

>PHYCA_69583
Length=224

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  90   IDYSSCKGS-CTLYWYWMGVR-YLKGAYSWQVYKNCVPLS  127
            IDYSSC  S C   +YW+  +    G Y WQ+YK+C+PL+
Sbjct  160  IDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLT  199

>PYU1_G005867
Length=200

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 32/46 (70%), Gaps = 5/46 (11%)

Query  90   IDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  134
            I+Y++CK S CTL +YW+ +       +WQ+YK+CVP++ S ++ +
Sbjct  159  INYAACKTSKCTLTFYWLALH----EPNWQIYKHCVPITNSKKLRD  200

>PHALS_03176
Length=207

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 2/43 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C  + +YW+  + + G   WQ YKNC+PL  S+
Sbjct  153  VDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSYKNCIPLQGSS  195

 Score = 30.8 bits (68),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 29/66 (44%), Gaps = 6/66 (9%)

Query  26  DAHQYVILPQPSWTTSDRDVWYSPLAFL------ENQGFKTQEDFSAWRRANGYKTLRSF  79
           D H Y+++PQ  +  S    W   +  L           K+ + F   + AN +K L++ 
Sbjct  22  DGHGYMLIPQAQFKGSANSAWIVQIDPLWKSSDWNGNTQKSVKTFQKLKAANKFKDLKTL  81

Query  80  MDSGKY  85
           MD+  +
Sbjct  82  MDTSAF  87

>PYAR_17163
Length=114

 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 29/49 (59%), Gaps = 5/49 (10%)

Query  87   DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEA  135
            +  + +S+CKG+CTL +YW+ +   +    WQVYK C  L  + RML  
Sbjct  71   EIPVSFSACKGTCTLTFYWLALHEPQ----WQVYKQCA-LIKNGRMLRG  114

>PYIR_20483
Length=287

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (67%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            D+S CKG+C + +YW+ +   K    WQ+YK CVP+
Sbjct  163  DFSVCKGTCRVTFYWLALHSQK----WQIYKQCVPV  194

>PPTG_07521
Length=281

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 24/41 (59%), Gaps = 4/41 (10%)

Query  86   TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +D  +DYSSC   CTL  YW+  +      +WQ Y NCVPL
Sbjct  150  SDMPVDYSSCTEDCTLTIYWLAFQN----ANWQAYINCVPL  186

>PYU1_G005872
Length=297

 Score = 43.1 bits (100),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 4/53 (8%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142
            + Y SCKG+C L +YW+ +   K    WQ YK+CV +  +A   E +S+   L
Sbjct  159  MSYKSCKGTCRLTFYWLALHSPK----WQAYKSCVAIKNNAYSEERSSDPEDL  207

>PYIR_16443
Length=275

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 3/35 (9%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY-KNC  123
            ID+SSCKGSC L W+W+G++       WQVY K+C
Sbjct  145  IDFSSCKGSCMLRWFWLGLQ--DSGKRWQVYSKSC  177

>PYU1_G005871
Length=284

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 30/53 (57%), Gaps = 4/53 (8%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESAL  142
            + Y SCKG+C L +YW+ +   K    WQ YK+CV +  +A   E +S+   L
Sbjct  159  MSYKSCKGTCRLTFYWLALHSPK----WQAYKSCVAIKNNAYSEERSSDPEDL  207

>PYAP_18584
Length=210

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (55%), Gaps = 8/51 (16%)

Query  84   KYT----DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            KYT    +  +DYS CKG C L +YW+ +       +WQ+YK C P+   +
Sbjct  149  KYTSYPAELPVDYSVCKGKCQLTFYWLALH----EPNWQIYKQCAPIQNGS  195

>PHYKE_6001
Length=289

 Score = 42.7 bits (99),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (5%)

Query  90   IDYSSCKGS-CT-LYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC G  C  + +YW+  + + G   WQ YKNC+PL  S 
Sbjct  154  VDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPLEGSG  196

 Score = 33.1 bits (74),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 11/79 (14%)

Query  23  PVADAHQYVILPQPSWTTSDRDVWYSPLAFL------ENQGFKTQEDFSAWRRANGYKTL  76
           P ADAH Y+++P+  +  S    W   +  +      +    ++   F+A ++AN Y  L
Sbjct  19  PRADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTAFNALKKANNYVDL  78

Query  77  RSFMDSGKYTDTAIDYSSC  95
           ++ MD     DT++  + C
Sbjct  79  KTLMD-----DTSVYGADC  92

>PHYSO_476077
Length=268

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            D+S C G CTL +YW+ +       +WQ+YK CVP+
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPV  193

>PHYSO_472009
Length=268

 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            D+S C G CTL +YW+ +       +WQ+YK CVP+
Sbjct  162  DFSKCSGDCTLRFYWLALH----EPNWQIYKQCVPV  193

>SDRG_17448
Length=262

 Score = 42.4 bits (98),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            +DYSSC G  C L +YW+ +   +    WQVYKNCVPL  + +
Sbjct  49   VDYSSCAGDGCMLRFYWIALHQPE----WQVYKNCVPLQGNGQ  87

>PHYRA_86751
Length=163

 Score = 41.6 bits (96),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (63%), Gaps = 4/40 (10%)

Query  81   DSGKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
            DSG  +D  IDYSSC G+CTL  YW+G +  +    WQ Y
Sbjct  68   DSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ----WQAY  103

>PHYSO_488139
Length=265

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 5/39 (13%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            +DYS+CKG  C   +YW+ V     +  WQ+YK CVP+S
Sbjct  158  VDYSACKGDKCLFVFYWLAVH----SPEWQIYKQCVPIS  192

>PYIW_20715
Length=264

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 5/42 (12%)

Query  90   IDYSS-CKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DY+  CKG C L +YW+ +   K    WQ+YK CVP+ + +
Sbjct  141  VDYAKVCKGKCQLTFYWLALHEPK----WQIYKQCVPIQSGS  178

>PHALS_04411
Length=262

 Score = 42.0 bits (97),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 1/39 (3%)

Query  90   IDYSSCK-GSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            + YS C  G   L +YW+ ++ L+G   WQ YKNC+PL+
Sbjct  156  VKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIPLT  194

>PYIR_23585
Length=240

 Score = 41.6 bits (96),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            ID+S+CKGSC L +YW+G++   G   +Q Y  C+ L
Sbjct  143  IDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  177

>PITG_05271
Length=278

 Score = 42.0 bits (97),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 2/43 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            +DYSSC  G C  + +YW+  + + G   WQ YK+C+PL  S 
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPLEGSG  196

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 11/79 (14%)

Query  23  PVADAHQYVILPQPSWTTSDRDVW---YSPLAFLEN-QGFK--TQEDFSAWRRANGYKTL  76
           P  DAH Y+++P+  +  S    W     P+   E+  G K  +   F A + AN +K L
Sbjct  19  PSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTANKFKDL  78

Query  77  RSFMDSGKYTDTAIDYSSC  95
           ++ MD     DT++  + C
Sbjct  79  KTLMD-----DTSVYGADC  92

>PYAR_17166
Length=114

 Score = 40.0 bits (92),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 5/53 (9%)

Query  83   GKYTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEA  135
            G   +  + +S+C+G+CTL +YW+ +   +    WQVYK C  L  + RML  
Sbjct  67   GFPAEMPVSFSACQGTCTLTFYWLALHEPQ----WQVYKQCA-LIKNGRMLRG  114

>PYU1_G005869
Length=259

 Score = 41.6 bits (96),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 25/36 (69%), Gaps = 4/36 (11%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            D+S CKG+C + +YW+ +     + +WQ+YK CVP+
Sbjct  161  DFSVCKGTCRVTFYWLALH----SPNWQIYKQCVPV  192

>PHALS_06480
Length=159

 Score = 40.4 bits (93),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  29  QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLRSFMD  81
           Q V+ P P +     D     LA+LE QG  T  +  +W + + Y +LR+ +D
Sbjct  35  QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLD  87

>PYIR_15187
Length=207

 Score = 40.8 bits (94),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 4/37 (11%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +++S CK  CTL +YW+ +       +WQVYK CVP+
Sbjct  164  VNFSLCKDKCTLTFYWLALH----EPTWQVYKQCVPI  196

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (51%), Gaps = 11/67 (16%)

Query  26  DAHQYVILPQPSWTTSDRDVWYSP-LAFLENQGFKTQ----------EDFSAWRRANGYK  74
           +AH Y+ +PQ S+T S     YS  L+   N  F+ +          + F+A  RA GY 
Sbjct  27  EAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAAGYP  86

Query  75  TLRSFMD  81
           +L++ +D
Sbjct  87  SLKTLLD  93

>PHYSO_340332
Length=295

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC  G C  + +YW+  + + G   WQ YK+C+PL
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

 Score = 32.7 bits (73),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (48%), Gaps = 6/65 (9%)

Query  23  PVADAHQYVILPQPSWTTSDRDVWYSPLAFL------ENQGFKTQEDFSAWRRANGYKTL  76
           P ADAH Y+++P+  +  S    W   +  +      +     + + F A + AN +K L
Sbjct  19  PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77  RSFMD  81
           ++ MD
Sbjct  79  KTLMD  83

>PHYCA_132255
Length=128

 Score = 39.7 bits (91),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 4/58 (7%)

Query  86   TDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALI  143
            T   ID  +CK S  L +YW+    L+GA  WQVY NCV L  SA      SN ++ I
Sbjct  64   TSLPIDLDTCKSSSELVFYWLS---LQGA-PWQVYINCVKLDGSAAAGNDKSNSTSSI  117

>PHYRA_77291
Length=252

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query  91   DYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            DYS+CKG  C   +YW+ V     +  WQ+YK CVP+S
Sbjct  158  DYSACKGDKCLFVFYWLAVH----SPEWQIYKQCVPIS  191

>PYU1_G005873
Length=214

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLE  134
            + + +CKG+C L +YW+ +   K    WQ YK+CVP+  +A   E
Sbjct  159  MSFKACKGTCRLTFYWLALHSPK----WQAYKSCVPIKYNAYSAE  199

>PHYSO_340333
Length=284

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC  G C  + +YW+  + + G   WQ YK+C+PL
Sbjct  154  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

 Score = 32.7 bits (73),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 31/65 (48%), Gaps = 6/65 (9%)

Query  23  PVADAHQYVILPQPSWTTSDRDVWYSPLAFL------ENQGFKTQEDFSAWRRANGYKTL  76
           P ADAH Y+++P+  +  S    W   +  +      +     + + F A + AN +K L
Sbjct  19  PSADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDL  78

Query  77  RSFMD  81
           ++ MD
Sbjct  79  KTLMD  83

>PHYCA_534296
Length=309

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  90   IDYSSC-KGSCT-LYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC  G C  + +YW+  + + G   WQ YK+C+PL
Sbjct  128  VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  166

>PPTG_18176
Length=263

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 5/41 (12%)

Query  91   DYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            DYS+CKG  C   +YW+ +   K    WQ+YK CVP+S   
Sbjct  158  DYSACKGDKCLFVFYWLALHSPK----WQIYKQCVPISNGG  194

>PHYCA_14559
Length=251

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 5/41 (12%)

Query  91   DYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            DYSSCKG  C   +YW+ +     +  WQ+YK CVP+S   
Sbjct  158  DYSSCKGDKCLFVFYWLALH----SPEWQIYKQCVPISNGG  194

>PYAR_21941
Length=61

 Score = 38.1 bits (87),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query  84   KYTDTAIDYSSCKG--SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSAR  131
            K     +DYS C+   +CTL +YW+ +       +WQVYK CVP++    
Sbjct  10   KPASIPVDYSVCQSGQTCTLTFYWLALH----EPNWQVYKQCVPITRGGH  55

>SPRG_19917
Length=241

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC    C L +YW+ +   +    WQVYKNCVPL
Sbjct  153  VDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>SDRG_17318
Length=241

 Score = 40.4 bits (93),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 5/38 (13%)

Query  90   IDYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126
            +DYSSC    C L +YW+ +   +    WQVYKNCVPL
Sbjct  153  VDYSSCGAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>PPTG_01152
Length=262

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 5/41 (12%)

Query  91   DYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            DYSSCKG  C   +YW+ +     +  WQ+YK CVP+S   
Sbjct  158  DYSSCKGDKCLFVFYWLALH----SPEWQIYKQCVPISNGG  194

>PYAP_18226
Length=226

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query  90   IDYSSCKGS-CTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSARMLEAASNESALIIDEN  147
            +DYS CK S C L +YW+ +   K    WQ YK CVP+   A       +ES    D N
Sbjct  161  VDYSKCKSSKCMLRFYWLALHSEK----WQAYKQCVPIKYGASRSMDDEDESYSFSDLN  215

>PHYCA_562062
Length=237

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 8/49 (16%)

Query  83   GKYT----DTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLS  127
            G YT    +  +D+SSC G CT  +YW+ +       +WQVYK C  ++
Sbjct  144  GDYTGYPAEIPVDFSSCSGDCTFTFYWLALH----EPNWQVYKQCAAIT  188

>PPTG_01147
Length=263

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 5/41 (12%)

Query  91   DYSSCKG-SCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130
            DYSSCKG  C   +YW+ +     +  WQ+YK CVP+S   
Sbjct  158  DYSSCKGDKCLFVFYWLALH----SPEWQIYKQCVPISNGG  194

>PHYSO_533903
Length=208

 Score = 39.7 bits (91),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 3/44 (7%)

Query  86   TDTAIDYSSCK-GSCTLY-WYWMGVRYLKGAYS-WQVYKNCVPL  126
            T+  IDYSSC+ G C +  +YW+G + L    + WQ YK+C+PL
Sbjct  151  TEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIPL  194

 Score = 29.6 bits (65),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 26/75 (35%)

Query  23  PVADAHQYVILPQ----------------PSWTTSDRDVWYSPLAFLENQGFKTQEDFSA  66
           P  DAH Y+ +PQ                P W + D   WY   A       K+ E F +
Sbjct  20  PGVDAHGYIYVPQSQFKGGENSQWLVQIDPVWKSDD---WYGNTA-------KSVEVFKS  69

Query  67  WRRANGYKTLRSFMD  81
            + AN +K L++ +D
Sbjct  70  LKVANNFKDLKTMLD  84

>PHYKE_6079
Length=302

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 4/39 (10%)

Query  91   DYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTS  129
            D+ +C G+ TL +YW+ +     + +WQVY NC PL T+
Sbjct  165  DHDACLGTSTLTFYWLALH----SSTWQVYVNCAPLETT  199

>PHYSO_255056
Length=269

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 23/38 (61%), Gaps = 2/38 (5%)

Query  91   DYSSCKGSCTLYWYWMGVR-YLKGAYSWQVYKNCVPLS  127
            DY S  G C   +YW+  +    G Y WQ+YKNC+PL+
Sbjct  150  DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PYIW_27477
Length=180

 Score = 38.9 bits (89),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  90   IDYSSCKGSCTLYWYWMGVRYLKGAYSWQVY  120
            ID+S+CKG C L W+W+G++       WQVY
Sbjct  122  IDFSACKGKCMLRWFWLGLQ--DSGKRWQVY  150

Lambda      K        H        a         alpha
   0.318    0.130    0.421    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4284931392

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40