Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_181734496650050019240.0
PHYCA_537323449662001756917e-88
PPTG_17123147532011746864e-87
PHYRA_81105534612011756803e-86
PITG_18452147538561776981e-81
PPTG_17122147522041606222e-77
PHYCA_129425147522041606117e-76
PHYKE_8389147522041616031e-74
PHYRA_81106147522021615994e-74
PITG_18450147522031605987e-74
PHYSO_284086147522041605934e-73
PHYRA_81107568762021615925e-73
PHYKE_8388568762051615812e-71
PPTG_17121568762021615803e-71
PHYSO_477820568762021615778e-71
PYVX_18176568762011605752e-70
PPTG_10635528561991615724e-70
PHYCA_511409568762041615708e-70
PHYCA_14369109792481615741e-69
PHYKE_7718109792201615683e-69
PYU1_G001740147522061605673e-69
PHYSO_353401534611461425604e-69
PHYCA_102852242061951615638e-69
PHYRA_84190720132061615631e-68
PYU1_G001739932032661615681e-68
PHYSO_341599109791851615611e-68
PPTG_10634720132081615622e-68
PYU1_G001742932042131605622e-68
PYU1_G001741854041991605612e-68
PHYRA_85631109792281615623e-68
PPTG_10636109792461615643e-68
HYAP_07096534612511755626e-68
PHYCA_102550457052681615637e-68
PHYCA_102624720131951615551e-67
PYU1_G001744568762131605571e-67
PHYSO_536424606911971615523e-67
PHYSO_507031586531971615523e-67
PHYRA_82864231281931605515e-67
PYIR_25089854042621615532e-66
PPTG_10643457052501615489e-66
PHALS_00498109791991615402e-65
PYIR_26626147522121615403e-65
PHYKE_3446231281991615376e-65
PPTG_15264231281941635235e-63
PPTG_17366239131941635235e-63
PPTG_10048213141901615141e-61
PYVX_18174854042041615099e-61
PYIR_26546866052391645051e-59
PHALS_03284309411881624992e-59
PPTG_14255469372681674914e-57
PYAR_24096932032271634841e-56
PYIW_18791854041941624766e-56
PYAP_22273932032681634765e-55
PPTG_0882086622501664721e-54
PHYCA_510817445761881664642e-54
PPTG_14254445761881664633e-54
PHYSO_499978231281741404607e-54
PHYSO_501575820771741404607e-54
PYAP_22278932042891674654e-53
PYU1_G001738534612261624561e-52
PHYKE_9185445762811664592e-52
PHYSO_417649445761851664512e-52
PYAP_22279854042231654525e-52
PHYCA_53693413059831664763e-50
PHYSO_343376532371721324301e-49
PITG_1049986623231594432e-49
PHYSO_262732469371881664242e-48
PITG_13520109791711314205e-48
PHYSO_527908600641741544171e-47
PHYKE_8390534611301094088e-47
PHYSO_254168462841701494092e-46
PYIW_18788932032441594048e-45
PHYSO_341596528562311233793e-41
PHYSO_340369526762001663441e-36
PHYCA_14368528562191603354e-35
PHYSO_246676457051871613044e-31
PYAP_18131991722261133031e-30
PYIW_1879293204125982671e-26
PHALS_0648053461159712584e-25
PHYCA_12727044782791432631e-24
PHYRA_7868968382961432632e-24
PYIR_1643542333041342606e-24
PYIR_1644442341821342464e-23
PHYSO_438103557212381772504e-23
PHYSO_34033244782951432535e-23
PHYRA_78625541464341632595e-23
PHYSO_340333526712841432517e-23
PHYRA_78626578954731632597e-23
PHYSO_533682604462781562508e-23
PYIW_19151831912481282471e-22
PPTG_04622696962731342491e-22
PHYRA_74651699693441342512e-22
PYVX_18179534611471602372e-22
PYIR_16443823992751322472e-22
PPTG_1422144782751432463e-22
PYIW_27477823991801222384e-22
PHYSO_342364529831941772404e-22
PHYSO_533903604652081432414e-22
PHYCA_13036542352661272401e-21
PYAP_18709943552351322382e-21
PYU1_G01469042342951342412e-21
PITG_0494942353371812432e-21
PITG_0527144782781432393e-21
PYU1_G007476539131951322333e-21
PHYCA_534296526713091432403e-21
PHYCA_12942213313531032372e-20
PYVX_14662510865401432412e-20
PHYRA_73607194343431282352e-20
PHYKE_6002526711971322262e-20
PHYSO_48552442342781292322e-20
PYU1_G005323943552511332303e-20
PYAR_14256943551991312254e-20
PPTG_0461842353261812324e-20
PHYSO_48395542353201812325e-20
PHYKE_391342343211282317e-20
PITG_0494842342321282258e-20
PHYKE_10578778802391772241e-19
PHYRA_7914038074241062302e-19
PHYCA_534473423310503352343e-19
PHYKE_2809752822911282243e-19
PHYKE_600144782891432243e-19
PYIR_19612831912601342224e-19
PHALS_0317644782071432175e-19
PYAP_18711943562101322185e-19
PITG_1193697753331412245e-19
PHYRA_86016727462361082195e-19
PPTG_0461942342761282216e-19
PHYRA_7358242353261802237e-19
PHYRA_7358442332871282218e-19
PHYRA_83500718143941062258e-19
PHYKE_2937571983661282231e-18
PHYSO_533747604512061372151e-18
PPTG_04647194343271282211e-18
PHYRA_73606571983661342231e-18
PHYSO_484051571982851292191e-18
PYU1_G005324845341911322131e-18
PYU1_G005326463491911322131e-18
PYU1_G00532842331911322131e-18
PYIW_168101650732161712142e-18
PHYRA_86752732363001082192e-18
PYAR_14260845342121332142e-18
CCI4738117292111452132e-18
PHALS_0539242353671822203e-18
CCA1717917291851452103e-18
PYU1_G005325943562071322113e-18
PYAR_2411397811921732104e-18
PPTG_0313997753201792174e-18
PYAP_246891014392521192135e-18
PHYKE_607897753171572156e-18
PHYSO_459106194342231282106e-18
PHYSO_524101597733081432157e-18
PHALS_03177526712591762128e-18
PHYRA_78176597733121322148e-18
PHYRA_7358342346301282218e-18
PPTG_0750738072991082139e-18
PPTG_07509718142991082139e-18
PHYCA_97965401872881082121e-17
PHYRA_83494464352241082081e-17
PPTG_0315697874451792171e-17
PHYCA_12943369712871082121e-17
PHYRA_85794726192301092081e-17
PHYRA_77971705552301092081e-17
PHYCA_531163194343141282122e-17
PHYCA_1961197755311432172e-17
PHALS_03179308833721272132e-17
PPTG_03153597733141312113e-17
PHYRA_78175764333191412113e-17
PITG_0494742332981282093e-17
PYIW_187905687686811934e-17
PPTG_03138188562941432084e-17
PYAR_206171040482541332064e-17
SDRG_165351259803131772086e-17
PHYKE_6079597733021792077e-17
PHYRA_8075044782751382057e-17
PHYSO_24648197753181792077e-17
PITG_0820268381911312009e-17
PYVX_16138786195591482129e-17
H257_112641259792821802051e-16
PHYCA_69583463492241262011e-16
PYIR_23585845342401652021e-16
PYU1_G007364851643161022051e-16
PHYSO_255056463492691172031e-16
PHYRA_83499204334731082091e-16
PHALS_0539442342881832032e-16
PYIW_1552617302561372012e-16
H310_054321431863011772032e-16
H310_0636217301971361972e-16
H257_112651431862821802013e-16
PYIW_2196497752651411994e-16
SPRG_077961259803221752024e-16
PPTG_0462042333421282025e-16
PYIR_2213497753001812005e-16
PYIW_242891643031961571936e-16
SDRG_165341259793201782007e-16
PHYKE_574938073001051988e-16
PYAP_18221944962261591948e-16
PPTG_07516464352941081971e-15
PHYKE_6076764332721581961e-15
PPTG_0752038142941081971e-15
PHYCA_112615308831961311911e-15
PITG_1193797763051351962e-15
PHYRA_78161375713731801982e-15
SPRG_077951259793351291972e-15
PYU1_G005985820772001351902e-15
PHYCA_19598375713901431982e-15
PHYRA_86751732351631021872e-15
PHYRA_78174188562791811942e-15
PYAP_1871342341841271882e-15
PHYCA_98479819502761061942e-15
PHYSO_324715696932741331933e-15
PPTG_0316097913791321973e-15
PYVX_18175147521471621853e-15
PYIW_2557397812791781933e-15
PHYKE_6077188563221351953e-15
PHYKE_2454751493741311963e-15
PHALS_04411944962621811923e-15
PHYCA_1865738072951081934e-15
PHYKE_744597873691291954e-15
PYVX_2250897752981351925e-15
PHYKE_771752856568421976e-15
PHYSO_525076188573661791937e-15
SPRG_077971259813181261927e-15
PHYRA_84947539132651761897e-15
PHYRA_86241728921951221858e-15
PHYSO_31868397763521271928e-15
PHYKE_1913732362801081908e-15
PPTG_2037625275186881848e-15
H257_1355017302661361899e-15
PPTG_18166242064451081941e-14
PYAP_22462820772101841851e-14
PYAP_222571003612471471871e-14
PYU1_G00151997822651761871e-14
PPTG_03143188573681791902e-14
PYAP_18138991732681241862e-14
PYIW_242881643022011271822e-14
PHYRA_93650463492311131842e-14
PYVX_19277793613311371882e-14
PHYSO_426658554392101791822e-14
PYVX_24563161732541341853e-14
SPRG_199171339462411351843e-14
PHYKE_391242332521221843e-14
PYVX_20783375052761381854e-14
PYVX_21297798802631111844e-14
PHYKE_81047713586561715e-14
PYVX_2251097785961371895e-14
PHYCA_19612188566101801896e-14
PHYSO_25601746435148861756e-14
PHYCA_120062539132121361797e-14
HYAP_1192397766061051887e-14
PHYCA_12331697763161361848e-14
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18173

Length=500
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18173                                                            745        0.0  
PHYCA_537323                                                          270        7e-88
PPTG_17123                                                            268        4e-87
PHYRA_81105                                                           266        3e-86
PITG_18452                                                            273        1e-81
PPTG_17122                                                            244        2e-77
PHYCA_129425                                                          239        7e-76
PHYKE_8389                                                            236        1e-74
PHYRA_81106                                                           235        4e-74
PITG_18450                                                            234        7e-74
PHYSO_284086                                                          233        4e-73
PHYRA_81107                                                           232        5e-73
PHYKE_8388                                                            228        2e-71
PPTG_17121                                                            228        3e-71
PHYSO_477820                                                          226        8e-71
PYVX_18176                                                            226        2e-70
PPTG_10635                                                            224        4e-70
PHYCA_511409                                                          224        8e-70
PHYCA_14369                                                           225        1e-69
PHYKE_7718                                                            223        3e-69
PYU1_G001740                                                          223        3e-69
PHYSO_353401                                                          220        4e-69
PHYCA_102852                                                          221        8e-69
PHYRA_84190                                                           221        1e-68
PYU1_G001739                                                          223        1e-68
PHYSO_341599                                                          220        1e-68
PPTG_10634                                                            221        2e-68
PYU1_G001742                                                          221        2e-68
PYU1_G001741                                                          220        2e-68
PHYRA_85631                                                           221        3e-68
PPTG_10636                                                            221        3e-68
HYAP_07096                                                            221        6e-68
PHYCA_102550                                                          221        7e-68
PHYCA_102624                                                          218        1e-67
PYU1_G001744                                                          219        1e-67
PHYSO_536424                                                          217        3e-67
PHYSO_507031                                                          217        3e-67
PHYRA_82864                                                           216        5e-67
PYIR_25089                                                            217        2e-66
PPTG_10643                                                            215        9e-66
PHALS_00498                                                           212        2e-65
PYIR_26626                                                            212        3e-65
PHYKE_3446                                                            211        6e-65
PPTG_15264                                                            206        5e-63
PPTG_17366                                                            206        5e-63
PPTG_10048                                                            202        1e-61
PYVX_18174                                                            200        9e-61
PYIR_26546                                                            199        1e-59
PHALS_03284                                                           196        2e-59
PPTG_14255                                                            193        4e-57
PYAR_24096                                                            191        1e-56
PYIW_18791                                                            187        6e-56
PYAP_22273                                                            187        5e-55
PPTG_08820                                                            186        1e-54
PHYCA_510817                                                          183        2e-54
PPTG_14254                                                            182        3e-54
PHYSO_499978                                                          181        7e-54
PHYSO_501575                                                          181        7e-54
PYAP_22278                                                            183        4e-53
PYU1_G001738                                                          180        1e-52
PHYKE_9185                                                            181        2e-52
PHYSO_417649                                                          178        2e-52
PYAP_22279                                                            178        5e-52
PHYCA_536934                                                          187        3e-50
PHYSO_343376                                                          170        1e-49
PITG_10499                                                            175        2e-49
PHYSO_262732                                                          167        2e-48
PITG_13520                                                            166        5e-48
PHYSO_527908                                                          165        1e-47
PHYKE_8390                                                            161        8e-47
PHYSO_254168                                                          162        2e-46
PYIW_18788                                                            160        8e-45
PHYSO_341596                                                          150        3e-41
PHYSO_340369                                                          137        1e-36
PHYCA_14368                                                           133        4e-35
PHYSO_246676                                                          121        4e-31
PYAP_18131                                                            121        1e-30
PYIW_18792                                                            107        1e-26
PHALS_06480                                                           103        4e-25
PHYCA_127270                                                          105        1e-24
PHYRA_78689                                                           105        2e-24
PYIR_16435                                                            104        6e-24
PYIR_16444                                                            99.4       4e-23
PHYSO_438103                                                          100        4e-23
PHYSO_340332                                                          102        5e-23
PHYRA_78625                                                           104        5e-23
PHYSO_340333                                                          101        7e-23
PHYRA_78626                                                           104        7e-23
PHYSO_533682                                                          100        8e-23
PYIW_19151                                                            99.8       1e-22
PPTG_04622                                                            100        1e-22
PHYRA_74651                                                           101        2e-22
PYVX_18179                                                            95.9       2e-22
PYIR_16443                                                            99.8       2e-22
PPTG_14221                                                            99.4       3e-22
PYIW_27477                                                            96.3       4e-22
PHYSO_342364                                                          97.1       4e-22
PHYSO_533903                                                          97.4       4e-22
PHYCA_130365                                                          97.1       1e-21
PYAP_18709                                                            96.3       2e-21
PYU1_G014690                                                          97.4       2e-21
PITG_04949                                                            98.2       2e-21
PITG_05271                                                            96.7       3e-21
PYU1_G007476                                                          94.4       3e-21
PHYCA_534296                                                          97.1       3e-21
PHYCA_12942                                                           95.9       2e-20
PYVX_14662                                                            97.4       2e-20
PHYRA_73607                                                           95.1       2e-20
PHYKE_6002                                                            91.7       2e-20
PHYSO_485524                                                          94.0       2e-20
PYU1_G005323                                                          93.2       3e-20
PYAR_14256                                                            91.3       4e-20
PPTG_04618                                                            94.0       4e-20
PHYSO_483955                                                          94.0       5e-20
PHYKE_3913                                                            93.6       7e-20
PITG_04948                                                            91.3       8e-20
PHYKE_10578                                                           90.9       1e-19
PHYRA_79140                                                           93.2       2e-19
PHYCA_534473                                                          94.7       3e-19
PHYKE_2809                                                            90.9       3e-19
PHYKE_6001                                                            90.9       3e-19
PYIR_19612                                                            90.1       4e-19
PHALS_03176                                                           88.2       5e-19
PYAP_18711                                                            88.6       5e-19
PITG_11936                                                            90.9       5e-19
PHYRA_86016                                                           89.0       5e-19
PPTG_04619                                                            89.7       6e-19
PHYRA_73582                                                           90.5       7e-19
PHYRA_73584                                                           89.7       8e-19
PHYRA_83500                                                           91.3       8e-19
PHYKE_2937                                                            90.5       1e-18
PHYSO_533747                                                          87.4       1e-18
PPTG_04647                                                            89.7       1e-18
PHYRA_73606                                                           90.5       1e-18
PHYSO_484051                                                          89.0       1e-18
PYU1_G005324                                                          86.7       1e-18
PYU1_G005326                                                          86.7       1e-18
PYU1_G005328                                                          86.7       1e-18
PYIW_16810                                                            87.0       2e-18
PHYRA_86752                                                           89.0       2e-18
PYAR_14260                                                            87.0       2e-18
CCI47381                                                              86.7       2e-18
PHALS_05392                                                           89.4       3e-18
CCA17179                                                              85.5       3e-18
PYU1_G005325                                                          85.9       3e-18
PYAR_24113                                                            85.5       4e-18
PPTG_03139                                                            88.2       4e-18
PYAP_24689                                                            86.7       5e-18
PHYKE_6078                                                            87.4       6e-18
PHYSO_459106                                                          85.5       6e-18
PHYSO_524101                                                          87.4       7e-18
PHALS_03177                                                           86.3       8e-18
PHYRA_78176                                                           87.0       8e-18
PHYRA_73583                                                           89.7       8e-18
PPTG_07507                                                            86.7       9e-18
PPTG_07509                                                            86.7       9e-18
PHYCA_97965                                                           86.3       1e-17
PHYRA_83494                                                           84.7       1e-17
PPTG_03156                                                            88.2       1e-17
PHYCA_12943                                                           86.3       1e-17
PHYRA_85794                                                           84.7       1e-17
PHYRA_77971                                                           84.7       1e-17
PHYCA_531163                                                          86.3       2e-17
PHYCA_19611                                                           88.2       2e-17
PHALS_03179                                                           86.7       2e-17
PPTG_03153                                                            85.9       3e-17
PHYRA_78175                                                           85.9       3e-17
PITG_04947                                                            85.1       3e-17
PYIW_18790                                                            79.0       4e-17
PPTG_03138                                                            84.7       4e-17
PYAR_20617                                                            84.0       4e-17
SDRG_16535                                                            84.7       6e-17
PHYKE_6079                                                            84.3       7e-17
PHYRA_80750                                                           83.6       7e-17
PHYSO_246481                                                          84.3       7e-17
PITG_08202                                                            81.6       9e-17
PYVX_16138                                                            86.3       9e-17
H257_11264                                                            83.6       1e-16
PHYCA_69583                                                           82.0       1e-16
PYIR_23585                                                            82.4       1e-16
PYU1_G007364                                                          83.6       1e-16
PHYSO_255056                                                          82.8       1e-16
PHYRA_83499                                                           85.1       1e-16
PHALS_05394                                                           82.8       2e-16
PYIW_15526                                                            82.0       2e-16
H310_05432                                                            82.8       2e-16
H310_06362                                                            80.5       2e-16
H257_11265                                                            82.0       3e-16
PYIW_21964                                                            81.3       4e-16
SPRG_07796                                                            82.4       4e-16
PPTG_04620                                                            82.4       5e-16
PYIR_22134                                                            81.6       5e-16
PYIW_24289                                                            79.0       6e-16
SDRG_16534                                                            81.6       7e-16
PHYKE_5749                                                            80.9       8e-16
PYAP_18221                                                            79.3       8e-16
PPTG_07516                                                            80.5       1e-15
PHYKE_6076                                                            80.1       1e-15
PPTG_07520                                                            80.5       1e-15
PHYCA_112615                                                          78.2       1e-15
PITG_11937                                                            80.1       2e-15
PHYRA_78161                                                           80.9       2e-15
SPRG_07795                                                            80.5       2e-15
PYU1_G005985                                                          77.8       2e-15
PHYCA_19598                                                           80.9       2e-15
PHYRA_86751                                                           76.6       2e-15
PHYRA_78174                                                           79.3       2e-15
PYAP_18713                                                            77.0       2e-15
PHYCA_98479                                                           79.3       2e-15
PHYSO_324715                                                          79.0       3e-15
PPTG_03160                                                            80.5       3e-15
PYVX_18175                                                            75.9       3e-15
PYIW_25573                                                            79.0       3e-15
PHYKE_6077                                                            79.7       3e-15
PHYKE_2454                                                            80.1       3e-15
PHALS_04411                                                           78.6       3e-15
PHYCA_18657                                                           79.0       4e-15
PHYKE_7445                                                            79.7       4e-15
PYVX_22508                                                            78.6       5e-15
PHYKE_7717                                                            80.5       6e-15
PHYSO_525076                                                          79.0       7e-15
SPRG_07797                                                            78.6       7e-15
PHYRA_84947                                                           77.4       7e-15
PHYRA_86241                                                           75.9       8e-15
PHYSO_318683                                                          78.6       8e-15
PHYKE_1913                                                            77.8       8e-15
PPTG_20376                                                            75.5       8e-15
H257_13550                                                            77.4       9e-15
PPTG_18166                                                            79.3       1e-14
PYAP_22462                                                            75.9       1e-14
PYAP_22257                                                            76.6       1e-14
PYU1_G001519                                                          76.6       1e-14
PPTG_03143                                                            77.8       2e-14
PYAP_18138                                                            76.3       2e-14
PYIW_24288                                                            74.7       2e-14
PHYRA_93650                                                           75.5       2e-14
PYVX_19277                                                            77.0       2e-14
PHYSO_426658                                                          74.7       2e-14
PYVX_24563                                                            75.9       3e-14
SPRG_19917                                                            75.5       3e-14
PHYKE_3912                                                            75.5       3e-14
PYVX_20783                                                            75.9       4e-14
PYVX_21297                                                            75.5       4e-14
PHYKE_8104                                                            70.5       5e-14
PYVX_22510                                                            77.4       5e-14
PHYCA_19612                                                           77.4       6e-14
PHYSO_256017                                                          72.0       6e-14
PHYCA_120062                                                          73.6       7e-14
HYAP_11923                                                            77.0       7e-14
PHYCA_123316                                                          75.5       8e-14
PYU1_G005873                                                          73.6       8e-14
SDRG_07565                                                            74.7       8e-14
PPTG_07521                                                            74.7       8e-14
PHYCA_132255                                                          70.9       9e-14
PPTG_03140                                                            75.5       1e-13
PYU1_G005866                                                          72.8       1e-13
PYIR_25571                                                            74.7       1e-13
SDRG_08129                                                            73.2       1e-13
PYU1_G005868                                                          73.9       1e-13
PYAR_15391                                                            71.6       1e-13
PYU1_G005872                                                          74.3       2e-13
SDRG_17318                                                            73.2       2e-13
PHYCA_103479                                                          74.3       2e-13
PYIR_25999                                                            74.7       2e-13
PHYCA_14560                                                           73.9       2e-13
PITG_19818                                                            70.5       2e-13
PYIR_20481                                                            73.6       2e-13
PYU1_G007250                                                          71.2       2e-13
PYAR_24818                                                            71.6       2e-13
PHYSO_262844                                                          73.6       2e-13
PYU1_G005871                                                          73.6       2e-13
SDRG_08137                                                            73.6       2e-13
PYU1_G007242                                                          72.8       3e-13
PYIR_15187                                                            71.2       3e-13
PPTG_10073                                                            70.9       4e-13
PYAP_23672                                                            72.4       4e-13
PYU1_G005867                                                          70.9       4e-13
PHALS_01293                                                           73.6       4e-13
PHALS_10635                                                           72.8       4e-13
PHYSO_329293                                                          72.8       5e-13
PHYSO_488921                                                          72.8       5e-13
PYAP_19707                                                            71.6       5e-13
PHYRA_73581                                                           72.4       6e-13
PHYRA_77293                                                           72.4       7e-13
PHYKE_10295                                                           72.0       8e-13
SPRG_22161                                                            72.0       8e-13
PHYCA_12944                                                           69.3       8e-13
PYAP_24691                                                            68.6       9e-13
HYAP_01683                                                            72.4       9e-13
SDRG_00972                                                            72.4       9e-13
SPRG_07627                                                            73.6       9e-13
SPRG_07826                                                            72.8       9e-13
SPRG_07799                                                            72.4       1e-12
PYIR_24743                                                            72.4       1e-12
PYAP_18226                                                            70.5       1e-12
PYAR_16493                                                            70.9       1e-12
SDRG_08782                                                            72.8       1e-12
H310_05433                                                            72.0       1e-12
PYAP_19712                                                            70.9       1e-12
PHYRA_87941                                                           68.2       1e-12
SDRG_15426                                                            72.8       2e-12
PHYRA_86151                                                           68.6       2e-12
SDRG_17317                                                            67.0       2e-12
PHYSO_375794                                                          67.0       2e-12
PYIR_24421                                                            69.3       2e-12
PHYRA_78172                                                           71.6       2e-12
PPTG_04803                                                            70.5       2e-12
SPRG_07825                                                            71.2       2e-12
H257_11271                                                            71.2       3e-12
PHYRA_78177                                                           70.9       3e-12
PPTG_01148                                                            70.5       3e-12
PHYRA_78165                                                           70.5       3e-12
PHALS_02044                                                           69.3       3e-12
PHYCA_10471                                                           70.1       4e-12
PYIR_22549                                                            69.3       4e-12
SDRG_00948                                                            70.5       4e-12
PYU1_G005869                                                          69.3       4e-12
SPRG_19916                                                            70.1       4e-12
PYVX_20789                                                            69.7       5e-12
PYU1_G001528                                                          69.3       5e-12
PHYCA_122958                                                          68.9       6e-12
PHYSO_374518                                                          65.5       6e-12
PYIW_25463                                                            67.8       6e-12
PYU1_G007254                                                          67.4       7e-12
PHYSO_525490                                                          70.1       7e-12
PPTG_04617                                                            70.5       7e-12
PHYRA_78162                                                           70.5       7e-12
PHYKE_2379                                                            68.9       7e-12
PHYRA_77290                                                           69.3       7e-12
PHYSO_318693                                                          70.1       8e-12
PYIW_18065                                                            68.9       8e-12
PHYRA_78169                                                           69.7       8e-12
PHYKE_7443                                                            69.3       9e-12
PYAR_25093                                                            67.0       9e-12
PYIR_25001                                                            67.0       1e-11
PPTG_04801                                                            68.2       1e-11
PHYSO_255975                                                          66.6       1e-11
PYAP_14265                                                            68.6       1e-11
PYIR_23622                                                            67.8       1e-11
PHYSO_337515                                                          68.9       1e-11
PYVX_22511                                                            68.6       1e-11
PHYRA_84732                                                           67.8       1e-11
PYAP_16338                                                            68.2       1e-11
PYU1_G001514                                                          69.7       1e-11
PPTG_03145                                                            68.2       2e-11
PYIR_20482                                                            65.1       2e-11
PITG_11951                                                            65.5       2e-11
PYAR_18165                                                            67.4       2e-11
PYAP_23673                                                            68.2       2e-11
PHYSO_374025                                                          67.8       2e-11
PPTG_09880                                                            65.9       2e-11
PYIR_17978                                                            67.0       2e-11
PYU1_G001527                                                          67.4       2e-11
PYU1_G001523                                                          67.4       2e-11
PHYSO_476077                                                          67.0       3e-11
PHYSO_472009                                                          67.0       3e-11
PYIR_20483                                                            67.4       3e-11
PHYKE_10296                                                           68.6       3e-11
PITG_01966                                                            67.4       3e-11
PHYRA_78167                                                           67.0       3e-11
PHYKE_6069                                                            67.0       3e-11
PYAR_21940                                                            66.6       3e-11
PHYCA_123476                                                          67.0       4e-11
PITG_11942                                                            66.6       4e-11
HYAP_14170                                                            66.6       4e-11
PHALS_05110                                                           65.1       4e-11
PPTG_03147                                                            66.6       4e-11
PPTG_10186                                                            66.2       5e-11
PHYCA_19608                                                           66.6       5e-11
PHYCA_15126                                                           67.0       5e-11
PYAP_18584                                                            65.1       5e-11
PITG_08892                                                            66.6       5e-11
PYU1_G001520                                                          67.4       6e-11
PHYCA_562062                                                          65.5       6e-11
PPTG_01153                                                            66.6       6e-11
PHYRA_80632                                                           66.6       6e-11
PHYKE_2539                                                            65.9       7e-11
PHYCA_6388                                                            66.2       7e-11
PHYKE_9024                                                            66.2       7e-11
PPTG_03144                                                            66.2       8e-11
PYIR_16375                                                            65.5       8e-11
SPRG_04679                                                            64.7       8e-11
PYIR_25334                                                            65.5       8e-11
PPTG_03161                                                            67.0       8e-11
PYU1_G001525                                                          65.9       9e-11
PYAR_15390                                                            63.9       1e-10
PYVX_21438                                                            65.5       1e-10
PYVX_21643                                                            65.1       1e-10
PYU1_G001526                                                          66.2       1e-10
PPTG_06106                                                            65.1       1e-10
H257_11258                                                            66.2       1e-10
PYIR_14463                                                            66.2       1e-10
PYIW_24287                                                            65.9       1e-10
PPTG_03148                                                            65.5       1e-10
PPTG_06256                                                            65.9       1e-10
PHALS_08575                                                           65.5       1e-10
PHYSO_454780                                                          63.5       1e-10
PYIR_26867                                                            62.8       1e-10
PYU1_G001524                                                          65.5       1e-10
PHALS_02041                                                           65.1       1e-10
PPTG_06249                                                            65.5       1e-10
PITG_11944                                                            65.5       1e-10
PHYCA_18729                                                           65.9       2e-10
PHYCA_558591                                                          61.2       2e-10
PYVX_22512                                                            63.9       2e-10
PPTG_18176                                                            64.3       2e-10
PITG_11957                                                            65.1       2e-10
PYAR_17166                                                            60.8       2e-10
PHYCA_15125                                                           65.1       2e-10
PPTG_07511                                                            62.8       2e-10
PYAP_23455                                                            65.5       2e-10
PHYRA_80631                                                           64.7       3e-10
PITG_20631                                                            63.9       3e-10
PITG_20312                                                            63.9       3e-10
PPTG_06253                                                            64.3       3e-10
PHYSO_488139                                                          63.9       3e-10
PHYCA_15124                                                           63.9       3e-10
PYIW_19601                                                            63.2       4e-10
PYVX_16673                                                            65.5       4e-10
SDRG_17448                                                            63.2       5e-10
PYIR_16437                                                            63.2       6e-10
PHYCA_552912                                                          64.3       6e-10
PYVX_21174                                                            58.9       6e-10
PHYKE_9023                                                            63.2       7e-10
PYIR_22133                                                            63.9       7e-10
PYAR_17163                                                            59.3       9e-10
PYAR_17307                                                            62.0       1e-09
PHALS_05395                                                           60.5       1e-09
PITG_08895                                                            60.8       1e-09
PHYKE_7446                                                            63.2       1e-09
PYIW_18794                                                            61.6       1e-09
PITG_11943                                                            60.1       2e-09
PHYRA_77291                                                           61.6       2e-09
PYIR_22634                                                            61.6       2e-09
PYAP_16994                                                            61.2       2e-09
PYIR_23689                                                            60.5       2e-09
PYU1_G001516                                                          61.6       2e-09
PYIW_15528                                                            61.6       3e-09
PYIW_16208                                                            60.8       3e-09
PHYKE_6066                                                            60.8       4e-09
PHYRA_79881                                                           60.5       4e-09
PYAP_20077                                                            60.1       4e-09
PHYRA_86201                                                           60.5       5e-09
PYAR_14261                                                            57.8       5e-09
PYAR_21271                                                            59.7       5e-09
PYIW_14247                                                            60.1       5e-09
PYU1_G001475                                                          60.1       5e-09
PYAP_24338                                                            60.1       6e-09
PYIW_21963                                                            60.8       6e-09
PYU1_G003057                                                          59.3       6e-09
PHYSO_525121                                                          59.3       6e-09
PHYCA_10470                                                           60.1       6e-09
PYU1_G006404                                                          60.1       7e-09
PYAP_16351                                                            59.7       9e-09
PYAP_16347                                                            58.2       1e-08
PYU1_G001517                                                          59.7       1e-08
PYAR_25949                                                            57.8       1e-08
H310_05438                                                            59.7       1e-08
PHYRA_75781                                                           58.5       1e-08
PHYKE_9025                                                            59.3       1e-08
PHYCA_19599                                                           59.3       2e-08
PYIR_26312                                                            55.8       2e-08
PYIR_20304                                                            57.4       2e-08
PYAR_13902                                                            56.2       2e-08
PYAR_15784                                                            57.0       2e-08
PYU1_G005878                                                          53.5       2e-08
PHYRA_78164                                                           58.5       3e-08
PPTG_13879                                                            58.5       3e-08
PYU1_G006672                                                          53.1       3e-08
PHYSO_339832                                                          57.8       3e-08
PYIW_26657                                                            55.5       3e-08
PYAR_23090                                                            55.5       3e-08
PYAP_25026                                                            57.4       3e-08
PYIR_24867                                                            58.2       3e-08
PYVX_23997                                                            56.2       4e-08
PHYRA_78168                                                           57.8       4e-08
PYIW_26655                                                            57.4       4e-08
PHYRA_95184                                                           58.9       5e-08
PYAP_16337                                                            57.0       6e-08
HYAP_01682                                                            57.4       7e-08
PYU1_G006405                                                          57.0       9e-08
PYIR_22136                                                            57.0       9e-08
PYIW_17867                                                            57.0       9e-08
PHYRA_77292                                                           55.1       1e-07
PITG_04404                                                            55.5       1e-07
PHALS_02037                                                           57.0       1e-07
PITG_21641                                                            57.0       1e-07
PYVX_21644                                                            55.1       1e-07
H257_11306                                                            57.0       1e-07
PYVX_24774                                                            55.1       1e-07
PHYCA_559281                                                          53.9       1e-07
PYAR_22058                                                            54.7       1e-07
PPTG_22744                                                            53.9       2e-07
PHALS_02295                                                           56.2       2e-07
PHYCA_14559                                                           55.5       2e-07
PYU1_G006403                                                          55.1       2e-07
PPTG_01147                                                            55.5       2e-07
PHYCA_538650                                                          55.5       2e-07
PPTG_01152                                                            55.1       2e-07
PHYCA_97699                                                           54.7       3e-07

>PYVX_18173
Length=500

 Score = 745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/500 (100%), Positives = 500/500 (100%), Gaps = 0/500 (0%)

Query  1    MRSSPLasaalgvalasagavELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA  60
            MRSSPLASAALGVALASAGAVELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA
Sbjct  1    MRSSPLASAALGVALASAGAVELCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVA  60

Query  61   YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN  120
            YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN
Sbjct  61   YLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN  120

Query  121  GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY  180
            GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY
Sbjct  121  GSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKY  180

Query  181  QGERYSWQVFKNCINLSASALVTMIGLQHprsalpalalaaaafvatnapqaMAHQLVIL  240
            QGERYSWQVFKNCINLSASALVTMIGLQHPRSALPALALAAAAFVATNAPQAMAHQLVIL
Sbjct  181  QGERYSWQVFKNCINLSASALVTMIGLQHPRSALPALALAAAAFVATNAPQAMAHQLVIL  240

Query  241  PAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASAD  300
            PAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASAD
Sbjct  241  PAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASAD  300

Query  301  FRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS  360
            FRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS
Sbjct  301  FRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS  360

Query  361  ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIsdgsaaassedsasgeVEETaapsvgs  420
            ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISDGSAAASSEDSASGEVEETAAPSVGS
Sbjct  361  ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISDGSAAASSEDSASGEVEETAAPSVGS  420

Query  421  sssdaasvggeadetspsssgsdasvggeadeeaagsadaetsapgssateapspstaep  480
            SSSDAASVGGEADETSPSSSGSDASVGGEADEEAAGSADAETSAPGSSATEAPSPSTAEP
Sbjct  421  SSSDAASVGGEADETSPSSSGSDASVGGEADEEAAGSADAETSAPGSSATEAPSPSTAEP  480

Query  481  eesdetssGTTPSKCRAKSA  500
            EESDETSSGTTPSKCRAKSA
Sbjct  481  EESDETSSGTTPSKCRAKSA  500

>PHYCA_537323
Length=200

 Score = 270 bits (691),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 147/175 (84%), Gaps = 0/175 (0%)

Query  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
             QRRLD+GLGEGQVV +PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +L
Sbjct  24   GQRRLDAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSL  83

Query  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
            RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   A
Sbjct  84   RAMLDDESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSA  143

Query  146  GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            GRNCHTEFP+G H +DYS CGESC +SW+WLGIKY    YSWQV+KNC+ L  +A
Sbjct  144  GRNCHTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGTAA  198

 Score = 160 bits (404),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 1/159 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V  P P + V+G D +   LA+L+ Q  +T+ +   +++ +G+ SLRA +DD+SLY V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
               A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            + +DYS+C  SCTL WYWLG++Y++ +YSWQVYK CV +
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194

>PPTG_17123
Length=201

 Score = 268 bits (686),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 147/174 (84%), Gaps = 0/174 (0%)

Query  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
             QRRLD+GLGEGQVVL+PPPFFVVDG+D++G  +AYL++QGV+T+IEAQ+W+ + GY +L
Sbjct  25   GQRRLDAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSL  84

Query  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
            RA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCE+W+D+T   +
Sbjct  85   RAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSS  144

Query  146  GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            GRNCHTEFP G H +DYS CG++C +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  145  GRNCHTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLSTA  198

 Score = 161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 105/159 (66%), Gaps = 1/159 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
               A F CG T P    QPIP +   +++GYT DGPCEVWLDDT+V    NCH       
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +++DYS+C  +CTL WYWLG++Y++ +YSWQVYK CV +
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195

>PHYRA_81105
Length=201

 Score = 266 bits (680),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 144/175 (82%), Gaps = 0/175 (0%)

Query  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
             QRRLD+GLGEGQ+VL+PPPFF+VDG+D++G  +AYL++QGV+T+IEAQ W+ + GYA+L
Sbjct  25   GQRRLDAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASL  84

Query  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
            R+++DD+ LY VTEE +FDCGLT P TETQ IPTN SF +SGYTLDGPCE+W+D+T A A
Sbjct  85   RSMLDDESLYQVTEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAA  144

Query  146  GRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            GRNCHTEFP G H IDYS CG +C + W+WLGIKY    YSWQV+KNCI L   A
Sbjct  145  GRNCHTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKEA  199

 Score = 155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G++  +G+ SLR+ +DD+SLY V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
               A F CG T P    Q IP +   +S+GYT DGPCEVWLDDT+     NCH       
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            + +DYSAC  +C L WYWLG++Y++  YSWQVYK C+ +
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195

>PITG_18452
Length=856

 Score = 273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 150/177 (85%), Gaps = 1/177 (1%)

Query  24   CFA-QRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGY  82
            C A QRRLD+GLGEGQ+VL+PPPFFVVDG+D++G  +AYL++QG++T+IEAQ+W+ ++GY
Sbjct  677  CVAGQRRLDAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGY  736

Query  83   ATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTL  142
            ++LRA++DD+ LY VTEE +F+CGLT P TETQPIPTN SF TSGYTLDGPCEIW+D+T 
Sbjct  737  SSLRAMLDDESLYKVTEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTK  796

Query  143  ALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
              +GRNCHTEFP G H +DYS CG SC +SW+WLGIKY    YSWQV+KNC+ LS +
Sbjct  797  VASGRNCHTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853

 Score = 162 bits (411),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 1/157 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +   ++   G+ SLRA +DD+SLY V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT  354
               A F CG T P    QPIP +   +++GYT DGPCE+WLDDT+V    NCH       
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  355  YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
            + +DYS+C GSC L WYWLG++Y++ +YSWQVYK CV
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCV  848

>PPTG_17122
Length=204

 Score = 244 bits (622),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 129/160 (81%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q + T +DF G+   NG+ +LR FMD  + Y
Sbjct  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD+ CGFT+ +AAPQPIPDG MRSTGYTHDGPCEVWLD  RVLQ DNCHE ISGK
Sbjct  86   TVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            TY+LDYS+C G+CTL WYWLGVRYLK  YSWQ+YKAC+P+
Sbjct  146  TYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPL  185

 Score = 148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 95/163 (58%), Gaps = 2/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLR  MD    Y+V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   + CG T  N   QPIP +G+  ++GYT DGPCE+W+D    L   NCH       
Sbjct  88   TDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKT  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + +DYS C  +C + W+WLG++Y    YSWQ++K CI LSASA
Sbjct  147  YNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASA  189

>PHYCA_129425
Length=204

 Score = 239 bits (611),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T +DF G+  +NG+ +LRAFMD  + Y
Sbjct  27   AHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD+ CGFT+  AAPQPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE   GK
Sbjct  86   TVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            TY+LDYS+C GSC L WYWLG R+LK  +SWQVYKAC+P+
Sbjct  146  TYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185

 Score = 152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 98/163 (60%), Gaps = 2/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  29   QVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   + CG T      QPIP +G+  ++GYT DGPCE+W+D+T  L   NCH  FP   
Sbjct  88   TDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKT  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + +DYS C  SC + W+WLG ++    +SWQV+K CI LS+SA
Sbjct  147  YNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSSSA  189

>PHYKE_8389
Length=204

 Score = 236 bits (603),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 126/161 (78%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T DDF  +   NG+ +LRAFMD  + Y
Sbjct  26   AHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKY  84

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   AD+ CGFT+ DAAPQ IP G  MRSTGYTHDGPCEVWLD TRVL HDNCHE ISG
Sbjct  85   TVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  144

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKACVP+
Sbjct  145  KDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

 Score = 153 bits (387),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 96/163 (59%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  28   QVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYTV  86

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   + CG T  +   Q IP+  +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  87   TDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + W+WLG+++    YSWQV+K C+ LSASA
Sbjct  147  YTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASA  189

>PHYRA_81106
Length=202

 Score = 235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 127/161 (79%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + KD ++ PLAFLE Q F T  DF  +  +NG+ +LRAFMD  + Y
Sbjct  27   AHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   AD+ CGFT+ DA PQ IPDG  MRSTGYTHDGPCEVWLD TRVL HDNCHE ISG
Sbjct  86   TVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL+WYW+GVRYLK  YSWQVYKACVP+
Sbjct  146  KDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186

 Score = 149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 94/163 (58%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  29   QVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             +   + CG T  +   Q IP   +  ++GYT DGPCE+W+D T  L   NCH       
Sbjct  88   ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + W+W+G++Y    YSWQV+K C+ LSASA
Sbjct  148  YTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASA  190

>PITG_18450
Length=203

 Score = 234 bits (598),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 127/160 (79%), Gaps = 4/160 (3%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP+PTYT + KD ++ PL FLEGQ + T +DF G+   NG+ +LR FM+    Y
Sbjct  27   AHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----Y  82

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD+ CGFT+ +AAPQP PDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE I GK
Sbjct  83   TVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            TY+LDYS+C G+CTL WYWLGVR+LK  YSWQ+YKAC+P+
Sbjct  143  TYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPL  182

 Score = 138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 94/163 (58%), Gaps = 5/163 (3%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+ +LE QG  T  +   W    GY TLR  M+    Y+V
Sbjct  29   QVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             +   + CG T  N   QP P +G+  ++GYT DGPCE+W+D+T  L   NCH       
Sbjct  85   ADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKT  143

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + +DYS C  +C + W+WLG+++    YSWQ++K CI LSASA
Sbjct  144  YNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASA  186

>PHYSO_284086
Length=204

 Score = 233 bits (593),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 123/160 (77%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + K  ++ PLAFLE Q + T +DF  +    G+ +LRAFMD  S Y
Sbjct  27   AHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-Y  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD+ CGFTD     QPIPDG MRSTGYTHDGPCEVWLD TRVLQ DNCHE  SGK
Sbjct  86   TVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            TYDLDYS+C GSCTL WYWLGVR+LK  YSWQVYKACVP+
Sbjct  146  TYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

 Score = 146 bits (368),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 96/163 (59%), Gaps = 2/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D    + +P+A+LE QG  T  +   W  ++GY TLRA MD    Y+V
Sbjct  29   QVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             +   + CG T      QPIP +G+  ++GYT DGPCE+W+D T  L   NCH  F    
Sbjct  88   ADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKT  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + +DYS C  SC + W+WLG+++    YSWQV+K C+ LS SA
Sbjct  147  YDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLSTSA  189

>PHYRA_81107
Length=202

 Score = 232 bits (592),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 128/161 (80%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + K  ++ PLAFLE Q FST +DF  + + NG+DSLRAF DD + Y
Sbjct  24   AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGASY  82

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V+  ADF CGFTD +   Q IPDG  MRSTGYTHDGPCEVWLDDT V+Q+DNCHEVISG
Sbjct  83   TVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISG  142

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +CTLYW+W+GVRYL   YSWQVYKACVP+
Sbjct  143  KDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPL  183

 Score = 152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D    + +P+A+LE QG  T  +   W  E GY +LRA  DD   Y+V
Sbjct  26   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGASYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            ++   F CG T  N + Q IP   +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  85   SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKD  144

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + WFW+G++Y    YSWQV+K C+ LSASA
Sbjct  145  YTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASA  187

>PHYKE_8388
Length=205

 Score = 228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP+PTYT + K  ++ PLAFLE Q FST +DF  +   NG+ SLRAF +DD+ Y
Sbjct  27   AHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAF-NDDASY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V+  ADF CGFTD + A QPIPD   MRSTGYTHDGPCEVWLDDT V+Q++NCH+ ISG
Sbjct  86   TVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +CTLYW+W+GVRYLK  YSWQVYKACVP+
Sbjct  146  KDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPL  186

 Score = 159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D    + +P+A+LE QG  T  +   W ++ GYA+LRA  +DD  Y+V
Sbjct  29   QVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAF-NDDASYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            ++   F CG T  N   QPIP + +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  88   SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + WFW+G++Y    YSWQV+K C+ LSASA
Sbjct  148  YTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASA  190

>PPTG_17121
Length=202

 Score = 228 bits (580),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 127/161 (79%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+L APTYT + KD ++ PLAFLE Q F+T +DF  +   NG+DSLRAF +D + Y
Sbjct  24   AHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAF-NDGASY  82

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V+  AD  CGFT+ +   QPIPDG  MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  83   TVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  142

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  143  KYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

 Score = 150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL   P +  D  D + +P+A+LE QG  T  +   W  + GY +LRA  +D   Y+V
Sbjct  26   QVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAF-NDGASYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            ++     CG T  N + QPIP   +  ++GYT DGPCE+W+D+T+ +   NCH      +
Sbjct  85   SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKY  144

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LS SA
Sbjct  145  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PHYSO_477820
Length=202

 Score = 226 bits (577),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + K  ++ PLAFLE Q F+T +DF  +   NG+DSLRAF +D + Y
Sbjct  24   AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDGASY  82

Query  294  SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CGFT+ +   QPIPD   MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  83   TVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISG  142

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  143  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

 Score = 155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 99/166 (60%), Gaps = 1/166 (1%)

Query  35   GEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGL  94
            G  QVVL P P +  D    + +P+A+LE QG  T  +   W  + GY +LRA  +D   
Sbjct  23   GAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDGAS  81

Query  95   YSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
            Y+V +   F CG T  N E QPIP + +  ++GYT DGPCE+W+D+T+ +   NCH    
Sbjct  82   YTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  155  EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
               +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LS SA
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSTSA  187

>PYVX_18176
Length=201

 Score = 226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 123/160 (77%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILPAPT+  + KD  + PLAFLE Q FST +DF  +   NG+DSLRAFMD  S Y
Sbjct  24   AHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-Y  82

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD  CG+T+ D   Q +PDG+MRSTGYTH GPCEVWLDDT VLQ+DNCH+ ISGK
Sbjct  83   TVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  142

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            TYDLDYS+C  +CTLYW+W+GVRYL   YSWQVYK CVP+
Sbjct  143  TYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPL  182

 Score = 138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 2/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P +  D  D   +P+A+LE QG  T  +   W ++ GY +LRA MD    Y+V
Sbjct  26   QYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDG-ASYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+     CG T  +   Q +P +G   ++GYT  GPCE+W+D+T+ L   NCH       
Sbjct  85   TDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKT  143

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + +DYS C  +C + WFW+G++Y    YSWQV+KNC+ LSASA
Sbjct  144  YDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASA  186

>PPTG_10635
Length=199

 Score = 224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 119/161 (74%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE Q F T +DF  + D NG+ SLR FMD  + Y
Sbjct  10   AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR-AKY  68

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  69   EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  128

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C GSCTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  129  KDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  169

 Score = 160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 100/163 (61%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  D + +P+A+LE QG  T  + ++W  E GY +LR  MD    Y V
Sbjct  12   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR-AKYEV  70

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +T+DYS C  SC + W+WLG+++    YSWQV+K CI L+  A
Sbjct  131  YTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTGGA  173

>PHYCA_511409
Length=204

 Score = 224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAPTYT + K  ++ PLAFLE Q F+T +DF  +   NG+DSLRAF +D + Y
Sbjct  26   AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDGASY  84

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V+  ADF CGFT+ +   Q IPD   MRSTGYTHDGPCEVWLDDT V+Q+DNCHE ISG
Sbjct  85   TVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISG  144

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +CTLYW+WLGVRYLK  YSWQ+YKACVP+
Sbjct  145  KDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  185

 Score = 150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D    + +P+A+LE QG  T  +   W  + GY +LRA  +D   Y+V
Sbjct  28   QVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDGASYTV  86

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            ++   F CG T  N + Q IP   +  ++GYT DGPCE+W+D+T+ +   NCH       
Sbjct  87   SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKD  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + WFWLG++Y    YSWQ++K C+ LSASA
Sbjct  147  YTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASA  189

>PHYCA_14369
Length=248

 Score = 225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 118/161 (73%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE Q F T  DF  + + NG+ SLR FMD  + Y
Sbjct  27   AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  86   TVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  186

 Score = 159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 99/163 (61%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  D + +P+A+LE QG  T  +   W  E GY +LR  MD    Y+V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  88   TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +T+DYS C  +C + W+WLG+++    YSWQV+K CI L+ S 
Sbjct  148  YTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSG  190

>PHYKE_7718
Length=220

 Score = 223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP PT+T + KD ++ PLAFLEG+ F+  +DF  +   NG+ SLR FMD+ + Y
Sbjct  31   AHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKY  89

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            SV + AD  CGFTDP+  PQPIP+G  MRSTGYTHDGPCEVW+DDT  + +DNCHE   G
Sbjct  90   SVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPG  149

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYSAC G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  150  KDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

 Score = 156 bits (394),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 1/162 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  D + +P+A+LE +G     +   W  E GY +LR  MD+   YSV
Sbjct  33   QIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYSV  91

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T      CG T PN   QPIP   +  ++GYT DGPCE+WID+TLA+   NCH  FP   
Sbjct  92   TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKD  151

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            +TIDYS C  +C + W+WLG+++    YSWQV+K CI L+ S
Sbjct  152  YTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGS  193

>PYU1_G001740
Length=206

 Score = 223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQLVILP PT+TV  KD RW PLAFLE Q + TT DF  Y  + G+ SLRAFMDD   Y
Sbjct  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
             VN++ADF CG+T+ + A QPIP    R+TGYTHDGPCEVWLD+T+VL   NCH+   GK
Sbjct  87   KVNSNADFECGYTNKNGARQPIPANF-RTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGK  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            T+ + Y+AC GSCTL WYW+G+R+LK  +SWQVYK CVP+
Sbjct  146  THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

 Score = 166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 2/166 (1%)

Query  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
            DS     Q+V+ P P F V   D R SP+A+LE QG  T  +   +   +GY +LRA MD
Sbjct  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81

Query  91   DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
            D   Y V     F+CG T  N   QPIP N  F T+GYT DGPCE+W+DNT  L+G NCH
Sbjct  82   DKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  139

Query  151  TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             +FP   H + Y+ C  SC + W+W+GI++   ++SWQV+K C+ L
Sbjct  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PHYSO_353401
Length=146

 Score = 220 bits (560),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)

Query  59   VAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP  118
            +AYL++QGV+T+IEAQ+W+ E GYA+LRA++DD+ LY VTEE LFDCGLT P TETQPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  119  TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGI  178
            +N SF TSGYTLDGPCE+W+D+T   AGRNCHT+FP G H IDYS CG+SC + W+WLGI
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  179  KYQGERYSWQVFKNCINLSASA  200
            KY    YSWQV+KNC+ LS +A
Sbjct  123  KYVEGAYSWQVYKNCVALSKTA  144

 Score = 150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 93/138 (67%), Gaps = 1/138 (1%)

Query  257  LAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP  316
            LA+L+ Q  +T+ +   ++  +G+ SLRA +DD+SLY V   A F CG T P    QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  317  -DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGV  375
             +   +++GYT DGPCEVWLDDT+V    NCH       +++DYSAC  SCTL+WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  376  RYLKQVYSWQVYKACVPI  393
            +Y++  YSWQVYK CV +
Sbjct  123  KYVEGAYSWQVYKNCVAL  140

>PHYCA_102852
Length=195

 Score = 221 bits (563),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  27   AHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   ADF+CGFTDP+  PQPIP G  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  86   PVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTLYW+WLGVR+LK  YSWQVYKAC+P+
Sbjct  146  KGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

 Score = 160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 100/161 (62%), Gaps = 1/161 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  D + +P+A+LE +G  T  +   W  E GY +LR  MD    Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR-AKYPV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   F CG T PN   QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  88   TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKG  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
            +TIDYS C  +C + WFWLG+++    YSWQV+K CI L+A
Sbjct  148  YTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLTA  188

>PHYRA_84190
Length=206

 Score = 221 bits (563),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 121/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T + KD ++ PLAFLE + F+T +DF  +   NG+ SLR FMD+ + Y
Sbjct  10   AHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKY  68

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            SV   ADF CGFTDP   PQPIP D  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  69   SVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  128

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYW+GVR+LK+ YSWQVYK C+P+
Sbjct  129  KDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  169

 Score = 162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 102/163 (63%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  D + +P+A+LE +G  T  +   W  E GY +LR  MD+   YSV
Sbjct  12   QIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYSV  70

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP + +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  71   TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  130

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +T+DYS C  +C + W+W+G+++  E YSWQV+K CI L+  +
Sbjct  131  YTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGS  173

>PYU1_G001739
Length=266

 Score = 223 bits (568),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 120/161 (75%), Gaps = 1/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ++I P P + V+GKD +WKPLAFLE Q  +T+ D  G++   G+ +LRA MDD+ LY
Sbjct  23   AHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLY  82

Query  294  SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             VN  A F CG+TDP    QPIP  G +RSTGYTHDGPCEVWLDD +V+  DNCH+   G
Sbjct  83   EVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG  142

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            KT+ LDYS+C GSCTL WYWLGVRYLK+ YSWQ+YK CV +
Sbjct  143  KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183

 Score = 194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 119/163 (73%), Gaps = 0/163 (0%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q++++P PFF+VDG D +  P+A+LE QGV+T+ +   ++ ++GYA LRALMDD+ LY V
Sbjct  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
              + LF+CG T P  E+QPIPT G+  ++GYT DGPCE+W+D+   ++G NCH +FP   
Sbjct  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +DYS C  SC + W+WLG++Y  +RYSWQ++K C++LS +A
Sbjct  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDNA  187

>PHYSO_341599
Length=185

 Score = 220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 119/161 (74%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   K+ ++ PLAFLE Q F T +DF  +   NG+ SLR FMD  + Y
Sbjct  10   AHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR-AKY  68

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  69   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  128

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  129  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  169

 Score = 156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 100/166 (60%), Gaps = 1/166 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  + + +P+A+LE QG  T  +   W  E GY +LR  MD    Y V
Sbjct  12   QIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR-AKYDV  70

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  130

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
            +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  131  YTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  176

>PPTG_10634
Length=208

 Score = 221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR F+D+ + Y
Sbjct  27   AHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   ADF+CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  86   PVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTLYWYWLGVR+LK  YSWQVYKAC+P+
Sbjct  146  KDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

 Score = 151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 98/159 (62%), Gaps = 1/159 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR  +D+   Y V
Sbjct  29   QIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKYPV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  88   TDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            +T+DYS C  +C + W+WLG+++    YSWQV+K CI L
Sbjct  148  YTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYU1_G001742
Length=213

 Score = 221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V+LPAPT+TV+ +  ++ PLAFLE Q + TT DF  Y  A G+ +LRAFMDD   Y
Sbjct  27   AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAY  86

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
             V A ADF+CG+T  D   QPIP G +RSTGYTHDGPCEVWLD TRV++ +NCH    G 
Sbjct  87   KVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGT  146

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            T+ +DYS+C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  147  TFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

 Score = 157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 1/165 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P F V     + +P+A+LE QG  T ++   +   +GY TLRA MDD   Y V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKV  88

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 F CG T  + + QPIP  G+  ++GYT DGPCE+W+D+T  + G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTT  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
              IDYS C  SC + W+W+GI++   +YSWQV+KNC+ +    L+
Sbjct  148  FKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKRLL  192

>PYU1_G001741
Length=199

 Score = 220 bits (561),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 0/160 (0%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V+LPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ +LRAFMDD   Y
Sbjct  26   AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V + ADF CG+T  D   Q IP G +RSTGYTHDGPCEVWLD TRV++ +NCH   +G 
Sbjct  86   TVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGT  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            T+ +DYS+C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  146  THTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI  185

 Score = 157 bits (397),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 1/162 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY TLRA MDD   Y+V
Sbjct  28   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 F+CG T  +   Q IP  G+  ++GYT DGPCE+W+D+T  + G NCHTEF    
Sbjct  88   ASGADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTT  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            HTIDYS C  SC + W+W+GI++    YSWQV+KNC+ + +S
Sbjct  147  HTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSS  188

>PHYRA_85631
Length=228

 Score = 221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 121/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T + KD ++ PLAFLE + F+T +DF  + D NG+ SLR FMD+ + Y
Sbjct  27   AHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  86   NVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYK C+P+
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

 Score = 157 bits (398),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 101/163 (62%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE +G  T  +  +W  E GY +LR  MD+   Y+V
Sbjct  29   QVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYNV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             +   F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  88   ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +T+DYS C  +C + W+WLGI++    YSWQV+K CI L+  +
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGS  190

>PPTG_10636
Length=246

 Score = 221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 120/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE Q F T +DF+ + + N + SLR FMD+ + Y
Sbjct  27   AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT VL  +NCHE   G
Sbjct  86   EVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  146  KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  186

 Score = 159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 101/166 (61%), Gaps = 1/166 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  D + +P+A+LE QG  T  +  +W  E  Y +LR  MD+   Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYEV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP   +  ++GYT DGPCE+W+D+T+ L G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
            +T+DYS C  +C + W+WLGI++   +YSWQV+K CI LS S   T
Sbjct  148  YTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGEAT  193

>HYAP_07096
Length=251

 Score = 221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 128/175 (73%), Gaps = 1/175 (1%)

Query  23   LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGY  82
            +C   +RL S L EGQVVLYP P F+VD    +G  +AYL++QG+ T+IEAQ+W  E GY
Sbjct  71   VCVTGQRLTSDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGY  130

Query  83   ATLRALMDDDGLYSVTEEGLFDCGLTFPNTET-QPIPTNGSFITSGYTLDGPCEIWIDNT  141
             +LRA++DD  LY V+++ +FDCG T   +ET Q IPTNG+  +SGYTLDGPCE+W D+T
Sbjct  131  VSLRAMLDDQSLYHVSKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDT  190

Query  142  LALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               +GRNC TEFP G H +DYS CG+SC + W+WLGI+Y    YSWQV+KNCI L
Sbjct  191  QVTSGRNCRTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

 Score = 146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 2/158 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V+ P+P + V+    + K LA+L+ Q   T+ +   +   +G+ SLRA +DD SLY V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  296  NASADFRCGFTD-PDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +  A F CGFT  P    Q IP +G + S+GYT DGPCEVW DDT+V    NC       
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             + +DYS+C  SCTL WYWLG++Y+  +YSWQVYK C+
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCI  243

>PHYCA_102550
Length=268

 Score = 221 bits (563),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LPAP +  + +D +  PLAFLE Q F T  DF  + + NG+ SLR FMD  + Y
Sbjct  27   AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF+CG+TDP+  PQPIP G  MRSTGYTHDGPCEVW+DDT V++ DNCHE   G
Sbjct  86   TVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS C G CTLYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  146  KGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPL  186

 Score = 160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 97/163 (60%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D +  P+A+LE QG  T  +   W  E GY +LR  MD    Y+V
Sbjct  29   QVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 F CG T PN   QPIP   +  ++GYT DGPCE+WID+T+ + G NCH +FP   
Sbjct  88   RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKG  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C   C + W+WLG+++    YSWQV+K CI L+ S 
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PHYCA_102624
Length=195

 Score = 218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 118/161 (73%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +  + +D + KPL FLEG  F T  DF  +   NG+ SLR FMD+ + Y
Sbjct  27   AHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V+  ADF+CGFTDP+  PQPIP G  MRSTGYTHDGPCEVW+DDT V++ DNCHE   G
Sbjct  86   PVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS C G CTLYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  146  KDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPL  186

 Score = 160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 1/161 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D +  P+ +LE  G  T  +   W  E GY +LR  MD+   Y V
Sbjct  29   QVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYPV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            +E   F CG T PN   QPIP   +  ++GYT DGPCE+WID+T+ + G NCH +FP   
Sbjct  88   SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
            +TIDYS C   C + W+WLG+++   RYSWQV+K CI L++
Sbjct  148  YTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTS  188

>PYU1_G001744
Length=213

 Score = 219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 118/160 (74%), Gaps = 0/160 (0%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V+LPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ SLRAFMDD   Y
Sbjct  27   AHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAY  86

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
             V A ADF+CG+T  D   QPIP G +RSTGYTHDGPCEVWLD+T V++ +NCH    G 
Sbjct  87   KVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGT  146

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            T+ + Y++C GSCTL WYW+G+R+LK  YSWQVYK CVPI
Sbjct  147  THKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

 Score = 160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 100/165 (61%), Gaps = 1/165 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY +LRA MDD   Y V
Sbjct  29   QYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKV  88

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 F CG T  + + QPIP  G+  ++GYT DGPCE+W+DNTL + G NCH+EFP   
Sbjct  89   AAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTT  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
            H I Y+ C  SC + W+W+GI++   +YSWQV+KNC+ +    L+
Sbjct  148  HKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKRLL  192

>PHYSO_536424
Length=197

 Score = 217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             HQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKY  80

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  81   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  140

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  141  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

 Score = 155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 103/176 (59%), Gaps = 1/176 (1%)

Query  28   RRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRA  87
            RR    +   Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  88   LMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR  147
             MD    Y VT    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G 
Sbjct  74   FMDR-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  148  NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
            NCH +FP   +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  188

>PHYSO_507031
Length=197

 Score = 217 bits (552),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 119/161 (74%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
             HQ+V+LP P +T   K+ ++ PLAFLE + F+T +DF  +   NG+ SLR FMD  + Y
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKY  80

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP+G  MRSTGYTHDGPCEVWLDDT VL  DNCHE   G
Sbjct  81   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  140

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  141  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

 Score = 155 bits (393),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 103/176 (59%), Gaps = 1/176 (1%)

Query  28   RRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRA  87
            RR    +   Q+VL P P +  +  + + +P+A+LE +G  T  +   W  E GY +LR 
Sbjct  14   RRNVPDITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRD  73

Query  88   LMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR  147
             MD    Y VT    F CG T P    QPIP      ++GYT DGPCE+W+D+T+ L G 
Sbjct  74   FMDR-AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGD  132

Query  148  NCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
            NCH +FP   +T+DYS C  +C + W+WLG+++    YSWQV+K CI L++ ++ +
Sbjct  133  NCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAS  188

>PHYRA_82864
Length=193

 Score = 216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 121/160 (76%), Gaps = 1/160 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T + KD ++ PLAFLEGQ F+T  DF  +   NG+ +LR FMD  + Y
Sbjct  27   AHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD+ CG+TDP+  PQPIP G MRSTGYTHDGPCEVWLD+TRVLQ DNCHE    K
Sbjct  86   TVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDK  145

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             Y +DYS+C G+CTL+WYW+GVR+LK  YSWQVYK C+ +
Sbjct  146  DYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISL  185

 Score = 158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 104/167 (62%), Gaps = 2/167 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  29   QVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR-AKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   + CG T PN   QPIP  G+  ++GYT DGPCE+W+DNT  L G NCH +FP+  
Sbjct  88   TEGADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKD  146

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
            + IDYS C  +C + W+W+G+++    YSWQV+K CI+L++   + M
Sbjct  147  YPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQRLRM  193

>PYIR_25089
Length=262

 Score = 217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 115/161 (71%), Gaps = 1/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILPAPT+TV+ +  ++ PLAFLE Q F TT DF  Y  A G+ +LRAFMDD S Y
Sbjct  27   AHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAY  86

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   ADF CG+T     PQPIP    +RSTGYTHDGPCEVWLD TRVL+  NCH    G
Sbjct  87   KVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPG  146

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             T+ +DYS+C GSC L WYW+G+R+LK  YSWQVYK CVP+
Sbjct  147  TTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV  187

 Score = 161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 101/169 (60%), Gaps = 0/169 (0%)

Query  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
            D+ +   Q V+ P P F V     + +P+A+LE QG  T  +   +   +GY TLRA MD
Sbjct  22   DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  81

Query  91   DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
            D   Y V +   F+CG T      QPIP+  +  ++GYT DGPCE+W+D T  L G NCH
Sbjct  82   DKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCH  141

Query  151  TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            +EFP     IDYS C  SC + W+W+GI++   +YSWQV+KNC+ ++ S
Sbjct  142  SEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS  190

>PPTG_10643
Length=250

 Score = 215 bits (548),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 116/161 (72%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE Q F   +DF  +   NG+ SLR FMD  + Y
Sbjct  27   AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   ADF CGFT+P   PQPIP  GIMRSTGYTHDGPCEV+LDDT VLQ DNCHE   G
Sbjct  86   EVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K   +DYS+C G+CTL WYWLG+R+LK  YSWQVYK C+P+
Sbjct  146  KDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

 Score = 151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 96/166 (58%), Gaps = 1/166 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  D + +P+A+LE QG     +   W  E GY +LR  MD    Y V
Sbjct  29   QIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR-AKYEV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP  G   ++GYT DGPCE+++D+TL L G NCH +FP   
Sbjct  88   TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
              IDYS C  +C + W+WLGI++    YSWQV+K CI L  S  V+
Sbjct  148  CPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVS  193

>PHALS_00498
Length=199

 Score = 212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 116/161 (72%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +    KD R+ PLAFLE QNF TT D   Y   N F +LR FMD+ + Y
Sbjct  27   AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   AD  CGFTDP+  PQPIP +  MRSTGYTHDGPCEVWL++TRVL   NCHE   G
Sbjct  86   TVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C  +C L WYWLGVR+LK+ YSWQVYKAC+P+
Sbjct  146  KDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPL  186

 Score = 162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/171 (43%), Positives = 106/171 (62%), Gaps = 1/171 (1%)

Query  30   LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM  89
            L   +   Q+VL P P +  +  D R +P+A+LE Q   T  +AQ +  +  + TLR  M
Sbjct  21   LAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFM  80

Query  90   DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
            D+   Y+V +     CG T PN   QPIP N +  ++GYT DGPCE+W++NT  L+  NC
Sbjct  81   DN-AKYTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNC  139

Query  150  HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            H +FP   +TIDYS C ++C + W+WLG+++  E+YSWQV+K CI LS SA
Sbjct  140  HEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSRSA  190

>PYIR_26626
Length=212

 Score = 212 bits (540),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILPAPT+T   K+  W PLAFLE Q + TT DF GY+ + G+ +LRAFMDD   Y
Sbjct  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86

Query  294  SVNAS-ADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V+A+ A+F CG+T+ +   QPIP G +RSTGYTHDGPCEVWLD+T+V+   NC++   G
Sbjct  87   KVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            KT+ + Y++C GSCTL WYW+G+R+LK  +SWQVYK CVPI
Sbjct  147  KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187

 Score = 152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 2/165 (1%)

Query  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90
            DS +   Q V+ P P F     +   +P+A+LE QG  T  +   ++  +GY TLRA MD
Sbjct  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81

Query  91   DDGLYSVTEEGL-FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
            D   Y V   G  F+CG T  N + QPIP  G+  ++GYT DGPCE+W+DNT  ++G NC
Sbjct  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140

Query  150  HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            + +FP   H+I Y+ C  SC + W+W+G+++   ++SWQV+K C+
Sbjct  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185

>PHYKE_3446
Length=199

 Score = 211 bits (537),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 121/161 (75%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +  + K+ ++ PLAFLE Q F+T +D   +   NG+ +LRAFMD  + Y
Sbjct  27   AHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V   AD+ CG+TDP+   QPIP+G  MRSTGYTHDGPCEVW+D+TRVL+  NCHE I+G
Sbjct  86   QVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITG  145

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYSAC G+C L WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  146  KDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPL  186

 Score = 156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 99/163 (61%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  + + +P+A+LE QG  T  +A  W  + GY TLRA MD    Y V
Sbjct  29   QIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM-AKYQV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   + CG T PN   QPIP  G+  ++GYT DGPCE+WIDNT  L   NCH       
Sbjct  88   TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKD  147

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            +TIDYS C  +C + W+WLG+++    YSWQV+K CI L++ +
Sbjct  148  YTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTSGS  190

>PPTG_15264
Length=194

 Score = 206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 4/163 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+ P P +T + KD ++ PLAFLEGQ F T +DF  +   NG+ +LR FMD  + Y
Sbjct  24   AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKY  82

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   AD+ CG+TDP   PQPIP  G MRSTGYTHDGPCEVWLDD RVL+  NCHE I G
Sbjct  83   TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  142

Query  353  KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C   G C L WYWLGVR+LK  YSWQVYK C+P+
Sbjct  143  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

 Score = 149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   + CG T P    QPIP  G+  ++GYT DGPCE+W+D+   L G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  158  HTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            +TIDYS C +   C + W+WLG+++    YSWQV+K CI L+ +
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTT  188

>PPTG_17366
Length=194

 Score = 206 bits (523),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 4/163 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+ P P +T + KD ++ PLAFLEGQ F T +DF  +   NG+ +LR FMD  + Y
Sbjct  24   AHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKY  82

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   AD+ CG+TDP   PQPIP  G MRSTGYTHDGPCEVWLDD RVL+  NCHE I G
Sbjct  83   TVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPG  142

Query  353  KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS+C   G C L WYWLGVR+LK  YSWQVYK C+P+
Sbjct  143  KDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

 Score = 149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 97/164 (59%), Gaps = 3/164 (2%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  D  D + +P+A+LE QG  T  +   W  + GY TLR  MD    Y+V
Sbjct  26   QIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   + CG T P    QPIP  G+  ++GYT DGPCE+W+D+   L G NCH   P   
Sbjct  85   TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKD  144

Query  158  HTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
            +TIDYS C +   C + W+WLG+++    YSWQV+K CI L+ +
Sbjct  145  YTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLTTT  188

>PPTG_10048
Length=190

 Score = 202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 116/161 (72%), Gaps = 2/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+ PAP +  + +D +  PLAFLE Q F T +DF  +   NG+ +LR FM+  + Y
Sbjct  24   AHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH-AKY  82

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CG+T+P   PQPIP  GIMRSTGYTH+GPCE+W+ DT+V Q DNCH  + G
Sbjct  83   TVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPG  142

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K Y +DYS C G+C LYWYWLGVR+LK  YSWQVYK C+P+
Sbjct  143  KEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPL  183

 Score = 148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 98/163 (60%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            QVVL+P P ++ D  D + +P+A+LE QG  T  + ++W  + GY TLR  M+    Y+V
Sbjct  26   QVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH-AKYTV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE   F CG T P    QPIP  G   ++GYT +GPCE+W+ +T      NCH   P   
Sbjct  85   TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKE  144

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
            + IDYS C  +C + W+WLG+++    YSWQV+K CI L+ ++
Sbjct  145  YPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTNS  187

>PYVX_18174
Length=204

 Score = 200 bits (509),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 114/161 (71%), Gaps = 3/161 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILP PT+T   +D  + PLAFLE Q F T +DF  +  +NG+ +LRAFMD  S Y
Sbjct  27   AHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-Y  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   AD  CGFT+ D  PQPIP    RSTGYTHDGPCE+WLD TRV  +DNCHE ISGK
Sbjct  86   TVTDGADQTCGFTEIDGTPQPIPANF-RSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  144

Query  354  TYDLDYS-ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               +DYS    G+CTLYWYW+GVRYL   YSWQVYK CVP+
Sbjct  145  DTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPL  185

 Score = 132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 91/164 (55%), Gaps = 4/164 (2%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P +     D   +P+A+LE QG  T  +   W    GY TLRA MD    Y+V
Sbjct  29   QYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQ-ASYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+     CG T  +   QPIP N  F ++GYT DGPCEIW+D+T   A  NCH       
Sbjct  88   TDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKD  145

Query  158  HTIDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              IDYS     +C + W+W+G++Y    YSWQV+KNC+ LS SA
Sbjct  146  TAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLSTSA  189

>PYIR_26546
Length=239

 Score = 199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 4/164 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-NFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
            AHQ+V+LP PT+T+EGK  +W+P+A+LEGQ  FS   DF GYL + GF ++R FMD+D L
Sbjct  27   AHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKL  86

Query  293  YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH-EVI  350
            Y   + ADF+CG+T  D  PQPIP +  +R+TGYTH+GPCE+WLDD +V    NCH +V 
Sbjct  87   YRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVA  146

Query  351  SGKTY-DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            SG  +  LD+S+C G CT+YWYW+G+R   +  SWQ+YK C+P+
Sbjct  147  SGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

 Score = 137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 98/170 (58%), Gaps = 3/170 (2%)

Query  30   LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLE-QQGVHTAIEAQTWLAERGYATLRAL  88
            LDS     Q+V+ P P + ++G   +  P+AYLE Q G     +   +L+ +G+ T+R  
Sbjct  21   LDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREF  80

Query  89   MDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRN  148
            MD+D LY    +  F CG T  + E QPIP N    T+GYT +GPCEIW+D+     G+N
Sbjct  81   MDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  149  CHTEFPEGHH--TIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            CH +   G +   +D+S C   C + W+W+GI+  G+  SWQ++K CI L
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHALS_03284
Length=188

 Score = 196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 113/162 (70%), Gaps = 2/162 (1%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
            +AHQ+++LP P +    KD ++ PLAFLE QNF T+ DF GYL  N ++SLR F+   + 
Sbjct  12   IAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-  70

Query  293  YSVNASADFRCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
            Y+V   AD  CGFTDP+  PQPIP G  MR TGYTHDG CE+WLDDT+VL   NCH    
Sbjct  71   YTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFP  130

Query  352  GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            GK   +DYS+C  +C +YWYWL VR LK  YSWQVYKAC+P+
Sbjct  131  GKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPL  172

 Score = 136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 95/163 (58%), Gaps = 1/163 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q++L P P +  +  D + +P+A+LE Q   T+ +   +L +  Y +LR  +     Y+V
Sbjct  15   QIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-YTV  73

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            TE    DCG T PN   QPIP   +   +GYT DG CE+W+D+T  L+G NCH +FP   
Sbjct  74   TEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKD  133

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              +DYS C ++C + W+WL ++     YSWQV+K CI L+ S 
Sbjct  134  CPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTRSG  176

>PPTG_14255
Length=268

 Score = 193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 117/167 (70%), Gaps = 7/167 (4%)

Query  233  MAHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFM  287
             AHQ+V +P+PT+T     +      W PL+FLE + ++T ++F  Y   NG+ SLR FM
Sbjct  20   QAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFM  79

Query  288  DDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNC  346
            D+ + YSV   AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ DT  L + NC
Sbjct  80   DN-AKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNC  138

Query  347  HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            HE I+ +T+ LDYSAC  SC LYWYWLGVRYLK+ YSWQVYK C+P+
Sbjct  139  HESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

 Score = 129 bits (324),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 1/140 (1%)

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+++LE++G  T      +  + GY +LR  MD+   YSVT+     CG T P    Q 
Sbjct  47   NPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN-AKYSVTDGADQACGWTDPKGVPQQ  105

Query  117  IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
            IP +G+  TSGYT DGPCEI++ +TLAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  106  IPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWL  165

Query  177  GIKYQGERYSWQVFKNCINL  196
            G++Y  ++YSWQV+K CI L
Sbjct  166  GVRYLKKKYSWQVYKECIPL  185

>PYAR_24096
Length=227

 Score = 191 bits (484),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 107/163 (66%), Gaps = 3/163 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V LP   YTV  ++  W P A LE Q + TT DF  YL AN + +LR FMD    Y
Sbjct  26   AHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAY  85

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              N+ A F CGFTDP A  QPIP DG  R++GYTH+GPCE+W+DD RV   DNCH  IS 
Sbjct  86   KPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  145

Query  353  KTY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +   +DYSAC G+C L WYWLG+R   + YSWQ+YKAC+P+
Sbjct  146  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

 Score = 145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 89/162 (55%), Gaps = 2/162 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V  P   + V   +    P A LE+QG  T  +   +L    Y TLR  MD  G Y  
Sbjct  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                 F+CG T P    QPIP +G+F TSGYT +GPCEIWID+     G NCH +  E  
Sbjct  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147

Query  158  HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             T  IDYS C  +C + W+WLGI+  G+ YSWQ++K CI LS
Sbjct  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PYIW_18791
Length=194

 Score = 187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 3/162 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V +P P +TV  K   W PL+FLE     T++   G++   G+ +LRA MDD  LY
Sbjct  21   AHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLY  80

Query  294  SVNASAD-FRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
              N++AD F CG+TDP    Q IP D  MR+TGYTH GPCEVW+DD RV+  DNCHE +S
Sbjct  81   KTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVS  140

Query  352  GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              T  +DYS C G CT+ WYWLG+RYLK+ +SWQVYK C+ +
Sbjct  141  NTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

 Score = 141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 100/176 (57%), Gaps = 2/176 (1%)

Query  33   GLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
            G    Q V  P P + V       +P+++LE+ GV T+     ++ ++GY+TLRALMDD 
Sbjct  18   GADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDS  77

Query  93   GLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHT  151
             LY        F CG T P+  +Q IP + +  T+GYT  GPCE+WID+   +AG NCH 
Sbjct  78   KLYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHE  137

Query  152  EFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGL  207
            +       +DYS C   C + W+WLG++Y  +++SWQV+KNCI L+        G+
Sbjct  138  QVSNTTK-VDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAAISKGV  192

>PYAP_22273
Length=268

 Score = 187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 105/163 (64%), Gaps = 3/163 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V  P   YT+  +   W P A LE Q + TT DF  YL ANG+ +LR FMD    Y
Sbjct  25   AHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAY  84

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
              N  A   CG+TDP+A PQPIP +G  R++GYTH+GPCE+W+DD  V    NCH  IS 
Sbjct  85   KANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISE  144

Query  353  KTY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            K +   +DYSAC G C L WYWLG+R + + YSWQ+YKAC+P+
Sbjct  145  KAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPL  187

 Score = 155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V +P   + +        P A LE QG  T  +   +L+  GY TLR  MD  G Y  
Sbjct  27   QRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYKA  86

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
             +    +CG T PN   QPIPTNG F TSGYT +GPCEIWID+ +  +G+NCH +  E  
Sbjct  87   NKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEKA  146

Query  158  HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             T  IDYS C   C + W+WLGI+  G++YSWQ++K CI L+
Sbjct  147  FTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PPTG_08820
Length=250

 Score = 186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 115/166 (69%), Gaps = 6/166 (4%)

Query  234  AHQLVILPAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS  291
            AHQL++ P P +   +  +D RW+PLAFLE Q F    DF G+   +G+ +LR FMD   
Sbjct  27   AHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAK  86

Query  292  -LYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEV  349
               SV   AD  CG T+    P+PIP DG+M+STGYTHDGPC V+LDD  VL++DNCHE 
Sbjct  87   YTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEK  146

Query  350  ISGKTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            + GK+Y +DYS+C   G CTLYW+WLG+R++K  +SWQVYK CVP+
Sbjct  147  LPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

 Score = 126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 93/166 (56%), Gaps = 5/166 (3%)

Query  38   QVVLYPPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDG-L  94
            Q++L P P +   ++  D R  P+A+LE QG     +   W A+ GY  LR  MD     
Sbjct  29   QLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYT  88

Query  95   YSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP  154
             SVT      CGLT      +PIP +G   ++GYT DGPC +++D+ L L   NCH + P
Sbjct  89   TSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLP  148

Query  155  EGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
               + IDYS C +   C + WFWLGI++   R+SWQV+K C+ L+A
Sbjct  149  GKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLTA  194

>PHYCA_510817
Length=188

 Score = 183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 112/166 (67%), Gaps = 7/166 (4%)

Query  234  AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T      K+ R  W PL+FLE + F T ++F  Y   NG+ SLR FM+
Sbjct  22   AHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  81

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
              + Y V+  AD  CG++DP   PQ IP DG MR++GYTHDGPCE+W+ D   L + NCH
Sbjct  82   K-AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  140

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I  +T+ LDYS C  SC LYWYWLGVR LK  YSWQVYK C+P+
Sbjct  141  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

 Score = 125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 93/164 (57%), Gaps = 6/164 (4%)

Query  38   QVVLYPPPFFVVDGMDYRG-----SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
            QVV  P P +       +      +P+++LE++G  T      +  + GY +LR  M+  
Sbjct  24   QVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMEK-  82

Query  93   GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
              Y V++     CG + P    Q IP++G+  TSGYT DGPCEIW+ + LAL+  NCH  
Sbjct  83   AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHES  142

Query  153  FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
             PE    +DYS CG+SC + W+WLG++    +YSWQV+K CI L
Sbjct  143  IPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PPTG_14254
Length=188

 Score = 182 bits (463),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 111/166 (67%), Gaps = 7/166 (4%)

Query  234  AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +PAPT+T      K+ R  W PL+FLE + F T ++F  +   NG+ SLR FMD
Sbjct  22   AHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD  81

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
              + Y V   AD  CG+TDP   PQ IP DG MR+TGYTHDGPCE+++ +   L + NCH
Sbjct  82   R-AKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCH  140

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I  +T+ LDYS C  SC LYWYWLGVR LK  YSWQVYK C+PI
Sbjct  141  ESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

 Score = 123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+++LE++G  T      +  + GY +LR  MD    Y VTE     CG T P    Q 
Sbjct  48   NPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMDR-AKYKVTEGADQACGWTDPKGIPQK  106

Query  117  IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
            IP +G+  T+GYT DGPCEI++   LAL+  NCH   PE    +DYS CG+SC + W+WL
Sbjct  107  IPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWL  166

Query  177  GIKYQGERYSWQVFKNCI  194
            G++    +YSWQV+K CI
Sbjct  167  GVRKLKGKYSWQVYKECI  184

>PHYSO_499978
Length=174

 Score = 181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 2/140 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+ P P +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y
Sbjct  27   AHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-Y  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ 
Sbjct  86   TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  145

Query  353  KTYDLDYSACNGSCTLYWYW  372
            K Y +DYSAC G+CTL WYW
Sbjct  146  KGYTIDYSACKGTCTLRWYW  165

 Score = 129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  + + +P+A+LE QG  T  + + W  + GY TLR  MD  G Y+V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   F CG T P    QPIP   +  ++GYT DGPCE+WIDNT  L G NCH +  +  
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  158  HTIDYSVCGESCRVSWFW  175
            +TIDYS C  +C + W+W
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 181 bits (460),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 101/140 (72%), Gaps = 2/140 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+ P P +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y
Sbjct  27   AHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-Y  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V   ADF CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ 
Sbjct  86   TVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIAD  145

Query  353  KTYDLDYSACNGSCTLYWYW  372
            K Y +DYSAC G+CTL WYW
Sbjct  146  KGYTIDYSACKGTCTLRWYW  165

 Score = 129 bits (323),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 83/138 (60%), Gaps = 1/138 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +  + + +P+A+LE QG  T  + + W  + GY TLR  MD  G Y+V
Sbjct  29   QIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYTV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T+   F CG T P    QPIP   +  ++GYT DGPCE+WIDNT  L G NCH +  +  
Sbjct  88   TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKG  147

Query  158  HTIDYSVCGESCRVSWFW  175
            +TIDYS C  +C + W+W
Sbjct  148  YTIDYSACKGTCTLRWYW  165

>PYAP_22278
Length=289

 Score = 183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 114/167 (68%), Gaps = 7/167 (4%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V +PAPT+T   ++  W PLAFLE Q     DD  G+L + G  +LR +MD+ + Y
Sbjct  24   AHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANY  83

Query  294  SVNA-SADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQH--DNCHEV  349
             + A  A F CG+T+P+ A QPIP +G+MRSTGYTHDGPCEVWLD+TRVL     NCH  
Sbjct  84   KIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRD  143

Query  350  ISGK--TYDLDYSACNGSCTLYWYWLGVRYL-KQVYSWQVYKACVPI  393
            +  K  +Y +D+S C G+C L WYWLG R +  + +SWQ+YKACVP+
Sbjct  144  VGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

 Score = 131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 96/175 (55%), Gaps = 6/175 (3%)

Query  32   SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
            S +   Q V  P P F  +  +   +P+A+LE QGV    +   +L  +G  TLR  MD+
Sbjct  20   SSVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDN  79

Query  92   DGLYSVTEEGL-FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR--N  148
               Y +   G  F+CG T PN   QPIP NG   ++GYT DGPCE+W+DNT  L     N
Sbjct  80   KANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGN  139

Query  149  CHTEFPEG--HHTIDYSVCGESCRVSWFWLGIKY-QGERYSWQVFKNCINLSASA  200
            CH +       + ID+S C  +C + W+WLG +   G+++SWQ++K C+ L  S 
Sbjct  140  CHRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSG  194

>PYU1_G001738
Length=226

 Score = 180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 115/162 (71%), Gaps = 0/162 (0%)

Query  40   VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
            VLYP PF++VDG + + +PVA+LE+QG+ T+ +   ++ ++GYA LRA++DD  LY+V  
Sbjct  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84

Query  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
            + L +CG T P  E+QPIP   +FI++GY L+GPCE+W+D+   ++  NCHT++P  +  
Sbjct  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144

Query  160  IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201
            +DYS C  SC + W+WLGI+   E YSWQV+K C++L  + +
Sbjct  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGV  186

 Score = 160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 98/161 (61%), Gaps = 1/161 (1%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            A   V+ P P Y V+G + +  P+A LE Q   T+ D   ++   G+ +LRA +DD  LY
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +VN  A   CG+TDP    QPIP      STGY  +GPCEVWLDD +V+   NCH    G
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              + LDYS+C GSC L WYWLG++ + + YSWQVYK CV +
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYKE_9185
Length=281

 Score = 181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 112/166 (67%), Gaps = 7/166 (4%)

Query  234  AHQLVILPAPTYT---VEGKDNR--WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T      K+ R  W PL+FLE +   T ++F  Y   N + SLR FMD
Sbjct  24   AHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMD  83

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
              + Y V+  AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  84   K-AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  142

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I+ +T+ LDYSAC  SC LYWYWLGVR LK  YSWQ+YK C+P+
Sbjct  143  ESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

 Score = 120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 6/164 (4%)

Query  38   QVVLYPPPFFVVDGMDYRG-----SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDD  92
            QVV  P P +       +      +P+++LE++G+ T      +  +  YA+LR  MD  
Sbjct  26   QVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMDK-  84

Query  93   GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
              Y V++     CG T P    Q IP +G+  TSGYT DGPCEI++ + LAL+  NCH  
Sbjct  85   AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHES  144

Query  153  FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              +    +DYS CG+SC + W+WLG++     YSWQ++K CI L
Sbjct  145  ITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PHYSO_417649
Length=185

 Score = 178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 110/166 (66%), Gaps = 7/166 (4%)

Query  234  AHQLVILPAPTYT-----VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T        +   W PL+FLE + F T ++F  Y   NG+ SLR FM+
Sbjct  20   AHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFME  79

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
              + Y +   AD  CG+TDP   PQ IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  80   R-AKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  138

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I+ +T+ LDYS C  SC LYWYWLGVR LK  +SWQVYK C+P+
Sbjct  139  ESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

 Score = 115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 1/140 (1%)

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+++LE++G  T      +  + GY +LR  M+    Y +T+     CG T P    Q 
Sbjct  46   NPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMER-AKYKLTDGADQACGWTDPKGIPQQ  104

Query  117  IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
            IP +G+  TSGYT DGPCEI++ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  105  IPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWL  164

Query  177  GIKYQGERYSWQVFKNCINL  196
            G++    ++SWQV+K CI L
Sbjct  165  GVRKLKGKFSWQVYKECIPL  184

>PYAP_22279
Length=223

 Score = 178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 110/165 (67%), Gaps = 7/165 (4%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYS  294
            HQ + +PAPT T + ++    PLAFLE Q    TDD  GYL   G  +LR FMD+ + Y 
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  295  VNAS-ADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVL--QHDNCHEVI  350
            V A+ A F CG+TDP+ A QPIP +G+MRSTGYTHDGPCEVWLD+TRVL     +CH+ I
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  351  SGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 +Y +D+S C G+C L WYWL  R +   +SWQVYK CVP+
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

 Score = 137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 98/172 (57%), Gaps = 6/172 (3%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q +  P P    D  +   +P+A+LE QGV    +   +L ++G  TLR  MD+   Y V
Sbjct  23   QRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYKV  81

Query  98   TEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR--NCHTEFP  154
               G  F+CG T PN   QPIP+NG   ++GYT DGPCE+W+DNT  L     +CH +  
Sbjct  82   EAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDIG  141

Query  155  EG--HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
            +G   + ID+S C  +C + W+WL  +  G ++SWQV+K C+ L  SA  ++
Sbjct  142  QGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAARSL  193

>PHYCA_536934
Length=983

 Score = 187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 116/166 (70%), Gaps = 7/166 (4%)

Query  234  AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T     +      W PL+FLE + ++T ++F  Y   NG+ +LR FMD
Sbjct  38   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMD  97

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
            + + Y+V   AD  CG++DP+  PQ IP DG MR++GYTHDGPCE+W+ D   L + NCH
Sbjct  98   N-AKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCH  156

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I+ +T+ LDYS C  SC LYWYWLGVRYLK+ YSWQVYK C+P+
Sbjct  157  ESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

 Score = 129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 88/140 (63%), Gaps = 1/140 (1%)

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+++LE++G  T      +  + GY  LR  MD+   Y+VT+     CG + PN   Q 
Sbjct  64   NPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN-AKYAVTDGADQACGWSDPNGIPQQ  122

Query  117  IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
            IP +G+  TSGYT DGPCEIW+ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  123  IPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWL  182

Query  177  GIKYQGERYSWQVFKNCINL  196
            G++Y  ++YSWQV+K CI L
Sbjct  183  GVRYLKKKYSWQVYKECIPL  202

>PHYSO_343376
Length=172

 Score = 170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 2/132 (2%)

Query  242  APTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADF  301
            A  +T   K+ ++ PLAFLE Q F+T  DF  +   NG+ +LR FMD    Y+V   ADF
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGK-YTVTKGADF  91

Query  302  RCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYS  360
             CG+TDP   PQPIPDG  MRSTGYTHDGPCEVW+D+TRVLQ DNCHE I+ K Y +DYS
Sbjct  92   SCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYS  151

Query  361  ACNGSCTLYWYW  372
            AC G+CTL WYW
Sbjct  152  ACKGTCTLRWYW  163

 Score = 120 bits (300),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 83/150 (55%), Gaps = 4/150 (3%)

Query  29   RLDSGLGEGQVVLYPPPF---FVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
            R  + L   +  L   P    +  +  + + +P+A+LE QG  T  + + W  + GY TL
Sbjct  15   RKQASLAAVRAALRGRPVAAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTL  74

Query  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA  145
            R  MD  G Y+VT+   F CG T P    QPIP   +  ++GYT DGPCE+WIDNT  L 
Sbjct  75   RDFMDH-GKYTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQ  133

Query  146  GRNCHTEFPEGHHTIDYSVCGESCRVSWFW  175
            G NCH +  +  +TIDYS C  +C + W+W
Sbjct  134  GDNCHEKIADKGYTIDYSACKGTCTLRWYW  163

>PITG_10499
Length=323

 Score = 175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 6/159 (4%)

Query  241  PAPTYT--VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS-LYSVNA  297
            P P +   +  +D RW+PLAFLE Q F   +DF G+   NG+  LR FMD    + SV  
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  298  SADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD  356
             AD  CG T+    P+PIP DG MRSTGYTHDGPC ++LDD  V+++DNCHE I G+TY 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  357  LDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +D+S+C   G CTLYW+WLG+R++K  +SWQVYK C+ +
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

 Score = 121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 91/161 (57%), Gaps = 5/161 (3%)

Query  43   PPPFFV--VDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDG-LYSVTE  99
            P P +   ++  D R  P+A+LE QG     +   W A+ GY  LR  MD    + SVT 
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
                 CGLT      +PIP +G+  ++GYT DGPC I++D+ L +   NCH   P   + 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  160  IDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
            ID+S C +   C + WFWLGI++   R+SWQV+K CI+L+A
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLTA  164

>PHYSO_262732
Length=188

 Score = 167 bits (424),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 104/166 (63%), Gaps = 21/166 (13%)

Query  234  AHQLVILPAPTYT-----VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T        +   W PLAFLE Q F T               LR FMD
Sbjct  21   AHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDFMD  66

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
            + + Y+V   AD  CG+TDP    Q IP DG MR++GYTHDGPCE+++ D   L + NCH
Sbjct  67   N-AKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCH  125

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            E I+ +T+ LDYS C  SCTLYWYWLGVR+L   YSWQVYK C+PI
Sbjct  126  ESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

 Score = 115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 81/138 (59%), Gaps = 15/138 (11%)

Query  57   SPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQP  116
            +P+A+LE QG  T               LR  MD+   Y+VTE     CG T P    Q 
Sbjct  47   NPLAFLENQGFQTH--------------LRDFMDN-AKYTVTEGADQACGWTDPKGIAQQ  91

Query  117  IPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWL  176
            IP++G+  TSGYT DGPCEI++ + LAL+  NCH    +    +DYS CG+SC + W+WL
Sbjct  92   IPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWL  151

Query  177  GIKYQGERYSWQVFKNCI  194
            G+++   +YSWQV+K CI
Sbjct  152  GVRFLNNKYSWQVYKECI  169

>PITG_13520
Length=171

 Score = 166 bits (420),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 91/131 (69%), Gaps = 2/131 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T + KD ++ PLAFLE Q F T  DF  + D NG+ SLR FMD  + Y
Sbjct  27   AHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP  G MRSTGYTHDGPCEVWLDD  VL  DNCHE   G
Sbjct  86   DVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPG  145

Query  353  KTYDLDYSACN  363
            K Y +DYS+C 
Sbjct  146  KDYTVDYSSCK  156

 Score = 120 bits (302),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 75/128 (59%), Gaps = 1/128 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +     D + +P+A+LE QG  T  + + W  E GY +LR  MD    Y V
Sbjct  29   QIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR-AKYDV  87

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP  G+  ++GYT DGPCE+W+D+ + L G NCH +FP   
Sbjct  88   TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKD  147

Query  158  HTIDYSVC  165
            +T+DYS C
Sbjct  148  YTVDYSSC  155

>PHYSO_527908
Length=174

 Score = 165 bits (417),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 7/154 (5%)

Query  234  AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P PT+T     +      WKPLAFLEGQ F+T  +F  ++  NG+ SLR FMD
Sbjct  21   AHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMD  80

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
            + + YSV   AD  CG+TDP+  PQ IP DG MR++G+THD PCE+++ D   L + NCH
Sbjct  81   NGN-YSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCH  139

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            E I+ + + LDYSAC  SC LYWYWLGVR++K +
Sbjct  140  ESITSQPFKLDYSACGDSCVLYWYWLGVRFIKGI  173

 Score = 105 bits (263),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 1/123 (1%)

Query  58   PVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPI  117
            P+A+LE QG  T      ++ + GY +LR  MD+ G YSVT+     CG T PN   Q I
Sbjct  48   PLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN-GNYSVTKGADQACGWTDPNGIPQQI  106

Query  118  PTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLG  177
            P +G+  TSG+T D PCEI++ + L+L+  NCH         +DYS CG+SC + W+WLG
Sbjct  107  PEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLG  166

Query  178  IKY  180
            +++
Sbjct  167  VRF  169

>PHYKE_8390
Length=130

 Score = 161 bits (408),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 89/109 (82%), Gaps = 0/109 (0%)

Query  26   AQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATL  85
             QRRL + LGEGQ+VL PPPFF+VDG+D++G  +AYL++QGV+T+IE Q W+   GY +L
Sbjct  19   GQRRLKANLGEGQIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSL  78

Query  86   RALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
            RA++DD+ LY VTEE LFDCGLT P TETQ IPTN +F TSGYT+DGPC
Sbjct  79   RAMLDDEALYKVTEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

 Score = 84.7 bits (208),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 63/97 (65%), Gaps = 1/97 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            Q+V+ P P + V+G D +   LA+L+ Q  +T+ +  G+++++G+DSLRA +DD++LY V
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  296  NASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPC  331
               A F CG T P    Q IP +   +++GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PHYSO_254168
Length=170

 Score = 162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 100/149 (67%), Gaps = 17/149 (11%)

Query  247  VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFT  306
            VE KD ++ PLAFLEGQ F+T + F      NG+ +LR FMD    Y+V   AD+ CG+T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGK-YTVTQGADYFCGWT  86

Query  307  DPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSAC--NG  364
            +P   PQPIP    RSTGYTHDGPCE+WLDD RVL+          ++  +DYS+C   G
Sbjct  87   NPKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKG  132

Query  365  SCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             CT++WYWLGVR+LK  YSWQVYK C+P+
Sbjct  133  GCTMHWYWLGVRFLKNSYSWQVYKECIPL  161

 Score = 108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 84/154 (55%), Gaps = 18/154 (12%)

Query  48   VVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGL  107
             V+  D + +P+A+LE QG  T         + GY TLR  MD  G Y+VT+   + CG 
Sbjct  27   AVEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDR-GKYTVTQGADYFCGW  85

Query  108  TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGE  167
            T P    QPIP      ++GYT DGPCEIW+D+   L          E   TIDYS C +
Sbjct  86   TNPKGTPQPIPR-----STGYTHDGPCEIWLDDVRVL----------ERSPTIDYSSCEK  130

Query  168  S--CRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
               C + W+WLG+++    YSWQV+K CI L+A+
Sbjct  131  KGGCTMHWYWLGVRFLKNSYSWQVYKECIPLTAA  164

>PYIW_18788
Length=244

 Score = 160 bits (404),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  40   VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
            V YP PFF++DG     + VA LE Q V T+ +   +L ++GYA+LRA++DD+ LY V  
Sbjct  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89

Query  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
            + +F+CG T P  E+QPIPTNG    +GY  DGPCEIWID+   L+  NC  +FP     
Sbjct  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149

Query  160  IDYSVCGESCRVSWFWLGI-KYQGERYSWQVFKNCINLS  197
            +DYS C   C + W+ L + K  G  YSW+V+KNC+ LS
Sbjct  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

 Score = 152 bits (383),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 2/163 (1%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
            +A+  V  P P + ++G       +A LE QN +T+ D  G+L   G+ SLRA +DD++L
Sbjct  25   VANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETL  84

Query  293  YSVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
            Y VN  + F CG+TDP    QPIP +G +R TGY  DGPCE+W+DD ++L   NC +   
Sbjct  85   YDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFP  144

Query  352  GKTYDLDYSACNGSCTLYWYWLGV-RYLKQVYSWQVYKACVPI  393
            G +  LDYS+C G CTL WY L V +     YSW+VYK CV +
Sbjct  145  GTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187

>PHYSO_341596
Length=231

 Score = 150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 85/123 (69%), Gaps = 10/123 (8%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+L         KD ++ PLAFLE Q F T +DF  + D NG+ SLR FMD  + Y
Sbjct  27   AHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK-AKY  77

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            +V + ADF CGFTDP   PQPIP G  MRSTGYTHDGPCEVWLDDT+VL+ DNCHE   G
Sbjct  78   TVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG  137

Query  353  KTY  355
            K Y
Sbjct  138  KDY  140

 Score = 97.1 bits (240),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 63/108 (58%), Gaps = 1/108 (1%)

Query  53   DYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNT  112
            D + +P+A+LE QG  T  +  +W  + GY +LR  MD    Y+VT    F CG T P  
Sbjct  36   DTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK-AKYTVTSGADFSCGFTDPKG  94

Query  113  ETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI  160
              QPIP   +  ++GYT DGPCE+W+D+T  L G NCH +FP   +T 
Sbjct  95   TPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPGKDYTT  142

>PHYSO_340369
Length=200

 Score = 137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 98/166 (59%), Gaps = 21/166 (13%)

Query  234  AHQLVILPAPTYT-----VEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            A+Q+V +PAPT+T      + +   W PLA+ E Q F+T+ +F  +   NGF +LR FMD
Sbjct  24   ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  83

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCH  347
            + + YSV               +PQ IPD  IMR+ GYT DGPCE+WLD+T      +C 
Sbjct  84   NGN-YSV--------------TSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCL  128

Query  348  EVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +   TY LDYS C  SC +YWY LGV    +VYSW+VYK C+P+
Sbjct  129  VSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

 Score = 110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 75/139 (54%), Gaps = 15/139 (11%)

Query  58   PVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPI  117
            P+AY E QG +T+     W    G+ TLR  MD+ G YSVT                Q I
Sbjct  51   PLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDN-GNYSVTSP--------------QQI  95

Query  118  PTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLG  177
            P +    T GYT DGPCEIW+DNTLA +  +C    P   +T+DYS CG SC + W+ LG
Sbjct  96   PDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLG  155

Query  178  IKYQGERYSWQVFKNCINL  196
            +      YSW+V+K CI L
Sbjct  156  VAKPDRVYSWEVYKECIPL  174

>PHYCA_14368
Length=219

 Score = 133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 84/160 (53%), Gaps = 45/160 (28%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   KD ++ PLAFLE Q F T  DF  +   N + SLR FMD+ + Y
Sbjct  27   AHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDN-AKY  85

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +V   ADF CGFTDP                                            K
Sbjct  86   TVTDGADFSCGFTDP--------------------------------------------K  101

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             Y +DYS+C G+CTL WYWLG+R+LK  YSWQVYKAC+P+
Sbjct  102  DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  141

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 75/170 (44%), Gaps = 46/170 (27%)

Query  30   LDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALM  89
            LDS     Q+VL P P +  +  D + +P+A+LE QG  T  +  +W  E  Y +LR  M
Sbjct  21   LDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFM  80

Query  90   DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149
             D+  Y+VT+   F CG T P                                       
Sbjct  81   -DNAKYTVTDGADFSCGFTDPK--------------------------------------  101

Query  150  HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                    +T+DYS C  +C + W+WLGI++   +YSWQV+K CI LS S
Sbjct  102  -------DYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGS  144

>PHYSO_246676
Length=187

 Score = 121 bits (304),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 84/161 (52%), Gaps = 40/161 (25%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ+V+LP P +T   K  ++ PLAFLE Q F T +DF  +   NG+ +LR FM D + Y
Sbjct  10   AHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DKAKY  68

Query  294  SVNASADFRCGFTDPDAAPQPIPDG-IMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
             V + ADF CGFTDP   PQPIP+G  MRSTGYTHDG     L             V+ G
Sbjct  69   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASL-------------VLDG  115

Query  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                                     +K  YSW+VYKAC+P+
Sbjct  116  -------------------------MKNSYSWKVYKACIPL  131

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 65/162 (40%), Gaps = 39/162 (24%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q+VL P P +  +    + +P+A+LE QG  T  +   W  E GY TLR  M D   Y V
Sbjct  12   QIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DKAKYDV  70

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            T    F CG T P    QPIP      ++GYT DG     +  +L L G           
Sbjct  71   TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG----LVHASLVLDGMK---------  117

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSAS  199
                                       YSW+V+K CI LS S
Sbjct  118  -------------------------NSYSWKVYKACIPLSGS  134

>PYAP_18131
Length=226

 Score = 121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 8/113 (7%)

Query  287  MDDDSLYSVNAS-ADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVL--Q  342
            MDD + Y V A+ A F CG TDP+   QPIP +G+MRSTG+THDG   VW+D+TRVL  +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  343  HDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              NCH+ I     +Y +D+S C G C + WYWLG+R L + +SWQVYKAC+PI
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

 Score = 100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 69/119 (58%), Gaps = 7/119 (6%)

Query  89   MDDDGLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGR  147
            MDD   Y V   G  F+CG T PN   QPIP NG   ++G+T DG   +WIDNT  L  +
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  148  --NCHTEFPEG--HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
              NCH    +G   + ID+S C   C + W+WLG++  G+++SWQV+K CI + AS   
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGTA  117

>PYIW_18792
Length=125

 Score = 107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 2/98 (2%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ V LPAPT+TV+ +  ++ PLAFLEGQ +  T DF  Y  + G+ +LR FMDD   Y
Sbjct  23   AHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAY  82

Query  294  SVNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGP  330
             V+   +F CG++     PQPIP  G +RSTGYTHDGP
Sbjct  83   KVDG-GNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  119

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 50/99 (51%), Gaps = 1/99 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V  P P + V     + +P+A+LE QG     +   +   +GY  LR  MDD   Y V
Sbjct  25   QYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKV  84

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEI  136
             + G F+CG +      QPIP  G+  ++GYT DGP  I
Sbjct  85   -DGGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHALS_06480
Length=159

 Score = 103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 60/71 (85%), Gaps = 0/71 (0%)

Query  25  FAQRRLDSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYAT  84
           +  RRL++GLGEGQVVLYP PF+VVDG+D++G  +AYLE+QG++T+IE Q+W+ +  Y +
Sbjct  22  YGYRRLEAGLGEGQVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNS  81

Query  85  LRALMDDDGLY  95
           LRA++DDD LY
Sbjct  82  LRAMLDDDMLY  92

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (66%), Gaps = 0/58 (0%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            Q+V+ PAP Y V+G D +   LA+LE Q  +T+ +   ++  + ++SLRA +DDD LY
Sbjct  35   QVVLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLY  92

>PHYCA_127270
Length=279

 Score = 105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 76/143 (53%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  56   DGNNPQSVDTFKSLKAANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPCE+WLDD +VL  D+C      K  D+      DYS+C NG C  + +
Sbjct  110  ATFSRALVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + L +   WQ YK C+P+
Sbjct  170  YWLAFQGLSKKTVWQSYKDCIPL  192

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 64/128 (50%), Gaps = 15/128 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
            A   +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEI
Sbjct  71   AANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEI  124

Query  137  WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
            W+D+   L   +C +++   +  I      DYS C  G   ++ ++WL  +   ++  WQ
Sbjct  125  WLDDKKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQ  184

Query  189  VFKNCINL  196
             +K+CI L
Sbjct  185  SYKDCIPL  192

>PHYRA_78689
Length=296

 Score = 105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 76/143 (53%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDPD  PQPIP DG 
Sbjct  56   DGNNPQSVDTFKSLKTANNFKDLKTLMDDTSVYGAD------CGFTDPDGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSACN-GSCT-LYW  370
               S    H GPCE+WLDDT+VL  D+C      +  D+      DYS+CN G C  + +
Sbjct  110  ATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + L     WQ YK C+P+
Sbjct  170  YWLAFQGLDSKTVWQSYKDCIPL  192

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 15/126 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD  +Y        DCG T P+   QPIPT+G    S   +  GPCEIW+
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWL  126

Query  139  DNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
            D+T  L   +C +++   +  I      DYS C  G   ++ ++WL  +    +  WQ +
Sbjct  127  DDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSY  186

Query  191  KNCINL  196
            K+CI L
Sbjct  187  KDCIPL  192

>PYIR_16435
Length=304

 Score = 104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 76/134 (57%), Gaps = 15/134 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--DGIMR  321
            ++S   +F       G+ +LR++++D             CG T+PDA P+ IP  + +  
Sbjct  60   DWSDPANFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKF  110

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
            S    H GPCE+WLDD RV+Q DNC      K  T+ +D+S+C GSC L W+WLG++   
Sbjct  111  SRAIVHPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSG  170

Query  380  QVYSWQVYKACVPI  393
            +   WQVYK CVP+
Sbjct  171  E--RWQVYKNCVPL  182

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 14/121 (12%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            E+GY+TLR+ ++D G           CG T P+   + IP++ +   +      GPCE+W
Sbjct  73   EKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVHPGPCELW  123

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            +D+   +   NC   F     T  ID+S C  SC + WFWLG++  GER  WQV+KNC+ 
Sbjct  124  LDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGER--WQVYKNCVP  181

Query  196  L  196
            L
Sbjct  182  L  182

>PYIR_16444
Length=182

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
            N+    +F       GF +LR+++++             CG T+  A P+PIP DG +  
Sbjct  57   NWKDPKNFAKVAKQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHF  107

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
            S    H GPCE+WLD+ RV Q+DNC  V   K   + +D+S+C G+C L ++WLG++   
Sbjct  108  SRAIVHPGPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ--D  165

Query  380  QVYSWQVYKACVPI  393
            Q   WQVYK CVP+
Sbjct  166  QGKRWQVYKNCVPV  179

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 14/124 (11%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++G+ TLR+ +++ G           CG T      +PIP++G    +      GPCE+W
Sbjct  70   QKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELW  120

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            +DN       NC   F        ID+S C  +C + +FWLG++ QG+R  WQV+KNC+ 
Sbjct  121  LDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGKR--WQVYKNCVP  178

Query  196  LSAS  199
            +   
Sbjct  179  VKGK  182

>PHYSO_438103
Length=238

 Score = 100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 90/177 (51%), Gaps = 24/177 (14%)

Query  234  AHQLVILPAPTYTVEGKDNRW----KPL---AFLEGQNFSTTDDFVGYLDANGFDSLRAF  286
            AH  +++P   +T  G ++ W     P+      +G N  + + F     AN F  L+  
Sbjct  22   AHGYMLIPESQFT-GGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLKTL  80

Query  287  MDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHD  344
            MDD S+Y  +      CGFTDP+  PQPIP DG    S    H GPCE+WLD+T+VL  D
Sbjct  81   MDDTSVYGQD------CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYED  134

Query  345  NCHEVISGKTYDL------DYSACN-GSCT-LYWYWLGVRYLKQVYSWQVYKACVPI  393
            +C      +  D+      DYS+CN G C  + +YWL  + L     WQ YK C+P+
Sbjct  135  DCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 63/128 (49%), Gaps = 15/128 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
            +   +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEI
Sbjct  70   SANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEI  123

Query  137  WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
            W+DNT  L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ
Sbjct  124  WLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQ  183

Query  189  VFKNCINL  196
             +K+CI L
Sbjct  184  SYKDCIPL  191

>PHYSO_340332
Length=295

 Score = 102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  56   DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPCE+WLDD +VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  110  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  170  YWLAFQGVDGKTVWQSYKDCIPL  192

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 15/126 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  139  DNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
            D+   L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ +
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  191  KNCINL  196
            K+CI L
Sbjct  187  KDCIPL  192

>PHYRA_78625
Length=434

 Score = 104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 77/163 (47%), Gaps = 50/163 (31%)

Query  234  AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T     +      W PL+FLE + F T ++F  +   NG+ SLR F+D
Sbjct  240  AHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLD  299

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
                      A ++                                      L + NCHE
Sbjct  300  ---------KAKYKLA------------------------------------LSYLNCHE  314

Query  349  VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  315  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  357

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  142  LALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  305  LALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYSO_340333
Length=284

 Score = 101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  56   DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPCE+WLDD +VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  110  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  170  YWLAFQGVDGKTVWQSYKDCIPL  192

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 15/126 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  139  DNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
            D+   L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ +
Sbjct  127  DDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  191  KNCINL  196
            K+CI L
Sbjct  187  KDCIPL  192

>PHYRA_78626
Length=473

 Score = 104 bits (259),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 77/163 (47%), Gaps = 50/163 (31%)

Query  234  AHQLVILPAPTYTVEGKDNR-----WKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMD  288
            AHQ+V +P+PT+T     +      W PL+FLE + F T ++F  +   NG+ SLR F+D
Sbjct  279  AHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFLD  338

Query  289  DDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHE  348
                      A ++                                      L + NCHE
Sbjct  339  ---------KAKYKLA------------------------------------LSYLNCHE  353

Query  349  VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             I+ +T+ LDYS C  SC LYWYWLG RYLK  YSWQVYK C+
Sbjct  354  SITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECI  396

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 0/55 (0%)

Query  142  LALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            LAL+  NCH    +    +DYS CG+SC + W+WLG +Y    YSWQV+K CI L
Sbjct  344  LALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PHYSO_533682
Length=278

 Score = 100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (54%), Gaps = 26/156 (17%)

Query  250  KDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPD  309
            K ++W      +G N  + + F  +   N F  L+  MDD S+Y  +      CGFTDP+
Sbjct  51   KSDKW------DGNNPGSVEVFTSFKSVNNFKDLKTLMDDTSVYGQD------CGFTDPN  98

Query  310  AAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDNCH--------EVISGKTYDLDY  359
              PQPIP DG    S G  H GPCE+WLDD +VL  D+C+        +VI+  T+ +DY
Sbjct  99   GTPQPIPTDGKATFSRGLIHVGPCEIWLDDNKVLSEDDCYSKYGNPNQDVIT--TFPVDY  156

Query  360  SAC-NGSCT-LYWYWLGVRYLKQVYSWQVYKACVPI  393
            S+C NG C  +  Y LG + L     WQ YK C+P+
Sbjct  157  SSCNNGGCKEMRCYCLGFQGLVDKTVWQSYKNCIPL  192

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 65/126 (52%), Gaps = 15/126 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWI  138
              +  L+ LMDD  +Y        DCG T PN   QPIPT+G +  + G    GPCEIW+
Sbjct  73   NNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGPCEIWL  126

Query  139  DNTLALAGRNCHTEFPEGHH------TIDYSVCGE-SCR-VSWFWLGIKYQGERYSWQVF  190
            D+   L+  +C++++   +        +DYS C    C+ +  + LG +   ++  WQ +
Sbjct  127  DDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTVWQSY  186

Query  191  KNCINL  196
            KNCI L
Sbjct  187  KNCIPL  192

>PYIW_19151
Length=248

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 75/128 (59%), Gaps = 15/128 (12%)

Query  270  DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTH  327
            +F       GF +LR++++D             CGFTDP  +P+ IP D  +R S    H
Sbjct  60   NFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPH  110

Query  328  DGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
             GPCE+++DDTRV Q+D+C    +G   ++D+D+S C G C + +YWLG++       WQ
Sbjct  111  PGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQ--ASGTRWQ  168

Query  386  VYKACVPI  393
            VYK+CVP+
Sbjct  169  VYKSCVPV  176

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 70/128 (55%), Gaps = 14/128 (11%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            E+G++TLR+ ++D G           CG T P    + IP + +   +      GPCE++
Sbjct  67   EKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELY  117

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            ID+T      +C + F     +  +D+S+C   C + ++WLG++  G R  WQV+K+C+ 
Sbjct  118  IDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASGTR--WQVYKSCVP  175

Query  196  LSASALVT  203
            +S+SA+ T
Sbjct  176  VSSSAVAT  183

>PPTG_04622
Length=273

 Score = 100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 73/134 (54%), Gaps = 17/134 (13%)

Query  271  FVGYLDANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTH  327
            +    ++NG+  +RA +D D+ LY  N      CGFTDPDA P+  P       S G  H
Sbjct  69   YTSLKESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRGMVH  122

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACN-GSCTLYWYWLGVRYLK  379
             GPCE+WLDDT VL +D+C       T D       +DYS+C+ G C L +YWL  + + 
Sbjct  123  AGPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVD  182

Query  380  QVYSWQVYKACVPI  393
                WQVYK CVP+
Sbjct  183  SKMVWQVYKDCVPL  196

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 68/132 (52%), Gaps = 16/132 (12%)

Query  79   ERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
              GY+ +RAL+D D  LY        +CG T P+   +  PT G +  + G    GPCEI
Sbjct  75   SNGYSDIRALLDSDTDLYGA------NCGFTDPDATPKDPPTTGDATFSRGMVHAGPCEI  128

Query  137  WIDNTLALAGRNCHTEFPEGHH-------TIDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
            W+D+T+ L+  +C T + +G          +DYS C    C + ++WL  +    +  WQ
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMVWQ  188

Query  189  VFKNCINLSASA  200
            V+K+C+ L+  A
Sbjct  189  VYKDCVPLTGPA  200

>PHYRA_74651
Length=344

 Score = 101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 74/134 (55%), Gaps = 17/134 (13%)

Query  271  FVGYLDANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTH  327
            +    ++NG+  +R  +D D SLY  +      CGFTDP+A P+  P       S G  H
Sbjct  69   YTSLKESNGYSDIRTLLDSDTSLYGAD------CGFTDPNATPKDPPSTGDATFSRGMVH  122

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLK  379
             GPCE+WLDDT+VL +DNC       T +       +DYS+C +G CTL +YWL  + L 
Sbjct  123  AGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLD  182

Query  380  QVYSWQVYKACVPI  393
                WQVYK CVP+
Sbjct  183  SSTVWQVYKNCVPL  196

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 63/128 (49%), Gaps = 16/128 (13%)

Query  80   RGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIW  137
             GY+ +R L+D D  LY        DCG T PN   +  P+ G +  + G    GPCEIW
Sbjct  76   NGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAGPCEIW  129

Query  138  IDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQV  189
            +D+T  L+  NC   + +G          +DYS C    C + ++WL  +       WQV
Sbjct  130  LDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSSTVWQV  189

Query  190  FKNCINLS  197
            +KNC+ L+
Sbjct  190  YKNCVPLT  197

>PYVX_18179
Length=147

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 76/160 (48%), Gaps = 59/160 (37%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILP PT+T E  D  + PLAFLE Q F+T +D         F+S R+    D+L 
Sbjct  27   AHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQED---------FNSWRSANGYDTLR  77

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            +          F D                                        + +SGK
Sbjct  78   A----------FMD----------------------------------------QAVSGK  87

Query  354  TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               +DYS+C+GSCTLYW+W+GVRYLK  YSWQVYK CVP+
Sbjct  88   DTAVDYSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 65/163 (40%), Gaps = 60/163 (37%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P +  +  D   SP+A+LE QG  T  +  +W +  GY TLRA MD       
Sbjct  29   QYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMDQ------  82

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                                                         A++G++   ++    
Sbjct  83   ---------------------------------------------AVSGKDTAVDY----  93

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                 S C  SC + WFW+G++Y    YSWQV+KNC+ LS SA
Sbjct  94   -----SSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLSTSA  131

>PYIR_16443
Length=275

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 16/132 (12%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
            N+    +F       GF++LR++++D             CG T+P+A+P+ IP D +++ 
Sbjct  57   NWKDPKNFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKF  107

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
            S    H GPCE+WLDD RV+Q DNC      K  T+ +D+S+C GSC L W+WLG++   
Sbjct  108  SRAIVHPGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSG  167

Query  380  QVYSWQVY-KAC  390
            +   WQVY K+C
Sbjct  168  K--RWQVYSKSC  177

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 14/132 (11%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++G+ TLR+ ++D G           CG T PN   + IP++     +      GPCEIW
Sbjct  70   QKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIW  120

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            +D+   +   NC   F     T  ID+S C  SC + WFWLG++  G+R  WQV+    +
Sbjct  121  LDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGKR--WQVYSKSCD  178

Query  196  LSASALVTMIGL  207
             S   ++ +  +
Sbjct  179  SSPLCIIPIASM  190

>PPTG_14221
Length=275

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD S+Y  +      CGFT+P+  PQPIP DG 
Sbjct  56   DGNNPKSVDTFKSLKAANNFKDLKTLMDDTSVYGAD------CGFTNPNGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPC +WLDD  VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  110  ATFSRALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + L +   WQ YK C+P+
Sbjct  170  YWLAFQGLNKKTVWQSYKDCIPL  192

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 15/128 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
            A   +  L+ LMDD  +Y        DCG T PN   QPIPT+G +  +      GPC I
Sbjct  71   AANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGI  124

Query  137  WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
            W+D+ + L   +C  ++   +  I      DYS C  G   ++ ++WL  +   ++  WQ
Sbjct  125  WLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQ  184

Query  189  VFKNCINL  196
             +K+CI L
Sbjct  185  SYKDCIPL  192

>PYIW_27477
Length=180

 Score = 96.3 bits (238),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 15/122 (12%)

Query  270  DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTH  327
            +F       GF++LR++++D            +CG TDP+A  + IP D +++ S    H
Sbjct  40   NFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVH  90

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
             GPCE+W+DDTRV+Q DNC +    K  T+ +D+SAC G C L W+WLG++   +   WQ
Sbjct  91   PGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGK--RWQ  148

Query  386  VY  387
            VY
Sbjct  149  VY  150

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 14/115 (12%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-NGSFITSGYTLDGPCEIW  137
            E+G+ TLR+ ++D G           CG T PN + + IP+ N    +      GPCE+W
Sbjct  47   EKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELW  97

Query  138  IDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
            ID+T  +   NC   F     T  ID+S C   C + WFWLG++  G+R  WQV+
Sbjct  98   IDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGKR--WQVY  150

>PHYSO_342364
Length=194

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 89/177 (50%), Gaps = 24/177 (14%)

Query  234  AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFSTTDDFVGYLDANGFDSLRAF  286
            AH  + +P   +   G++++W        P     G    +   F     ++ +  LR  
Sbjct  23   AHGYIYVPQSQF-FGGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDLRTL  81

Query  287  MDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMRSTGYTHDGPCEVWLDDTRVLQHD  344
            +D+ ++Y  N      CG+T+P+  PQPIP     + S G  H GPCE+WLDD +V+  D
Sbjct  82   LDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMAAD  135

Query  345  NC-----HEVISGKT-YDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +C     H  ++ KT + +DYS C   G C + +YWLG + L +   WQ YK C+P+
Sbjct  136  DCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 19/131 (15%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIW  137
               Y  LR L+D+  +Y        +CG T PN   QPIPTNG  I S G    GPCEIW
Sbjct  72   SHNYKDLRTLLDNTAVYGP------NCGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIW  125

Query  138  IDNTLALAGRNCHTEFPEGHHTI--------DYSVCGES--CRVSWFWLGIKYQGERYSW  187
            +D+   +A  +C++++  GH  +        DYS C     C + ++WLG +  G++  W
Sbjct  126  LDDKKVMAADDCYSKY--GHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVW  183

Query  188  QVFKNCINLSA  198
            Q +KNCI L A
Sbjct  184  QTYKNCIPLKA  194

>PHYSO_533903
Length=208

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 80/143 (56%), Gaps = 17/143 (12%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-I  319
            G    + + F     AN F  L+  +DD SLY  +      CGFTDP+  PQPIP DG  
Sbjct  58   GNTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGPD------CGFTDPNGTPQPIPTDGKA  111

Query  320  MRSTGYTHDGPCEVWLDDTRVLQHDNC-----HEVISGKT-YDLDYSAC-NGSCTLY-WY  371
            + S G  H GPCE WLDD +VL  D+C     H  ++ KT + +DYS+C NG C +  +Y
Sbjct  112  VFSRGLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFY  171

Query  372  WLGVRYLKQVYS-WQVYKACVPI  393
            WLG + L    + WQ YK C+P+
Sbjct  172  WLGFQALDDKKTVWQTYKDCIPL  194

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 20/129 (16%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWI  138
              +  L+ ++DD  LY        DCG T PN   QPIPT+G  + S G    GPCE W+
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  139  DNTLALAGRNCHTEFPEGHHT--------IDYSVC--GESCRVSWFWLGIKYQGERYS-W  187
            D+   L   +C++E+  GH          IDYS C  G    + ++WLG +   ++ + W
Sbjct  128  DDKKVLYADDCYSEY--GHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVW  185

Query  188  QVFKNCINL  196
            Q +K+CI L
Sbjct  186  QTYKDCIPL  194

>PHYCA_130365
Length=266

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 71/127 (56%), Gaps = 16/127 (13%)

Query  277  ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVW  334
            +N +  +R+ MD +S+Y  +      CGFTDP+  P  P  DG    S G  H GPCE+W
Sbjct  72   SNNYKDVRSMMDGNSVYGED------CGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIW  125

Query  335  LDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQV  386
            LDD  VLQ+D+C       T D       +DYS+C +G C L +YWLG++ L     WQ 
Sbjct  126  LDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQA  185

Query  387  YKACVPI  393
            YK C+P+
Sbjct  186  YKNCIPL  192

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 65/129 (50%), Gaps = 15/129 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
            A   Y  +R++MD + +Y        DCG T PN      PT+G+   S G    GPCEI
Sbjct  71   ASNNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEI  124

Query  137  WIDNTLALAGRNCHTEFPEGHH-------TIDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
            W+D+ + L   +C + + +G          +DYS C    C + ++WLG++    +  WQ
Sbjct  125  WLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTVWQ  184

Query  189  VFKNCINLS  197
             +KNCI L+
Sbjct  185  AYKNCIPLT  193

>PYAP_18709
Length=235

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (57%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       GF  LR+F++D             CG + P+A+P+PIP DG ++ +
Sbjct  54   FKTGAQYAAVAPGKGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLA  104

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCEVWLD+TR   +D+C +   S  ++ +D+ AC GSC L +YWLG++   + 
Sbjct  105  STIEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGK-  163

Query  382  YSWQVYKACVPI  393
              WQ YK C+P+
Sbjct  164  -RWQSYKNCIPL  174

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 65/120 (54%), Gaps = 13/120 (11%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
            +G+  LR+ ++D G           CG + PN   +PIP++G+  + S     GPCE+W+
Sbjct  67   KGFKDLRSFLEDKGPT---------CGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWL  117

Query  139  DNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
            DNT A    +C   F       +D+  C  SC + ++WLG++  G+R  WQ +KNCI L+
Sbjct  118  DNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGKR--WQSYKNCIPLN  175

>PYU1_G014690
Length=295

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 74/134 (55%), Gaps = 15/134 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--DGIMR  321
            N+    +F       GFD+LR++++D             CG TDP+A P+ IP  + +  
Sbjct  56   NWKDPANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHF  106

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLK  379
            S    H GPCE+WLDD RV+Q D+C      +   +++D+S+C  +C L ++WLG++   
Sbjct  107  SRPIVHPGPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--D  164

Query  380  QVYSWQVYKACVPI  393
                WQVYK CVP+
Sbjct  165  SGTRWQVYKNCVPL  178

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 18/123 (15%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-NGSFITSGYTLDGPCEIW  137
            E+G+ TLR+ ++D G           CG T PN   + IP+ N    +      GPCEIW
Sbjct  69   EKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEIW  119

Query  138  IDNTLALAGRNCHTEFPEGHH----TIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +D+   +   +C   F  G       ID+S C  +C + +FWLG++  G R  WQV+KNC
Sbjct  120  LDDKRVMQDDDCEATF--GDEIPVWNIDFSSCKSNCMLRFFWLGLQDSGTR--WQVYKNC  175

Query  194  INL  196
            + L
Sbjct  176  VPL  178

>PITG_04949
Length=337

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/181 (35%), Positives = 86/181 (48%), Gaps = 29/181 (16%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
             AH  +  PAP++    K N W  +  +E Q     + S  D+     F      N F  
Sbjct  22   QAHGYIAKPAPSWKAS-KTNNW--VVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKD  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
            +R+ MD + ++         CGFTDP   P +P  DG    S G  H GPCE+WLDD  V
Sbjct  79   VRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMV  132

Query  341  LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
            LQ+D+C       T         +DYS+C  G C L +YWL ++ LK    WQ YK C+P
Sbjct  133  LQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIP  192

Query  393  I  393
            +
Sbjct  193  L  193

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 64/128 (50%), Gaps = 15/128 (12%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDN  140
            +  +R+LMD + ++        +CG T P  +    P++G+   S G    GPCEIW+D+
Sbjct  76   FKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDD  129

Query  141  TLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKN  192
             + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ +KN
Sbjct  130  KMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKN  189

Query  193  CINLSASA  200
            CI L+  A
Sbjct  190  CIPLTGPA  197

>PITG_05271
Length=278

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 74/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G    + + F     AN F  L+  MDD S+Y  +      CGFTDP+   QPIP DG 
Sbjct  56   DGNKPGSVNAFKALKTANKFKDLKTLMDDTSVYGAD------CGFTDPNGKAQPIPKDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPCE+WLDDT+VL  D+C      +  D+      DYS+C NG C  + +
Sbjct  110  ATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  170  YWLAFQGVDGKTVWQSYKDCIPL  192

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 63/128 (49%), Gaps = 15/128 (12%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWIDN  140
            +  L+ LMDD  +Y        DCG T PN + QPIP +G    S   +  GPCEIW+D+
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  141  TLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQVFKN  192
            T  L   +C +++   +  I      DYS C  G    + ++WL  +    +  WQ +K+
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  193  CINLSASA  200
            CI L  S 
Sbjct  189  CIPLEGSG  196

>PYU1_G007476
Length=195

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 18/132 (14%)

Query  269  DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM----RST  323
            +DF       G+ +LR+F+++             CG+T+P+  P+ IP DG +     + 
Sbjct  64   NDFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  324  GYTHDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            G+ H GPCE+WLD+  +L  DNC +   G      +D+S+C G+C L  YWLG  +  Q 
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  382  YSWQVYKACVPI  393
              WQ YK CVP+
Sbjct  173  QRWQTYKYCVPV  184

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 17/122 (14%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS----GYTLDGPC  134
            ++GY TLR+ +++ G           CG T PNT  + IP +G  I +    G+   GPC
Sbjct  72   QKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGPC  122

Query  135  EIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
            E+W+DN + L   NC   FP  +    +D+S C  +C +  +WLG + QG+R  WQ +K 
Sbjct  123  ELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQDQGQR--WQTYKY  180

Query  193  CI  194
            C+
Sbjct  181  CV  182

>PHYCA_534296
Length=309

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + + F     AN F  L+  MDD S+Y  +      CGFT+P    QPIP DG 
Sbjct  30   DGNNAGSVETFKSLKSANNFKDLKTLMDDTSVYGAD------CGFTNPSGTAQPIPTDGK  83

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYW  370
               S    H GPCE+WLDDT+VL  D+C+     +  D+      DYS+C NG C  + +
Sbjct  84   ATFSRALVHVGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRF  143

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  144  YWLAFQGVDGKTVWQSYKDCIPL  166

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 15/128 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEI  136
            +   +  L+ LMDD  +Y        DCG T P+   QPIPT+G    S   +  GPCEI
Sbjct  45   SANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEI  98

Query  137  WIDNTLALAGRNCHTEFPEGHHTI------DYSVC--GESCRVSWFWLGIKYQGERYSWQ  188
            W+D+T  L   +C++++   +  I      DYS C  G    + ++WL  +    +  WQ
Sbjct  99   WLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQ  158

Query  189  VFKNCINL  196
             +K+CI L
Sbjct  159  SYKDCIPL  166

>PHYCA_12942
Length=353

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 63/103 (61%), Gaps = 13/103 (13%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVIS-G  352
            D +CG+T  DA PQPIP DG+++       G+TH GPCE+++DD  VL  DNC E    G
Sbjct  81   DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGG  140

Query  353  KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             T D+  DYS+CNG+C L  YWLG     Q   WQ Y  CVP+
Sbjct  141  DTSDMKIDYSSCNGNCMLTIYWLGF----QNAQWQAYVNCVPL  179

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 20/131 (15%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
            +T  AERG +    ++D      V ++    CG T  +   QPIP++G          G+
Sbjct  61   KTMAAERGMSVKDVILD-----MVKDK---KCGYTVADAPPQPIPSDGMVKWAGNGGGGF  112

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERY  185
            T  GPCEI+ID+ + L G NC  EF  G  +   IDYS C  +C ++ +WLG     +  
Sbjct  113  THQGPCEIYIDDKMVLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGF----QNA  168

Query  186  SWQVFKNCINL  196
             WQ + NC+ L
Sbjct  169  QWQAYVNCVPL  179

>PYVX_14662
Length=540

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 75/143 (52%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D +       G   +R+ +DD S+Y  +      CGFTDPD   Q IP DG 
Sbjct  57   DGNNQGSVDTYKSLAAEKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIPTDGK  110

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSACN-GSCT-LYW  370
               S G  H GPCE+WLDDT VL  D+C+    G   D      +DYS+CN G C  + +
Sbjct  111  ATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRF  170

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQVYK C+P+
Sbjct  171  YWLAFQGVDGDTVWQVYKNCIPL  193

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (52%), Gaps = 15/132 (11%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
            ++  AE+G   +R+L+DD  +Y        DCG T P+   Q IPT+G +  + G    G
Sbjct  68   KSLAAEKGVTEIRSLLDDTSIYGQ------DCGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  133  PCEIWIDNTLALAGRNCHTEFPEGHHT------IDYSVC--GESCRVSWFWLGIKYQGER  184
            PCEIW+D+T+ L   +C++ +            +DYS C  G    + ++WL  +     
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGD  181

Query  185  YSWQVFKNCINL  196
              WQV+KNCI L
Sbjct  182  TVWQVYKNCIPL  193

>PHYRA_73607
Length=343

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 70/128 (55%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +NG+  +R  +D D SLY  +      CGFT+PDA  +  P       S G  H GPCE+
Sbjct  75   SNGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVHVGPCEI  128

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
            WLDDT+VL +DNC       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  129  WLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVWQ  188

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  189  VYKNCVPL  196

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGFTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+T  L+  NC   + +G          +DYS C  S C + ++WL  +       W
Sbjct  128  IWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSSMVW  187

Query  188  QVFKNCINLSASA  200
            QV+KNC+ L+  A
Sbjct  188  QVYKNCVPLTGPA  200

>PHYKE_6002
Length=197

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 70/132 (53%), Gaps = 13/132 (10%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  +   F     AN F  L+  MDD S+Y  +      CGFTDP   PQPIP DG 
Sbjct  56   DGNNPQSVTTFDSLKKANNFVDLKTLMDDTSVYGAD------CGFTDPSGTPQPIPSDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACN-GSCT-LYWYWLGVR  376
               S    H GPCE+WLD T+    DNC ++   +T+ +DYS+CN G C  + +YWL  +
Sbjct  110  ATFSRAMQHVGPCEIWLDSTKAFSKDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQ  166

Query  377  YLKQVYSWQVYK  388
             L     WQ Y+
Sbjct  167  GLDSKTVWQSYR  178

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 57/117 (49%), Gaps = 16/117 (14%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWI  138
              +  L+ LMDD  +Y        DCG T P+   QPIP++G +  +      GPCEIW+
Sbjct  73   NNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWL  126

Query  139  DNTLALAGRNC--HTEFPEGHHTIDYSVC--GESCRVSWFWLGIKYQGERYSWQVFK  191
            D+T A +  NC     FP     +DYS C  G    + ++WL  +    +  WQ ++
Sbjct  127  DSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PHYSO_485524
Length=278

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 17/129 (13%)

Query  276  DANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCE  332
            D+N    +R  +D D+ LY  N      CG+T+PDA P+ P  DG    S G  H GPCE
Sbjct  72   DSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCE  125

Query  333  VWLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSW  384
            +WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  385  QVYKACVPI  393
            QVYK C+P+
Sbjct  186  QVYKNCIPL  194

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 16/126 (13%)

Query  85   LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDNTL  142
            +R L+D D  LY        +CG T P+   +  PT+G+   S G    GPCEIW+D+ +
Sbjct  79   IRTLLDSDTKLYGA------NCGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++WL ++    +  WQV+KNCI
Sbjct  133  VLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNCI  192

Query  195  NLSASA  200
             LS  A
Sbjct  193  PLSGPA  198

>PYU1_G005323
Length=251

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 72/133 (54%), Gaps = 14/133 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
             F T   +       G+  L++F++D             CG + PDA  +PIP DG+++ 
Sbjct  53   TFRTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKL  103

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
            ++   H GPCEVW DD R    D+C +   S  ++ +D+SAC GSC L +YWLG++   +
Sbjct  104  ASTIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGK  163

Query  381  VYSWQVYKACVPI  393
               WQ YK C+P+
Sbjct  164  --RWQSYKNCIPL  174

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 13/120 (11%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
            +GY  L++ ++D G           CG + P+ + +PIP++G   + S     GPCE+W 
Sbjct  67   KGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLASTIEHAGPCEVWF  117

Query  139  DNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
            D+  A    +C   F       +D+S C  SC + ++WLG++  G+R  WQ +KNCI L+
Sbjct  118  DDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGKR--WQSYKNCIPLT  175

>PYAR_14256
Length=199

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 71/131 (54%), Gaps = 13/131 (10%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-ST  323
            F T   +       GF +LRAF++D             CG T P+A P+P    +++ ++
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLAS  101

Query  324  GYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
               H GPCE+WLDD+     D+C +   S  ++ +D+SAC GSC L +YWLG++   +  
Sbjct  102  TIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGK--  159

Query  383  SWQVYKACVPI  393
             WQ YK C+P+
Sbjct  160  RWQSYKNCIPL  170

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 71/134 (53%), Gaps = 16/134 (12%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEI  136
            ++G+  LRA ++D G           CG T PN   +P P     I    T++  GPCEI
Sbjct  63   DKGFKNLRAFLEDKGP---------TCGNTLPNA--KPKPXXXXLIKLASTIEHPGPCEI  111

Query  137  WIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            W+D++LA    +C  +F       +D+S C  SC + ++WLG++  G+R  WQ +KNCI 
Sbjct  112  WLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGKR--WQSYKNCIP  169

Query  196  LSASALVTMIGLQH  209
            L  +   ++ G ++
Sbjct  170  LGGAQSRSIDGEEY  183

>PPTG_04618
Length=326

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 88/181 (49%), Gaps = 29/181 (16%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
             AH  +  PAP++  + + N W  +  +E Q     + S  D+     F      N +  
Sbjct  22   QAHGYIAKPAPSWK-DKETNDW--VVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKD  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
            +R+ MD + +Y  +      CGFTDP   P +P  DG    S G  H GPCE+WLDD  V
Sbjct  79   VRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMV  132

Query  341  LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
            LQ+D+C       T         +DYS+C +G C L +YWL ++ L     WQ YK C+P
Sbjct  133  LQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIP  192

Query  393  I  393
            +
Sbjct  193  L  193

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 15/128 (12%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDN  140
            Y  +R+LMD + +Y        DCG T P       P++G+   S G    GPCEIW+D+
Sbjct  76   YKDVRSLMDGNPVYGE------DCGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDD  129

Query  141  TLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKN  192
             + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ +KN
Sbjct  130  KMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKN  189

Query  193  CINLSASA  200
            CI L+  A
Sbjct  190  CIPLTGPA  197

>PHYSO_483955
Length=320

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 88/181 (49%), Gaps = 29/181 (16%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDD-----FVGYLDANGFDS  282
             AH  +  P P++  + K N W  +  +E Q     + S  D+     F     AN +  
Sbjct  22   QAHGYIAKPEPSWK-DKKTNDW--VVEIEPQWKGGWDESKGDEGLLATFKELSAANNYKD  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
            +R+ MD + +Y  +      CGFTDP   P  P  DG    S G  H GPCE+WLDD  V
Sbjct  79   VRSLMDGNPVYGED------CGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDDKMV  132

Query  341  LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
            LQ+D+C       T +       +DYS+C +G C L +YWL ++ L     WQ YK C+P
Sbjct  133  LQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIP  192

Query  393  I  393
            +
Sbjct  193  L  193

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 65/132 (49%), Gaps = 15/132 (11%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
            A   Y  +R+LMD + +Y        DCG T P  +    PT+G+   S G    GPCEI
Sbjct  72   AANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEI  125

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
            W+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ
Sbjct  126  WLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQ  185

Query  189  VFKNCINLSASA  200
             +KNCI L+  A
Sbjct  186  AYKNCIPLTGPA  197

>PHYKE_3913
Length=321

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 68/128 (53%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
            AN    +R   D D SLY  N      CGFT+PDA P+ P  DG    S G  H GPCE+
Sbjct  100  ANNAKDIRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEI  153

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T +       +DYS+C  G C   +YW+ ++ L     WQ
Sbjct  154  WLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQ  213

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  214  VYKNCVPL  221

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 61/124 (49%), Gaps = 16/124 (13%)

Query  85   LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDNTL  142
            +R L D D  LY        +CG T P+   +  PT+G+   S G    GPCEIW+D+ +
Sbjct  106  IRTLFDSDTSLYGE------NCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++W+ ++    +  WQV+KNC+
Sbjct  160  VLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNCV  219

Query  195  NLSA  198
             L+ 
Sbjct  220  PLTG  223

>PITG_04948
Length=232

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
            +N    +R  +D D SLY  +      CG+T+PD +P+ P  DG    S G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTSLYGAD------CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  126

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T +       +DYS+C +G C L +YWL ++ L     WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  186

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  187  VYKNCIPL  194

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 65/133 (49%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
            A      +R L+D D  LY        DCG T P+   +  PT+G+   S G    GPCE
Sbjct  72   ASNNAKDIRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCE  125

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYW  185

Query  188  QVFKNCINLSASA  200
            QV+KNCI LS  A
Sbjct  186  QVYKNCIPLSGPA  198

>PHYKE_10578
Length=239

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 85/177 (48%), Gaps = 29/177 (16%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNF---STTDDFVGYLDANGFDSLRAFMDDD  290
            AH  + +P PT+      + W  L      N+    +  D VG       +   +  D  
Sbjct  22   AHGALKVPEPTFEQGASHSNWVTLV----DNYWDIGSGGDQVGKFKTMATEKGMSVKD--  75

Query  291  SLYSVNASADFRCGFTDPDAAPQPIP-DGIM-----RSTGYTHDGPCEVWLDDTRVLQHD  344
                ++   D +CGFT  DA PQP+P DG +      + G+TH GPCEV++DD  VL  D
Sbjct  76   --VILDMVKDKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGD  133

Query  345  NCHEVI------SGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            NC +        SGK  ++  DYS+CNG C L +YWLG     Q   WQ Y  CVP+
Sbjct  134  NCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGF----QNEQWQSYVNCVPL  186

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 63/112 (56%), Gaps = 17/112 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QP+P++G  +      +G+T  GPCE++ID+ L L G NC  E+P G   
Sbjct  86   CGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPDE  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                   TIDYS C   C +S++WLG  +Q E+  WQ + NC+ L+ S   T
Sbjct  146  SGKLSEMTIDYSSCNGDCMLSFYWLG--FQNEQ--WQSYVNCVPLTGSGKST  193

>PHYRA_79140
Length=424

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 63/106 (59%), Gaps = 18/106 (17%)

Query  302  RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
            +CG TD  A+PQPIP DG  +       G+TH GPCE++LDDT VL  DNC       +V
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  350  ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             S +T D+  DYS+CNG CTL  YWL  +  +    WQ Y  CVP+
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPL  186

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 54/114 (47%), Gaps = 17/114 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  +   QPIP++G          G+T  GPCEI++D+T+ L   NC  ++P G   
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                    +DYS C   C ++ +WL      +   WQ + NC+ LS S   T  
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAF----QNAQWQAYVNCVPLSGSGSATQT  195

>PHYCA_534473
Length=1050

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 89/335 (27%), Positives = 138/335 (41%), Gaps = 55/335 (16%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
            A+  Y  +R LMD + +Y        DCG T P       PT+G+   S G    GPCEI
Sbjct  72   AKNNYKDVRTLMDGNPVYGE------DCGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEI  125

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGI-KYQGERYSW  187
            W+D+ + L   +C   + +G          +DYS C    C + ++WL + + +G   S 
Sbjct  126  WLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGGGAS-  184

Query  188  QVFKNCINLSASALVTMIGLQHprsalpalalaaaafvatnapqaMAHQLVILPAPTYTV  247
               +N       +        +  +       +     A+ +  + A   +    P    
Sbjct  185  ---QNTPTTGDGSSTQQQSPDNGSNTQQQSPPSTGDSPASKSDDSPASSRLRGEPPVGIQ  241

Query  248  EGKDNRWKPLAFLEGQNFSTTDDFVGYLD-ANGFDSLRAFMDDDSLYSVNASADFR----  302
              K + W  +  ++ Q       + G  D A G D L A   +  L + N + D R    
Sbjct  242  RQKTSEW--IVQIDPQ-------WKGDWDGAKGDDGLVALYKE--LKASNNAKDIRTLLD  290

Query  303  ---------CGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351
                     CG+T+PD  P+ P  DG    S G  H GPCE+WLDD  VL +D+C     
Sbjct  291  SDTKLYGADCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLSNDDCQSAYG  350

Query  352  GKTYD-------LDYSAC-NGSCTLYWYWLGVRYL  378
              T +       +DYS+C +G C   +YWL ++ L
Sbjct  351  DGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 71/134 (53%), Gaps = 17/134 (13%)

Query  271  FVGYLDANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPD--AAPQPIPDGIMRSTGYTH  327
            +    ++NG+  +R  +D D+ LY  N      CGFTDPD  A   P       S G  H
Sbjct  841  YASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVH  894

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLK  379
             GPCE+WLDDT+VL +D+C       T +       +DYS+C+ S C L +YWL  + + 
Sbjct  895  AGPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  954

Query  380  QVYSWQVYKACVPI  393
                WQVYK CVP+
Sbjct  955  SKIVWQVYKDCVPL  968

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 62/128 (48%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMD-DDSLYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
            +N    +R  +D D  LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  542  SNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEI  595

Query  334  WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T         +DYS+C  G C   +YWL ++       WQ
Sbjct  596  WLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQ  655

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  656  VYKNCIPL  663

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 78/167 (47%), Gaps = 29/167 (17%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDD----------FVGYLDANGFDS  282
             AH  +  PAP++  + + N W  +  +E Q     D+          F      N +  
Sbjct  22   QAHGYIAKPAPSWK-DKETNDW--VVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKD  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
            +R  MD + +Y  +      CGFTDP   P  P  DG    S G  H GPCE+WLDD  V
Sbjct  79   VRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMV  132

Query  341  LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLK  379
            LQ+D+C       T +       +DYS+C +G C L +YWL ++ LK
Sbjct  133  LQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLK  179

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query  80   RGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIW  137
             GY+ +R L+D D  LY        +CG T P+   +  PT G +  + G    GPCEIW
Sbjct  848  NGYSDIRTLLDSDTDLYGA------NCGFTDPDVTAKDPPTTGDATFSRGMVHAGPCEIW  901

Query  138  IDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQV  189
            +D+T  L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQV
Sbjct  902  LDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVWQV  961

Query  190  FKNCINLSASA  200
            +K+C+ L+  A
Sbjct  962  YKDCVPLTGPA  972

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 62/123 (50%), Gaps = 16/123 (13%)

Query  85   LRALMD-DDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
            +R ++D D  LY        DCG T P  + +  P+ G +  + G    GPCEIW+D+ +
Sbjct  548  IRTMIDADPKLYGE------DCGNTDPKAKPKDPPSTGDATFSRGIVHAGPCEIWLDDEM  601

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++WL ++ +  +  WQV+KNCI
Sbjct  602  VLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTLWQVYKNCI  661

Query  195  NLS  197
             L+
Sbjct  662  PLT  664

>PHYKE_2809
Length=291

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 68/128 (53%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
            AN    +R  +D D+ LY  +      CGFTDP A P+ P  DG    S G  H GPCE+
Sbjct  60   ANNVKDIRTMLDSDTKLYGQD------CGFTDPKATPKDPPTDGAATFSRGIVHAGPCEI  113

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T +       +DYS+C  G C   +YWL ++ L     WQ
Sbjct  114  WLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQ  173

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  174  VYKNCVPL  181

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 62/131 (47%), Gaps = 16/131 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
            A      +R ++D D  LY        DCG T P    +  PT+G+   S G    GPCE
Sbjct  59   AANNVKDIRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCE  112

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSW  187
            IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  113  IWLDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFW  172

Query  188  QVFKNCINLSA  198
            QV+KNC+ LS 
Sbjct  173  QVYKNCVPLSG  183

>PHYKE_6001
Length=289

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 73/143 (51%), Gaps = 16/143 (11%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  +   F     AN +  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  56   DGNNAQSVTAFNALKKANNYVDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPSDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSACN-GSCT-LYW  370
               S    H GPCE+WLDD  V   ++C+     +  D      +DYS+C+ G C  + +
Sbjct  110  ATYSRAIQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRF  169

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  170  YWLAFQGVDGKTVWQSYKNCIPL  192

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 64/128 (50%), Gaps = 15/128 (12%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWIDN  140
            Y  L+ LMDD  +Y        DCG T PN   QPIP++G    S      GPCEIW+D+
Sbjct  75   YVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDD  128

Query  141  TLALAGRNCHTEFPEGH------HTIDYSVC-GESCR-VSWFWLGIKYQGERYSWQVFKN  192
             +  +  +C+ ++   +        +DYS C G  C+ + ++WL  +    +  WQ +KN
Sbjct  129  KMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKN  188

Query  193  CINLSASA  200
            CI L  S 
Sbjct  189  CIPLEGSG  196

>PYIR_19612
Length=260

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 21/134 (16%)

Query  270  DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTH  327
            +F       GF +LR++++D             CGFTDP+ AP+ IP D  +R S   +H
Sbjct  62   NFATAAKEKGFATLRSYLEDKGAT---------CGFTDPNVAPRAIPADRKVRFSRDISH  112

Query  328  DGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQ  385
             GPCE+W+DD RV Q+D+C    +G   ++D+D++ C+G C + +YWL ++       WQ
Sbjct  113  PGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQ--ASGTRWQ  170

Query  386  VYKA------CVPI  393
            VY++      CVP+
Sbjct  171  VYRSELTRDLCVPV  184

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (47%), Gaps = 37/177 (21%)

Query  39   VVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVT  98
            V++YPPP        + GS   + + +   TA +      E+G+ATLR+ ++D G     
Sbjct  46   VIVYPPP--------WAGS---WKDPKNFATAAK------EKGFATLRSYLEDKGAT---  85

Query  99   EEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                  CG T PN   + IP +     +   +  GPCE+WID+       +C + F    
Sbjct  86   ------CGFTDPNVAPRAIPADRKVRFSRDISHPGPCELWIDDKRVYQNDDCESAFTGVV  139

Query  158  HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKN------CINLSASALVTMIG  206
             +  +D+++C   C + ++WL ++  G R  WQV+++      C+ +S S   T  G
Sbjct  140  PSWDVDWALCSGKCMIRFYWLSLQASGTR--WQVYRSELTRDLCVPVSGSGKATDSG  194

>PHALS_03176
Length=207

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 17/143 (12%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
             G    +   F     AN F  L+  MD  +  +       +CGF+DP   PQPIP DG 
Sbjct  56   NGNTQKSVKTFQKLKAANKFKDLKTLMDTSAFGA-------KCGFSDPKGKPQPIPKDGK  108

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCH------EVISGKTYDLDYSAC-NGSCT-LYW  370
               S    H GPCE+WLD+ +VL  D+C+      +V     + +DYS+C NG C  + +
Sbjct  109  ATFSRAIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRF  168

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL  + +     WQ YK C+P+
Sbjct  169  YWLAFQGVNGKTVWQSYKNCIPL  191

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 63/136 (46%), Gaps = 16/136 (12%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
            Q   A   +  L+ LMD     +        CG + P  + QPIP +G +  +      G
Sbjct  67   QKLKAANKFKDLKTLMDTSAFGA-------KCGFSDPKGKPQPIPKDGKATFSRAIVHTG  119

Query  133  PCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVCGE-SCR-VSWFWLGIKYQGER  184
            PCEIW+DN   L   +C++++       +    +DYS C    C+ + ++WL  +    +
Sbjct  120  PCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGK  179

Query  185  YSWQVFKNCINLSASA  200
              WQ +KNCI L  S+
Sbjct  180  TVWQSYKNCIPLQGSS  195

>PYAP_18711
Length=210

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G  +LRAF++         S    CG T+P+A  +PIP DG+++  
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLE---------SKGPECGRTNPNAKRKPIPSDGLIKFG  105

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCEVW D+T V    +C +     T + +DYS C G+C L +YWLG++   + 
Sbjct  106  SSMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGK-  164

Query  382  YSWQVYKACVPI  393
              WQ YK CVPI
Sbjct  165  -RWQSYKNCVPI  175

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 15/134 (11%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEI  136
            +RG   LRA ++  G          +CG T PN + +PIP++G  I  G +++  GPCE+
Sbjct  67   KRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDG-LIKFGSSMEHPGPCEV  116

Query  137  WIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCIN  195
            W DNTL  +  +C   F       IDYS C  +C + ++WLG++  G+R  WQ +KNC+ 
Sbjct  117  WFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGKR--WQSYKNCVP  174

Query  196  LSASALVTMIGLQH  209
            + ++     I  + 
Sbjct  175  IGSATKSRSIDAEE  188

>PITG_11936
Length=333

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 73/141 (52%), Gaps = 14/141 (10%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
            G     T +F     A+ + SL+ FM+D+ +  VN      CG+T+PDA PQP+P   + 
Sbjct  60   GSPTDNTANFNKGFAASKYKSLKEFMNDN-MVLVNEDFTKECGYTNPDATPQPLPKTYVE  118

Query  322  -----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYW  372
                   G+T  H+GPCEV+ D+TRV Q DNC +        L  D+ AC GS  L  YW
Sbjct  119  WSHGAGEGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYW  178

Query  373  LGVRYLKQVYSWQVYKACVPI  393
            + +       SWQVY  C P+
Sbjct  179  IALHSP----SWQVYINCAPL  195

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (47%), Gaps = 13/128 (10%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
             A   Y +L+  M+D+ +  V E+   +CG T P+   QP+P            G+TL  
Sbjct  73   FAASKYKSLKEFMNDN-MVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSH  131

Query  131  DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
            +GPCE++ D T      NC   FP     +  D+  C  S ++S +W+ +       SWQ
Sbjct  132  EGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL----HSPSWQ  187

Query  189  VFKNCINL  196
            V+ NC  L
Sbjct  188  VYINCAPL  195

>PHYRA_86016
Length=236

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 60/108 (56%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +DYS+CNG CTL  YWL  +  +    WQ Y  CVP+
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (48%), Gaps = 17/117 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                    +DYS C   C ++ +WL      +   WQ + NC+ L  S   T    Q
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPLKGSGSATQTQTQ  134

>PPTG_04619
Length=276

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEV  333
            +N    +R  +D D SLY  +      CG+T+PD  P+ P  DG    S G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTSLYGAD------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  126

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  186

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  187  VYKNCIPL  194

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCE  135
            A      +R L+D D  LY        DCG T P+   +  PT+G+   S G    GPCE
Sbjct  72   ASNNAKDIRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCE  125

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  188  QVFKNCINLSASA  200
            QV+KNCI LS  A
Sbjct  186  QVYKNCIPLSGPA  198

>PHYRA_73582
Length=326

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/180 (36%), Positives = 82/180 (46%), Gaps = 28/180 (16%)

Query  233  MAHQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDD-----FVGYLDANGFDSL  283
             AH  +  PAPT+  E + N W     PL +  G + S  DD     F      N +  L
Sbjct  22   QAHGYIANPAPTWKKE-ETNDWVVEIAPL-WKGGWDESKGDDGILAVFKELSATNNYKDL  79

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEVWLDDTRVL  341
            +  MD              CGFTDP+  P  P  DG    S G  H GPCE+WLDD  VL
Sbjct  80   KTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVL  132

Query  342  QHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            Q+D+C       T +       +DYS C  G C L +YWL ++ L     WQ YK C+P+
Sbjct  133  QNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPL  192

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 62/132 (47%), Gaps = 16/132 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
            A   Y  L+ LMD         E   DCG T PN      PT+G+   S G    GPCEI
Sbjct  72   ATNNYKDLKTLMDG-------PEFGEDCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEI  124

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQ  188
            W+D+ + L   +C + + +G          +DYS C    C + ++WL ++    +  WQ
Sbjct  125  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQ  184

Query  189  VFKNCINLSASA  200
             +KNCI L+  A
Sbjct  185  SYKNCIPLTGPA  196

>PHYRA_73584
Length=287

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +NG+  +R  +D D+ LY  N      CGFT+PDA  +  P       S G  H GPCE+
Sbjct  72   SNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRGMVHAGPCEI  125

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
            WLDDT VL +D+C       + +       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  126  WLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQ  185

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  186  VYKDCVPL  193

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (52%), Gaps = 16/132 (12%)

Query  79   ERGYATLRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
              GY+ +R L+D D  LY        +CG T P+   +  PT G +  + G    GPCEI
Sbjct  72   SNGYSDIRTLLDSDTTLYGA------NCGFTNPDATAKDPPTTGDATFSRGMVHAGPCEI  125

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
            W+D+TL L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQ
Sbjct  126  WLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTVWQ  185

Query  189  VFKNCINLSASA  200
            V+K+C+ L+  A
Sbjct  186  VYKDCVPLTGPA  197

>PHYRA_83500
Length=394

 Score = 91.3 bits (225),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 62/106 (58%), Gaps = 18/106 (17%)

Query  302  RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
            +CG TD  A+PQPIP DG  +       G+TH GPCE++LDDT VL  DNC       +V
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  350  ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             S +T D+  DYS+CNG CTL  YWL  +  +    WQ Y  C P+
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPL  186

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 17/114 (15%)

Query  105  CGLTFPNTETQPIPTNGSF-----ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  +   QPIP++G          G+T  GPCEI++D+T+ L   NC  ++P G   
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                    +DYS C   C ++ +WL      +   WQ + NC  LS S   T  
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAF----QNAQWQAYVNCAPLSGSGSATQT  195

>PHYKE_2937
Length=366

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +NG+  +R  +D D SLY  +      CG+T+PDA  +  P       S G  H GPCE+
Sbjct  79   SNGYSDIRTLLDSDTSLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  132

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
            WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  133  WLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVWQ  192

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  193  VYKDCVPL  200

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  131

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  188  QVFKNCINLSASA  200
            QV+K+C+ L+  A
Sbjct  192  QVYKDCVPLTGPA  204

>PHYSO_533747
Length=206

 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 75/137 (55%), Gaps = 17/137 (12%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DG-I  319
            G    + + F     AN F  L+  +DD SLY  +      CGFTDP+  PQPIP DG  
Sbjct  58   GNTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGPD------CGFTDPNGTPQPIPTDGKA  111

Query  320  MRSTGYTHDGPCEVWLDDTRVLQHDNC-----HEVISGKT-YDLDYSAC-NGSCTLY-WY  371
            + S G  H GPCE WLDD +VL  D+C     H  ++ KT + +DYS+C NG C +  +Y
Sbjct  112  VFSRGLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFY  171

Query  372  WLGVRYLKQVYS-WQVY  387
            WLG + L    + WQ Y
Sbjct  172  WLGFQALDDKKTVWQTY  188

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (49%), Gaps = 20/127 (16%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIWI  138
              +  L+ ++DD  LY        DCG T PN   QPIPT+G  + S G    GPCE W+
Sbjct  74   NNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWL  127

Query  139  DNTLALAGRNCHTEFPEGHHT--------IDYSVC--GESCRVSWFWLGIKYQGERYS-W  187
            D+   L   +C++E+  GH          IDYS C  G    + ++WLG +   ++ + W
Sbjct  128  DDKKVLYADDCYSEY--GHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVW  185

Query  188  QVFKNCI  194
            Q +   +
Sbjct  186  QTYSTLL  192

>PPTG_04647
Length=327

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 69/128 (54%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +NG+  +R  +D D+ LY  +      CG+T+PDA  +  P       S G  H GPCE+
Sbjct  74   SNGYSDIRTLLDSDTDLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVHVGPCEI  127

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
            WLDDT VL +DNC       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  128  WLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  187

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  188  VYKDCVPL  195

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  75   TWLAERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
            T  +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    G
Sbjct  70   TLKSSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVG  123

Query  133  PCEIWIDNTLALAGRNCHTEFPEG-------HHTIDYSVCGES-CRVSWFWLGIKYQGER  184
            PCEIW+D+T+ L+  NC T + +G          +DYS C  S C + ++WL  +    +
Sbjct  124  PCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSK  183

Query  185  YSWQVFKNCINLSASA  200
              WQV+K+C+ L+  A
Sbjct  184  MVWQVYKDCVPLTGPA  199

>PHYRA_73606
Length=366

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 71/134 (53%), Gaps = 17/134 (13%)

Query  271  FVGYLDANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTH  327
            + G   +NG+  +R  +D D SLY  +      CG+T+PDA  +  P       S G  H
Sbjct  69   YTGLKSSNGYSDIRTLLDSDTSLYGAD------CGYTNPDATAKDPPTTGDATFSRGMVH  122

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLK  379
             GPCE+WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + + 
Sbjct  123  VGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  182

Query  380  QVYSWQVYKACVPI  393
                WQVYK CVP+
Sbjct  183  SEIVWQVYKDCVPL  196

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 67/131 (51%), Gaps = 16/131 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            +  GY+ +R L+D D  LY        DCG T P+   +  PT G +  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  188  QVFKNCINLSA  198
            QV+K+C+ L+ 
Sbjct  188  QVYKDCVPLTG  198

>PHYSO_484051
Length=285

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 70/129 (54%), Gaps = 17/129 (13%)

Query  276  DANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCE  332
            ++NG+  +R  +D D SLY  +      CGFT+PDA+P+  P       S    H  PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGAD------CGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  333  VWLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSW  384
            +WLDDT VL +D+C       T +       +DYS+C+ S C L +YWL  + +     W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  385  QVYKACVPI  393
            QVYK CVP+
Sbjct  188  QVYKDCVPL  196

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query  79   ERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDG-PCEI  136
              GY+ +R L+D D  LY        DCG T P+   +  PT G    S   +   PCEI
Sbjct  75   SNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  128

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQ  188
            W+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +    +  WQ
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVWQ  188

Query  189  VFKNCINLSASA  200
            V+K+C+ L+  A
Sbjct  189  VYKDCVPLTGPA  200

>PYU1_G005324
Length=191

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  105

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  382  YSWQVYKACVPI  393
              WQ YK CVP+
Sbjct  165  -RWQSYKNCVPL  175

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  138  IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +KNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  197  SASALVTM  204
             +S L ++
Sbjct  176  KSSKLRSL  183

>PYU1_G005326
Length=191

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  105

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  382  YSWQVYKACVPI  393
              WQ YK CVP+
Sbjct  165  -RWQSYKNCVPL  175

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  138  IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +KNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  197  SASALVTM  204
             +S L ++
Sbjct  176  KSSKLRSL  183

>PYU1_G005328
Length=191

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 72/132 (55%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  105

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  382  YSWQVYKACVPI  393
              WQ YK CVP+
Sbjct  165  -RWQSYKNCVPL  175

 Score = 79.0 bits (193),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 13/128 (10%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  138  IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +KNC+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  197  SASALVTM  204
             +S L ++
Sbjct  176  KSSKLRSL  183

>PYIW_16810
Length=216

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 80/171 (47%), Gaps = 15/171 (9%)

Query  234  AHQLVILPAPTY--TVEGKDNRWK-PLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDD  290
            AH  + LPAPT+  + + K N W   +   +    +T   F      NGF SLRAF+ D+
Sbjct  25   AHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIMDN  84

Query  291  SL---YSVNASADF-RCGFTDPDAAPQPIPDGI-MRSTGYTHDGPCEVWLDDTRVLQHD-  344
                 Y    S     CGFTDP+  PQP+PD +      + H+GPCE W DD  V+    
Sbjct  85   QTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLVMPFTA  144

Query  345  NCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +C     G    + Y  + C G   L++YWL       V  +Q Y  CVPI
Sbjct  145  SCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATF----VSPFQAYTNCVPI  191

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (43%), Gaps = 11/135 (8%)

Query  79   ERGYATLRALMDDD---GLYSVTEEG-LFDCGLTFPNTETQPIPTNGSFITSGYTLDGPC  134
            + G+ +LRA + D+   G Y     G   +CG T PN   QP+P    +    +  +GPC
Sbjct  71   KNGFKSLRAFIMDNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPC  130

Query  135  EIWIDNTLAL---AGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFK  191
            E W D+ L +   A    +    +     D + C     + ++WL          +Q + 
Sbjct  131  EAWCDDVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFVS----PFQAYT  186

Query  192  NCINLSASALVTMIG  206
            NC+ + + A  ++ G
Sbjct  187  NCVPIKSGAARSLDG  201

>PHYRA_86752
Length=300

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +DYS+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPL  186

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (48%), Gaps = 17/117 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                    +DYS C   C ++ +WL      +   WQ + NC+ L  S   T    Q
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVPLKGSGSATQTQTQ  198

>PYAR_14260
Length=212

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 14/133 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-  321
             F T   +       GF +LR+F++         S    CG +   A P+PIP DG+++ 
Sbjct  30   KFKTGAQYAAVAPGKGFKNLRSFLE---------SKGPTCGNSLSSAKPKPIPSDGMVKF  80

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
            ++   H GPCE+WLD+T     D+C +   S  +  +++SAC GSC L +YWLG++    
Sbjct  81   ASTLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DS  138

Query  381  VYSWQVYKACVPI  393
               WQ YK CVP+
Sbjct  139  GTRWQSYKNCVPL  151

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 69/130 (53%), Gaps = 19/130 (15%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD--GPCEIW  137
            +G+  LR+ ++  G           CG +  + + +PIP++G  +    TL+  GPCEIW
Sbjct  44   KGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDG-MVKFASTLEHPGPCEIW  93

Query  138  IDNTLALAGRNCHTEFPEGHHT---IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            +D T+A    +C  +F  G  T   +++S C  SC + ++WLG++  G R  WQ +KNC+
Sbjct  94   LDETMAFHSDDCEKQF--GSSTSVKVNFSACKGSCMLRFYWLGLQDSGTR--WQSYKNCV  149

Query  195  NLSASALVTM  204
             L      +M
Sbjct  150  PLGGGKSRSM  159

>CCI47381
Length=211

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 76/145 (52%), Gaps = 24/145 (17%)

Query  260  LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--D  317
             +G     T  F+    ++ F +LR F+ D   Y         CG T+P+A+P+PIP  +
Sbjct  52   FDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIPADN  102

Query  318  GIM-----RSTGY--THDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTL  368
             I+        G+  +H GPCEVWL +TRV   DNC  H   S     +++S+C+G C L
Sbjct  103  AIVWENPDTREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLL  162

Query  369  YWYWLGVRYLKQVYSWQVYKACVPI  393
             ++WL +   +    WQVYK C+PI
Sbjct  163  QFFWLALHEPQ----WQVYKNCIPI  183

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 59/137 (43%), Gaps = 23/137 (17%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGY  128
            T  A   + TLR  + D G Y         CG T PN   +PIP + + +        G+
Sbjct  65   TAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGF  115

Query  129  TLD--GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGER  184
                 GPCE+W+  T      NC   F        I++S C   C + +FWL +      
Sbjct  116  VASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLAL----HE  171

Query  185  YSWQVFKNCINLSASAL  201
              WQV+KNCI ++ + +
Sbjct  172  PQWQVYKNCIPIAPNGI  188

>PHALS_05392
Length=367

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 86/182 (47%), Gaps = 33/182 (18%)

Query  234  AHQLVILPAPTYTVEGKDN-------RWKPLAFLEGQNFSTTDD-----FVGYLDANGFD  281
            AH  +  PAP++  + + +       +WK      G + S+ D+     F     AN F 
Sbjct  106  AHGYIADPAPSWKGKKRSDWVVEIEPQWK-----GGWDQSSGDEGLLSTFKELATANNFK  160

Query  282  SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMRSTGYTHDGPCEVWLDDTR  339
             +R+ MD + +Y  +      CG+TDP+  P   P       S G  H GPCE+WLDD  
Sbjct  161  DVRSLMDGNPVYGED------CGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDDKM  214

Query  340  VLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQVYKACV  391
            VLQ+D+C       T +       +DYS+C    C L +YWL ++ L     WQ YK C+
Sbjct  215  VLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKNCI  274

Query  392  PI  393
            P+
Sbjct  275  PL  276

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 64/130 (49%), Gaps = 15/130 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWI  138
              +  +R+LMD + +Y        DCG T PN      P+NG +  + G    GPCEIW+
Sbjct  157  NNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWL  210

Query  139  DNTLALAGRNCHTEFPEGHHT-------IDYSVCG-ESCRVSWFWLGIKYQGERYSWQVF  190
            D+ + L   +C   + +G          +DYS C  + C + ++WL ++    +  WQ +
Sbjct  211  DDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAY  270

Query  191  KNCINLSASA  200
            KNCI L+  A
Sbjct  271  KNCIPLNGPA  280

>CCA17179
Length=185

 Score = 85.5 bits (210),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 70/145 (48%), Gaps = 24/145 (17%)

Query  260  LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP---  316
             +G     T  F+    ++ F +LR F+ D   Y         CG T+P+A P+PIP   
Sbjct  26   FDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADH  76

Query  317  ----DGIMRSTGY--THDGPCEVWLDDTRVLQHDNCHEVI--SGKTYDLDYSACNGSCTL  368
                +      G+  +H GPCEVWL++ RV   DNC E    S     +D+S C   C L
Sbjct  77   AIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLL  136

Query  369  YWYWLGVRYLKQVYSWQVYKACVPI  393
             ++WL +   +    WQVYK C+PI
Sbjct  137  QFFWLALHEPQ----WQVYKNCIPI  157

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 58/135 (43%), Gaps = 23/135 (17%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGYTL  130
             A   +  LR  + D G Y         CG T PN + +PIP + + +        G+  
Sbjct  41   FASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPDTKEGFVA  91

Query  131  D--GPCEIWIDNTLALAGRNCHTEF--PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
               GPCE+W++        NC   F        ID+S C   C + +FWL +        
Sbjct  92   SHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWLAL----HEPQ  147

Query  187  WQVFKNCINLSASAL  201
            WQV+KNCI ++ + +
Sbjct  148  WQVYKNCIPIAPNGI  162

>PYU1_G005325
Length=207

 Score = 85.9 bits (211),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 72/132 (55%), Gaps = 14/132 (11%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-S  322
            F T   +       G+  L++F+D         S    CG T  +A  + IP DG+++ +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLD---------SKGPTCGNTLSNAKAKAIPKDGMLKFA  105

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            +   H GPCE+WL +TR   +D+C +   S  ++ +D+SAC G+C L +YWLG++   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  382  YSWQVYKACVPI  393
              WQ YK C+P+
Sbjct  165  -RWQSYKNCIPL  175

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 13/120 (11%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIW  137
            ++GY  L++ +D  G           CG T  N + + IP +G     S     GPCEIW
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  138  IDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            + NT A    +C   F       ID+S C  +C + ++WLG++  G+R  WQ +KNCI L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCIPL  175

>PYAR_24113
Length=192

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 81/173 (47%), Gaps = 20/173 (12%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLE---GQNFS-----TTDDFVGYLDANGFDSLRA  285
            AH  +I PAP YT    ++    +  L+   G+ FS         F      + + SL+ 
Sbjct  21   AHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLKE  80

Query  286  FMDDDSLYSVNASADFRCGF-TDPDAAPQPIPDGIM--RSTGYTHDGPCEVWLDDTRVLQ  342
             +  +   S  A+A+  CGF T   A PQP+PD +     TG +H GPCEVW D+    Q
Sbjct  81   LVLQNQKVSAGATAE--CGFATLSGATPQPLPDVVEWDEFTG-SHTGPCEVWCDNNLAFQ  137

Query  343  HDNCHEVISGKTYDLDYS--ACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             DNC + I G    L+Y   AC G+  L  YW+ +        WQVY  C P+
Sbjct  138  DDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIAL----HTAEWQVYTGCAPL  186

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 9/119 (8%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGL-TFPNTETQPIPTNGSFITSGYTLDGPCEIWIDN  140
            Y +L+ L+  +    V+     +CG  T      QP+P    +     +  GPCE+W DN
Sbjct  75   YKSLKELVLQN--QKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDN  132

Query  141  TLALAGRNCHTEFPEGHHTIDYS--VCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
             LA    NC          ++Y    C  +  ++ +W+ +        WQV+  C  LS
Sbjct  133  NLAFQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIAL----HTAEWQVYTGCAPLS  187

>PPTG_03139
Length=320

 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 86/179 (48%), Gaps = 31/179 (17%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQ------NF--STTDDFVGY---LDANGFDSL  283
            H  + +P   +T  G   ++  +A +E        NF  S TD+   +     A+ + SL
Sbjct  24   HGYMSVPKVEFTFNGDTTQY--MATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSL  81

Query  284  RAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
            + FM D  +     S DF   CG+T+PD  PQP+P+  +        G+T  H+GPCEVW
Sbjct  82   KEFMTDKMVL---VSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVW  138

Query  335  LDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
             DDTRV Q DNC +        L  D+ AC GS  L  YW+ +       SWQVY  C 
Sbjct  139  CDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALHSP----SWQVYINCA  193

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 62/128 (48%), Gaps = 13/128 (10%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIP------TNGSFITSGYTL  130
             A   Y++L+  M D  +  V+++   +CG T P+   QP+P      ++GS      + 
Sbjct  73   FAASKYSSLKEFMTDK-MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASH  131

Query  131  DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQ  188
            +GPCE+W D+T      NC   FP     +  D+  C  S R+S +W+ +       SWQ
Sbjct  132  EGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL----HSPSWQ  187

Query  189  VFKNCINL  196
            V+ NC  L
Sbjct  188  VYINCAAL  195

>PYAP_24689
Length=252

 Score = 86.7 bits (213),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 14/119 (12%)

Query  278  NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWL  335
            +G  +LRAF++         S    CG T+P+A  +PIP DG+++  +   H GPCE+W 
Sbjct  71   HGVKTLRAFLE---------SKGPVCGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWF  121

Query  336  DDTRVLQHDNCHEVISGKT-YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D+TRV    +C++     T + +DYS C G C L +YWLG++   +   WQ YK CVP+
Sbjct  122  DNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGK--RWQSYKNCVPL  178

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 15/133 (11%)

Query  67   VHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS  126
            + T  +      + G  TLRA ++  G           CG T PN + +PIP +G  I  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDG-LIKF  107

Query  127  GYTLD--GPCEIWIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQGE  183
            G +++  GPCEIW DNT      +C+  F       IDYS C   C + ++WLG++  G+
Sbjct  108  GSSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGK  167

Query  184  RYSWQVFKNCINL  196
            R  WQ +KNC+ L
Sbjct  168  R--WQSYKNCVPL  178

>PHYKE_6078
Length=317

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 77/157 (49%), Gaps = 16/157 (10%)

Query  246  TVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGF  305
            T+E  D+         G     T  F    +++ + SL+ F++D +  +V   A   CG 
Sbjct  46   TIEASDSGLS--GTFNGAPADNTAAFTTAFESSSYSSLKEFINDKATITVT-DATLTCGS  102

Query  306  TDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL-  357
             DPD A Q +PD  +      S G+T  H+GPCEVW DDTRV Q D+C    +     L 
Sbjct  103  CDPDEAAQALPDTYVEWAHSDSEGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLP  162

Query  358  -DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             D+ AC GS T+  YWL +       +WQVY  C P+
Sbjct  163  FDHDACLGSSTVTLYWLAL----HSSTWQVYVNCAPL  195

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (45%), Gaps = 13/130 (10%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
            T      Y++L+  ++D    +VT+  L  CG   P+   Q +P          + G+T 
Sbjct  71   TAFESSSYSSLKEFINDKATITVTDATL-TCGSCDPDEAAQALPDTYVEWAHSDSEGFTA  129

Query  131  --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+T      +C  ++      +  D+  C  S  V+ +WL +       +
Sbjct  130  SHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALHSS----T  185

Query  187  WQVFKNCINL  196
            WQV+ NC  L
Sbjct  186  WQVYVNCAPL  195

>PHYSO_459106
Length=223

 Score = 85.5 bits (210),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            AN    +R  +D D+ LY  +      CGFTDP   PQ  P       S G  H GPCE+
Sbjct  73   ANNVKDIRTMIDSDTKLYGED------CGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEI  126

Query  334  WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++       WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQ  186

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  187  VYKNCIPL  194

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 63/126 (50%), Gaps = 16/126 (13%)

Query  85   LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
            +R ++D D  LY        DCG T P  + Q  PT G +  + G    GPCEIW+D+ +
Sbjct  79   IRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIWLDDKM  132

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++WL ++ +  +  WQV+KNCI
Sbjct  133  VLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQVYKNCI  192

Query  195  NLSASA  200
             L+  A
Sbjct  193  PLTGPA  198

>PHYSO_524101
Length=308

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 71/143 (50%), Gaps = 14/143 (10%)

Query  260  LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI  319
              G     T  F    +++ + SL+  ++D +  +V   A   CG  DPD   QP+PD  
Sbjct  58   FNGAPADNTAAFTTAFESSSYSSLKELINDKATITVT-DATLTCGMCDPDETAQPLPDTY  116

Query  320  MR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYW  370
            +      S G+T  H+GPCEVW DD RV Q D+C    +    +L Y   AC GS TL +
Sbjct  117  VEWAHSDSEGFTASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTF  176

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL +       +WQVY  C P+
Sbjct  177  YWLAL----HSSTWQVYVNCAPL  195

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (47%), Gaps = 13/133 (10%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
            T      Y++L+ L++D    +VT+  L  CG+  P+   QP+P          + G+T 
Sbjct  71   TAFESSSYSSLKELINDKATITVTDATL-TCGMCDPDETAQPLPDTYVEWAHSDSEGFTA  129

Query  131  --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+       +C  ++      + Y    C  S  ++++WL +       +
Sbjct  130  SHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALHSS----T  185

Query  187  WQVFKNCINLSAS  199
            WQV+ NC  L A+
Sbjct  186  WQVYVNCAPLEAT  198

>PHALS_03177
Length=259

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 85/176 (48%), Gaps = 23/176 (13%)

Query  234  AHQLVILPAPTYTVEGKDN---RWKPL---AFLEGQNFSTTDDFVGYLDANGFDSLRAFM  287
            +H  + +P   +  +G D    + +PL   +   G    +   F     AN F  L+  M
Sbjct  23   SHGYMYIPRTQFKGQGNDGWIVQIEPLWKSSDWNGNTQKSVKAFQSLKAANNFKDLKTLM  82

Query  288  DDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQHDN  345
            D+  L          CG++DP+  PQPIP DG    S    H GPCE+WLD+ +VL  D+
Sbjct  83   DNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRAMVHTGPCEMWLDNKKVLYEDD  135

Query  346  CH------EVISGKTYDLDYSAC-NGSCT-LYWYWLGVRYLKQVYSWQVYKACVPI  393
            C+      +V     + +DYS+C NG C  + +YWL  + +     WQ YK C+P+
Sbjct  136  CYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQSYKMCIPL  191

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 64/132 (48%), Gaps = 16/132 (12%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDG  132
            Q+  A   +  L+ LMD+  L         DCG + PN + QPIP +G +  +      G
Sbjct  67   QSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSRAMVHTG  119

Query  133  PCEIWIDNTLALAGRNCHTEFP------EGHHTIDYSVC--GESCRVSWFWLGIKYQGER  184
            PCE+W+DN   L   +C++++       +    +DYS C  G   ++ ++WL  +    +
Sbjct  120  PCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGK  179

Query  185  YSWQVFKNCINL  196
              WQ +K CI L
Sbjct  180  TFWQSYKMCIPL  191

>PHYRA_78176
Length=312

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 14/132 (11%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
            F    +++ + SL+ F+DD +  +V   A   CG  DPD   QP+P+  +      S G+
Sbjct  70   FTTAFESSSYSSLKEFIDDKATITVT-DATLTCGACDPDETAQPLPETYVEWAHSDSEGF  128

Query  326  T--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQV  381
            T  H+GPCEVW DD RV Q D+C    +     L  D+ AC GS  L +YWL +      
Sbjct  129  TASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLAL----HS  184

Query  382  YSWQVYKACVPI  393
             +WQVY  C P+
Sbjct  185  STWQVYVNCAPL  196

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (46%), Gaps = 13/133 (10%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
            T      Y++L+  +DD    +VT+  L  CG   P+   QP+P          + G+T 
Sbjct  72   TAFESSSYSSLKEFIDDKATITVTDATL-TCGACDPDETAQPLPETYVEWAHSDSEGFTA  130

Query  131  --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+       +C  +F      +  D+  C  S  ++++WL +       +
Sbjct  131  SHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALHSS----T  186

Query  187  WQVFKNCINLSAS  199
            WQV+ NC  L +S
Sbjct  187  WQVYVNCAPLESS  199

>PHYRA_73583
Length=630

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 69/128 (54%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
            +N    +R  +D D+ LY  N      CG+T+PDA+P+  P       S G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEI  126

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T +       +DYS+C +G C   +YWL ++ L     WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQ  186

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  187  VYKNCIPL  194

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
            +N    +R  +D D+ LY  +      CGFTDP A P+  P       S G  H GPCEV
Sbjct  374  SNNIKDIRTMIDSDTKLYGAD------CGFTDPKATPKDPPSTGDATFSRGMVHAGPCEV  427

Query  334  WLDDTRVLQHDNCHEVISGKT-------YDLDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T         +DYS+C  G C   ++WL ++       WQ
Sbjct  428  WLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQ  487

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  488  VYKNCVPL  495

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            A      +R ++D D  LY        DCG T P    +  P+ G +  + G    GPCE
Sbjct  373  ASNNIKDIRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCE  426

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVC-GESCRVSWFWLGIKYQGERYSW  187
            +W+D+ + L   +C + + +G          IDYS C    C   +FWL ++ +  +  W
Sbjct  427  VWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWW  486

Query  188  QVFKNCINLSASA  200
            QV+KNC+ LS  A
Sbjct  487  QVYKNCVPLSGPA  499

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            A      +R L+D D  LY        +CG T P+   +  P+ G +  + G    GPCE
Sbjct  72   ASNNAKDIRTLLDSDTTLYGA------NCGYTNPDASPKDPPSTGDATFSRGIVHAGPCE  125

Query  136  IWIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSW  187
            IW+D+ + L   +C + + +G          +DYS C    C   ++WL ++    +  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWW  185

Query  188  QVFKNCINLSASA  200
            QV+KNCI LS  A
Sbjct  186  QVYKNCIPLSGPA  198

>PPTG_07507
Length=299

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  P+PIP DG ++       G+TH GPCE+++DD  VL  DNC E   G 
Sbjct  82   DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGG  141

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +D+S+CNG CTL  YWLG     Q   WQ Y  CVP+
Sbjct  142  PDGSEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPL  185

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 17/113 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + +PIP +G          G+T  GPCE++ID+ + L G NC  +FP G   
Sbjct  85   CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  144

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
                    +D+S C   C ++ +WLG     +   WQ + NC+ L  S   T 
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPLQGSGSATQ  193

>PPTG_07509
Length=299

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  P+PIP DG ++       G+TH GPCE+++DD  VL  DNC E   G 
Sbjct  82   DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGG  141

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +D+S+CNG CTL  YWLG     Q   WQ Y  CVP+
Sbjct  142  PDGSEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPL  185

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 17/113 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + +PIP +G          G+T  GPCE++ID+ + L G NC  +FP G   
Sbjct  85   CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDG  144

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
                    +D+S C   C ++ +WLG     +   WQ + NC+ L  S   T 
Sbjct  145  SEKMSEMPVDFSSCNGKCTLTIYWLGF----QNAQWQAYVNCVPLQGSGSATQ  193

>PHYCA_97965
Length=288

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  PQPIP DGI++       G+TH GPCE+++DD  VL  D+C +   G 
Sbjct  85   DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGG  144

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +D+S+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  145  AKGSDKMSEMSVDFSSCNGKCTLTIYWLAF----QNEQWQSYVNCVPL  188

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 57/113 (50%), Gaps = 17/113 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QPIP++G          G+T  GPCEI+ID+ + L G +C  EFP G   
Sbjct  88   CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKG  147

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
                   ++D+S C   C ++ +WL   +Q E+  WQ + NC+ L      T 
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLA--FQNEQ--WQSYVNCVPLQGDGSATQ  196

>PHYRA_83494
Length=224

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 60/108 (56%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------  347
            D +CG TD  AAPQ +P DG  +       G+TH GPCE+++DD  VL  DNC       
Sbjct  20   DKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGG  79

Query  348  EVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            +V S  T D+  DYS+CNG CT   YWL  +  +    WQ Y  CVP+
Sbjct  80   DVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPL  123

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 52/114 (46%), Gaps = 17/114 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  +   Q +PT+G          G+T  GPCEI+ID+ + L G NC  ++P G   
Sbjct  23   CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  82

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMI  205
                    +DYS C   C  + +WL      +   WQ + NC+ L+ S   T  
Sbjct  83   STVTSDMPVDYSSCNGDCTFTIYWLAF----QNAQWQAYVNCVPLTGSGSTTQT  132

>PPTG_03156
Length=445

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 88/179 (49%), Gaps = 25/179 (14%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQ--------NFSTTDDFVGYLDA---NGFDS  282
            AH  +  PA T++ E  D + + +A +E          N +  D+   +  A   + + S
Sbjct  20   AHGWLSKPAATFSNEAGD-KSQFIATIEASSSGFKGTFNTAPADNVASFTKAFATSTYKS  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLD  336
            L+AF+DD +  +V   A   CG  +PDA  QP+PD +      S G+T  H+GPCE W D
Sbjct  79   LKAFIDDKAKITVTG-ATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCEAWCD  137

Query  337  DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              RV   +NC         ++ Y  S C+G+ TL +YW+ +       +WQVY  C P+
Sbjct  138  SERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVYVNCAPL  192

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 57/127 (45%), Gaps = 12/127 (9%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--D  131
             A   Y +L+A +DD    +VT   L  CG   P+   QP+P    +  S   G+T   +
Sbjct  71   FATSTYKSLKAFIDDKAKITVTGATL-TCGNAEPDATAQPLPDKLEWYHSESEGFTASHE  129

Query  132  GPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQV  189
            GPCE W D+       NC   F      + Y  S C  +  ++++W+ +       +WQV
Sbjct  130  GPCEAWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAM----HGPTWQV  185

Query  190  FKNCINL  196
            + NC  L
Sbjct  186  YVNCAPL  192

>PHYCA_12943
Length=287

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  PQPIP DGI++       G+TH GPCE+++DD  VL  D+C +   G 
Sbjct  85   DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGG  144

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +D+S+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  145  PDGSDKMSEMSVDFSSCNGKCTLTIYWLAF----QNEQWQSYVNCVPL  188

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 57/113 (50%), Gaps = 17/113 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QPIP++G          G+T  GPCEI+ID+ + L G +C  EFP G   
Sbjct  88   CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDG  147

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
                   ++D+S C   C ++ +WL   +Q E+  WQ + NC+ L      T 
Sbjct  148  SDKMSEMSVDFSSCNGKCTLTIYWLA--FQNEQ--WQSYVNCVPLQGDGSATQ  196

>PHYRA_85794
Length=230

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 18/109 (17%)

Query  299  ADFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            AD +CGFT  D  PQP+P             GYTH GPCE+++DD  VL  DNC     G
Sbjct  83   ADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPG  142

Query  353  KTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D        +DYS+CNG CT   YWLG +  +    WQ Y  CVP+
Sbjct  143  GPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 24/143 (17%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
            +T  AE+G +    ++D  G           CG T  + + QP+PTNG  +       GY
Sbjct  63   KTMAAEKGVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGY  115

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGIKY  180
            T  GPCE++ID+ + L   NC  ++P G +         +DYS C   C  S +WLG   
Sbjct  116  THVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF--  173

Query  181  QGERYSWQVFKNCINLSASALVT  203
              +   WQ + NC+ LS +   T
Sbjct  174  --QNAQWQAYINCVPLSGTGETT  194

>PHYRA_77971
Length=230

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 56/109 (51%), Gaps = 18/109 (17%)

Query  299  ADFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352
            AD +CGFT  D  PQP+P             GYTH GPCE+++DD  VL  DNC     G
Sbjct  83   ADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPG  142

Query  353  KTYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               D        +DYS+CNG CT   YWLG +  +    WQ Y  CVP+
Sbjct  143  GPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 67/143 (47%), Gaps = 24/143 (17%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
            +T  AE+G +    ++D  G           CG T  + + QP+PTNG  +       GY
Sbjct  63   KTMAAEKGVSVRDVVLDMVGADK-------KCGFTRTDVDPQPVPTNGKAVWLGNDGGGY  115

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGIKY  180
            T  GPCE++ID+ + L   NC  ++P G +         +DYS C   C  S +WLG   
Sbjct  116  THVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGF--  173

Query  181  QGERYSWQVFKNCINLSASALVT  203
              +   WQ + NC+ LS +   T
Sbjct  174  --QNAQWQAYINCVPLSGTGETT  194

>PHYCA_531163
Length=314

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDD-SLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +NG+  +R  +D D SLY  +      CG+T+ DA  +  P       S G  H GPCE+
Sbjct  75   SNGYSDIRTLLDSDTSLYGAD------CGYTNADATAKDPPSTGDATFSRGMVHVGPCEI  128

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSACNGS-CTLYWYWLGVRYLKQVYSWQ  385
            WLDDT VL +D+C       T D       +DYS+C+ S C L +YWL  + +     WQ
Sbjct  129  WLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVWQ  188

Query  386  VYKACVPI  393
            VYK CVP+
Sbjct  189  VYKDCVPL  196

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 67/133 (50%), Gaps = 16/133 (12%)

Query  78   AERGYATLRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCE  135
            +  GY+ +R L+D D  LY        DCG T  +   +  P+ G +  + G    GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEG-------HHTIDYSVCGES-CRVSWFWLGIKYQGERYSW  187
            IW+D+T+ L+  +C T + +G          +DYS C  S C + ++WL  +       W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  188  QVFKNCINLSASA  200
            QV+K+C+ L+  A
Sbjct  188  QVYKDCVPLTGPA  200

>PHYCA_19611
Length=531

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (52%), Gaps = 18/143 (13%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
            G     T +F   + A+ + SL+ FM+D  +  VN      CG+T+P  APQP+P   + 
Sbjct  267  GSPADNTANFNKGMAASKYTSLKEFMND-KMVLVNKEFTKECGYTNPKEAPQPVPKTYVE  325

Query  322  -----STGYT--HDGPCEVWLDDTRVLQHDNCHE---VISGKT-YDLDYSACNGSCTLYW  370
                   G+T  H+GPCEVW DDTRV Q DNC +   +I  K  YD D  AC GS  L  
Sbjct  326  WSHGDGEGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRD--ACLGSSQLTI  383

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YW+ +       SWQVY  C  +
Sbjct  384  YWIALHSP----SWQVYINCAAL  402

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 58/130 (45%), Gaps = 17/130 (13%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
            +A   Y +L+  M+D  +  V +E   +CG T P    QP+P         +G   T  +
Sbjct  280  MAASKYTSLKEFMNDK-MVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSH  338

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+T      NC   FP        D   C  S +++ +W+ +       S
Sbjct  339  --EGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL----HSPS  392

Query  187  WQVFKNCINL  196
            WQV+ NC  L
Sbjct  393  WQVYINCAAL  402

>PHALS_03179
Length=372

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 67/127 (53%), Gaps = 17/127 (13%)

Query  277  ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVW  334
            AN F  L+  M+  +L          CGF+DP   PQPIP DG    S    H GPCE+W
Sbjct  113  ANNFKDLKTLMETHALGP-------ECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMW  165

Query  335  LDDTRVLQHDNCHEVISGKTYDL------DYSAC-NGSCT-LYWYWLGVRYLKQVYSWQV  386
            LD+ +VL  D+C+     +   +      DYS+C NG C  + +YWL  + +K +  WQ 
Sbjct  166  LDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQS  225

Query  387  YKACVPI  393
            YK C+P+
Sbjct  226  YKNCIPL  232

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 15/133 (11%)

Query  80   RGYATLRALMDDDGLYSVTEEGLF--DCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
            + Y +L+A  +   L ++ E      +CG + P  + QPIP +G + ++      GPCE+
Sbjct  105  KAYQSLKAANNFKDLKTLMETHALGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEM  164

Query  137  WIDNTLALAGRNCHTEFPEGHHTI------DYSVCGE-SCR-VSWFWLGIKYQGER--YS  186
            W+DN   L   +C+ ++      I      DYS C    C+ + ++WL   +QG +    
Sbjct  165  WLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLA--FQGIKGITF  222

Query  187  WQVFKNCINLSAS  199
            WQ +KNCI L  S
Sbjct  223  WQSYKNCIPLQGS  235

>PPTG_03153
Length=314

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 13/131 (10%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
            F    +++ + SL+A +DD +   V   A   CG  DP A PQP+P  +      S G+T
Sbjct  66   FTKAFESSKYKSLKAVIDDKAKIIVPG-ATLTCGIADPKATPQPLPAKVEWYHSESEGFT  124

Query  327  --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
              H+GPCEVW D  RV   DNC    +    +L Y  S C G+  L  YW+ +       
Sbjct  125  ATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMHGP----  180

Query  383  SWQVYKACVPI  393
            SWQVY  C P+
Sbjct  181  SWQVYVNCAPL  191

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 12/122 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
            Y +L+A++DD     +       CG+  P    QP+P    +  S   G+T   +GPCE+
Sbjct  75   YKSLKAVIDDKAKI-IVPGATLTCGIADPKATPQPLPAKVEWYHSESEGFTATHEGPCEV  133

Query  137  WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            W D        NC   +      + Y  S C  +  ++ +W+ +       SWQV+ NC 
Sbjct  134  WCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----HGPSWQVYVNCA  189

Query  195  NL  196
             L
Sbjct  190  PL  191

>PHYRA_78175
Length=319

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 68/141 (48%), Gaps = 14/141 (10%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
            G     T +F     A+ + SL+ FM D  L  VN      CG+T+PD A QP+P   + 
Sbjct  60   GSPTDNTANFNKGFAASKYSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVE  118

Query  322  -----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYW  372
                   G+T  H+GPCEVW DDTRV Q DNC +        L Y   AC GS  L  YW
Sbjct  119  WSHGDGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYW  178

Query  373  LGVRYLKQVYSWQVYKACVPI  393
            + +       SWQVY  C  +
Sbjct  179  IALHSA----SWQVYINCAAL  195

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 59/130 (45%), Gaps = 17/130 (13%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
             A   Y++L+  M D  L  V +E   +CG T P+   QP+P         +G   T+ +
Sbjct  73   FAASKYSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASH  131

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+T      NC   FP     + Y    C  S  +S +W+ +       S
Sbjct  132  --EGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIAL----HSAS  185

Query  187  WQVFKNCINL  196
            WQV+ NC  L
Sbjct  186  WQVYINCAAL  195

>PITG_04947
Length=298

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 65/128 (51%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEV  333
            +N    +R  +D D+ LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  48   SNNIKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPTTGDATFSRGIVHAGPCEI  101

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++   Q   WQ
Sbjct  102  WLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLWQ  161

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  162  VYKNCIPL  169

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 16/122 (13%)

Query  85   LRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
            +R ++D D  LY        DCG T P    +  PT G +  + G    GPCEIW+D+ +
Sbjct  54   IRTMIDGDAKLYGE------DCGNTDPKATPKDPPTTGDATFSRGIVHAGPCEIWLDDEM  107

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGES-CRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++WL ++ + ++  WQV+KNCI
Sbjct  108  VLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTLWQVYKNCI  167

Query  195  NL  196
             L
Sbjct  168  PL  169

>PYIW_18790
Length=86

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 51/81 (63%), Gaps = 1/81 (1%)

Query  236  QLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSV  295
            + V+LP PT+TV+ +  ++ PLAFLE Q F TT DF  Y    G+ +LR FMDD + Y V
Sbjct  3    RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  62

Query  296  NASADFRCGFTDPDAAPQPIP  316
            +   DF CG++     PQPIP
Sbjct  63   DG-GDFECGWSTLKGTPQPIP  82

 Score = 54.7 bits (130),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            + VL P P + V     + +P+A+LE QG  T  + + +  ++GY TLR  MDD   Y V
Sbjct  3    RYVLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKV  62

Query  98   TEEGLFDCGLTFPNTETQPIP  118
             + G F+CG +      QPIP
Sbjct  63   -DGGDFECGWSTLKGTPQPIP  82

>PPTG_03138
Length=294

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 14/143 (10%)

Query  260  LEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI  319
              G     T  F    +++ F SL+  +++ +  +V+  A   CG  DPD   QP+PD  
Sbjct  58   FNGAPADNTAAFTKAFESSSFSSLKELINEKATLTVS-DATLTCGSCDPDETAQPLPDTY  116

Query  320  MR-----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYW  370
            +      S G+T  H+GPCE+W DD RV Q D+C    +     L  D+ AC GS  L +
Sbjct  117  VEWAHSDSEGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTF  176

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YWL +       +WQVY  C P+
Sbjct  177  YWLAL----HSSTWQVYVNCAPL  195

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 62/127 (49%), Gaps = 13/127 (10%)

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPC  134
             +++L+ L+++    +V++  L  CG   P+   QP+P          + G+T   +GPC
Sbjct  77   SFSSLKELINEKATLTVSDATL-TCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPC  135

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
            EIW D+     G +C  ++      +  D+  C  S  ++++WL +       +WQV+ N
Sbjct  136  EIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLAL----HSSTWQVYVN  191

Query  193  CINLSAS  199
            C  L ++
Sbjct  192  CAPLEST  198

>PYAR_20617
Length=254

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 65/133 (49%), Gaps = 14/133 (11%)

Query  264  NFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDG--IMR  321
             F T   +     A G   LR F++D             CG +  DA P+ IP    I  
Sbjct  54   TFKTGAQYAAKAKAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISL  104

Query  322  STGYTHDGPCEVWLDDTRVLQHDNCHEVI-SGKTYDLDYSACNGSCTLYWYWLGVRYLKQ  380
            ++   H GPCEVW DD      D+C +   S  ++ +D+S C+GSC L +YWLG++   +
Sbjct  105  ASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDGGK  164

Query  381  VYSWQVYKACVPI  393
               WQ YK CVP+
Sbjct  165  --RWQSYKNCVPL  175

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 63/135 (47%), Gaps = 17/135 (13%)

Query  64   QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
            + G   A +A+      G   LR  ++D G           CG +  +   + IP +G  
Sbjct  56   KTGAQYAAKAKA----EGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKI  102

Query  124  -ITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG-HHTIDYSVCGESCRVSWFWLGIKYQ  181
             + S     GPCE+W D+ LA    +C   F       +D+S C  SC + ++WLG++  
Sbjct  103  SLASTIEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDG  162

Query  182  GERYSWQVFKNCINL  196
            G+R  WQ +KNC+ L
Sbjct  163  GKR--WQSYKNCVPL  175

>SDRG_16535
Length=313

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 82/177 (46%), Gaps = 28/177 (16%)

Query  234  AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFS-----TTDDFVGYLDANGFD  281
             H  +I P PT+  E   +R K       P+  L G +++      T  F     A+ F 
Sbjct  17   GHGFLINPTPTFN-ELNGDRTKYCGTIDGPVV-LPGSSYNQDPAWNTRQFTMQFRASKFQ  74

Query  282  SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEVWLD  336
            +L +F+DD S           CG T+ + APQP+P  +  + G      +H+GPCEVW D
Sbjct  75   TLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCD  129

Query  337  DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             TRV Q+DNC          +D + C G+  L   WL +       SWQVY  CVP+
Sbjct  130  STRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPL  182

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 58/127 (46%), Gaps = 19/127 (15%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NGS--FITSGYTLDGPC  134
            + TL + +DD             CG+T  N   QP+P+     NG   F+ S    +GPC
Sbjct  73   FQTLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVAS---HEGPC  124

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            E+W D+T      NC      G  +ID + C  + ++   WL +       SWQV+ NC+
Sbjct  125  EVWCDSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCV  180

Query  195  NLSASAL  201
             LS S +
Sbjct  181  PLSGSTI  187

>PHYKE_6079
Length=302

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 84/179 (47%), Gaps = 26/179 (15%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
            H  +  PA T+     DN  + +A +E           G     T  F    D++ + SL
Sbjct  24   HGYMTEPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFDSSKYTSL  82

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
            +  ++D +  +V   A   CG  DPD   QP+P+  +      S G+T  H+GPCEVW D
Sbjct  83   KELINDLATITVT-DATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCEVWCD  141

Query  337  DTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D RV Q  +C    +    +L  D+ AC G+ TL +YWL +       +WQVY  C P+
Sbjct  142  DVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH----SSTWQVYVNCAPL  196

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 59/123 (48%), Gaps = 13/123 (11%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +L+ L++D    +VT+  L  CG   P+   QP+P          + G+T   +GPCE
Sbjct  79   YTSLKELINDLATITVTDATL-TCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  137

Query  136  IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+      ++C  ++      +  D+  C  +  ++++WL +       +WQV+ NC
Sbjct  138  VWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLAL----HSSTWQVYVNC  193

Query  194  INL  196
              L
Sbjct  194  APL  196

>PHYRA_80750
Length=275

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 66/138 (48%), Gaps = 16/138 (12%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  L+  MDD + +  +      CGFTDP   PQPIP DG 
Sbjct  56   DGNNAGSVDAFKALKTANNFVDLKTLMDDTATFGAD------CGFTDPSGTPQPIPSDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDL------DYSACN-GSCT-LYW  370
               S    H GPCE+WLDD +V   D+C      +  D+      DYS C+ G C  + +
Sbjct  110  ATFSRAIVHVGPCEIWLDDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRF  169

Query  371  YWLGVRYLKQVYSWQVYK  388
            YWL  + +     WQ Y 
Sbjct  170  YWLAFQGVDGKTVWQSYN  187

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 55/121 (45%), Gaps = 15/121 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD   +        DCG T P+   QPIP++G    S   +  GPCEIW+
Sbjct  73   NNFVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWL  126

Query  139  DNTLALAGRNCHTEFPEGHHTI------DYSVC-GESCR-VSWFWLGIKYQGERYSWQVF  190
            D+       +C + +   +  I      DYS C G  C+ + ++WL  +    +  WQ +
Sbjct  127  DDKKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSY  186

Query  191  K  191
             
Sbjct  187  N  187

>PHYSO_246481
Length=318

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 26/179 (15%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLE--GQNFS---------TTDDFVGYLDANGFDSL  283
            H  +  PA T+     DN  + +A +E    +FS          T  F    +A+ + SL
Sbjct  24   HGYMTEPAVTFLSSSTDNT-QFIATIESSASDFSGTFSGSPADNTAAFTKAFEASSYTSL  82

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
            +  ++D +  +V   A   CG  DPD   QP+PD  +      + G++  H GPCEVW D
Sbjct  83   KELINDKATITVT-DATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEVWCD  141

Query  337  DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  142  DVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  196

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 58/127 (46%), Gaps = 13/127 (10%)

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD--GPC  134
             Y +L+ L++D    +VT+  L  CG   P+   QP+P          T G++    GPC
Sbjct  78   SYTSLKELINDKATITVTDATL-TCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSHAGPC  136

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKN  192
            E+W D+       +C  ++      + Y    C  +  ++++WL +       +WQV+ N
Sbjct  137  EVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----TWQVYIN  192

Query  193  CINLSAS  199
            C  L ++
Sbjct  193  CAPLEST  199

>PITG_08202
Length=191

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 65/131 (50%), Gaps = 20/131 (15%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G N  + D F     AN F  LR  MDD S+Y  +      CGFT+P+  PQPIP DG 
Sbjct  57   DGNNAKSVDTFKSLKAANNFKDLRTLMDDTSVYGAD------CGFTNPNDTPQPIPSDGK  110

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSAC-NGSCT-LYWYWLGVR  376
               S    H GPC +WLDD   ++            + +DYS+C NG C  + +YWL  +
Sbjct  111  ATFSRALVHHGPCGIWLDDKMDIK----------SIFPVDYSSCSNGGCKQMRFYWLAFQ  160

Query  377  YLKQVYSWQVY  387
             L +   WQ Y
Sbjct  161  GLNKKTVWQSY  171

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 19/116 (16%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEI  136
            A   +  LR LMDD  +Y        DCG T PN   QPIP++G +  +      GPC I
Sbjct  72   AANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATFSRALVHHGPCGI  125

Query  137  WIDNTLALAGRNCHTEFPEGHHTIDYSVC--GESCRVSWFWLGIKYQGERYSWQVF  190
            W+D+ + +      + FP     +DYS C  G   ++ ++WL  +   ++  WQ +
Sbjct  126  WLDDKMDI-----KSIFP-----VDYSSCSNGGCKQMRFYWLAFQGLNKKTVWQSY  171

>PYVX_16138
Length=559

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query  251  DNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDA  310
            D +W+   +  G +  + D +V   +  G   +R+ +DD S+Y  +      CG+TDPD 
Sbjct  48   DPQWESDGW-NGNSQDSVDTYVSLAEEKGVTQIRSLLDDTSIYGAD------CGYTDPDG  100

Query  311  APQPIPDGIMR--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD------LDYSAC  362
              Q IP       S G  H GPCE+WLDDT VL  D+C+    G   D      +DYS+C
Sbjct  101  TAQDIPTDSTATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSC  160

Query  363  N--GSCTLYWYWLGVRYLKQVYSWQVYK  388
            +  G   + +YWL  + +     WQVY 
Sbjct  161  DTSGCSMMRFYWLAFQGVDDETVWQVYS  188

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 60/122 (49%), Gaps = 15/122 (12%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEIW  137
            E+G   +R+L+DD  +Y        DCG T P+   Q IPT+ +   S G    GPCEIW
Sbjct  73   EKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPCEIW  126

Query  138  IDNTLALAGRNCHTEFPEGHHT------IDYSVCGES--CRVSWFWLGIKYQGERYSWQV  189
            +D+T+ L   +C++ +            +DYS C  S    + ++WL  +   +   WQV
Sbjct  127  LDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETVWQV  186

Query  190  FK  191
            + 
Sbjct  187  YS  188

>H257_11264
Length=282

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 83/180 (46%), Gaps = 35/180 (19%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAF---------LEGQNFS-----TTDDFVGYLDAN  278
            +AH  ++ P PT+   G D    P  +         L G+N++      T +F   L  +
Sbjct  22   LAHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKS  77

Query  279  GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPC  331
             F SLRAF+D         +    CG T  D  P+ +P D  ++    S G+  +H+GPC
Sbjct  78   SFASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPC  131

Query  332  EVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
            E+W D TRV ++DNC   I      ++ S C GS  L   WL +        WQVYK CV
Sbjct  132  ELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQWQVYKNCV  187

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 77/175 (44%), Gaps = 26/175 (15%)

Query  40   VLYPPPFFVVDGMD---YRGSPVAYLEQQGVH-------TAIEAQTWLAERGYATLRALM  89
            ++ P P FV  G D   Y G+    +   G +         IE    L +  +A+LRA +
Sbjct  27   LVDPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSSFASLRAFI  86

Query  90   DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI----TSGYTL--DGPCEIWIDNTLA  143
            D  G          +CGLT  +   + +P++        + G+ L  +GPCE+W D T  
Sbjct  87   DAQGNTG------GECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCELWCDATRV  140

Query  144  LAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                NC    P+G   I+ S C  S ++   WL +        WQV+KNC+ L++
Sbjct  141  YENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS----QWQVYKNCVRLTS  191

>PHYCA_69583
Length=224

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 67/126 (53%), Gaps = 19/126 (15%)

Query  281  DSLRAFMDDDS-LYSVNASADFRCGFTDPDA-APQPIPDGIMR-STGYTHDGPCEVWLDD  337
            +++R  +D D+ LY  N      CGF++PDA A  P  DG      G  H GPCE+WLDD
Sbjct  79   NNIRKLLDSDTNLYGAN------CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDD  132

Query  338  TRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGVR-YLKQVYSWQVY  387
              VL +D+C +  S   Y         +DYS+C+ S C   +YWL  +      Y WQ+Y
Sbjct  133  AMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIY  192

Query  388  KACVPI  393
            K C+P+
Sbjct  193  KDCIPL  198

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 67/134 (50%), Gaps = 23/134 (17%)

Query  79   ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCE  135
            E GYA  +R L+D D  LY        +CG + P+ + +  P++G+     G    GPCE
Sbjct  74   EAGYANNIRKLLDSDTNLYGA------NCGFSNPDAKAKDPPSDGTATFERGLAHHGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGIKYQGE---  183
            IW+D+ + L   +C   F    +         IDYS C  S C   ++WL   +QG    
Sbjct  128  IWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLA--FQGSTSG  185

Query  184  RYSWQVFKNCINLS  197
            +Y WQ++K+CI L+
Sbjct  186  KYVWQIYKDCIPLT  199

>PYIR_23585
Length=240

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 16/165 (10%)

Query  234  AHQLVILPAPTYTVEGKDNRW-KPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSL  292
            AH  +  P   +      + W    +   G +  +  DF       GF + RAF++    
Sbjct  24   AHGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKTAPGKGFATTRAFLE----  79

Query  293  YSVNASADFRCGFTDPDAAPQPIP--DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVI  350
                 S    CG T  +A+P+PIP  + +  S    H GPCE+W+D+TRV  +D+C    
Sbjct  80   -----SRGPTCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWIDNTRVYHNDDCEAAF  134

Query  351  SGK--TYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 T+ +D+SAC GSC L +YWLG++     +  Q Y  C+ +
Sbjct  135  GSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKCLAL  177

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 14/120 (12%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCEIWI  138
            +G+AT RA ++  G           CG T  N   +PIP++ +   +      GPCE+WI
Sbjct  69   KGFATTRAFLESRGPT---------CGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWI  119

Query  139  DNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            DNT      +C   F     T  ID+S C  SC + ++WLG++  G R+  Q +  C+ L
Sbjct  120  DNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKCLAL  177

>PYU1_G007364
Length=316

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 61/102 (60%), Gaps = 15/102 (15%)

Query  303  CGFTDPDAAPQPIP-DGIMR------STGY--THDGPCEVWLDDTRVLQHDNCHEVISGK  353
            CG T  DA P+PIP DG++       + G+  +H GPCE+WLDDT VL+ +NC     G 
Sbjct  103  CGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGPCEIWLDDTPVLKEENCAGRFPGN  162

Query  354  TYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
               +  D+S+C G C + +YWL +    Q  +WQ+YK C+P+
Sbjct  163  PAQMKVDFSSCTGKCVMRFYWLTL----QEPAWQIYKNCIPL  200

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 23/134 (17%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF------ITSG  127
            + + A   YA+LR L+   G          DCG T  +   +PIP++G           G
Sbjct  81   KAFQASGKYASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEG  131

Query  128  Y--TLDGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGE  183
            +  +  GPCEIW+D+T  L   NC   FP       +D+S C   C + ++WL +    +
Sbjct  132  FVPSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTL----Q  187

Query  184  RYSWQVFKNCINLS  197
              +WQ++KNCI L+
Sbjct  188  EPAWQIYKNCIPLA  201

>PHYSO_255056
Length=269

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 15/117 (13%)

Query  281  DSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCEVWLDD  337
            +++R  +D D+ LY  +      CGF++PDA P+ P  DG      G  H GPCE+WLDD
Sbjct  80   NNIRKLLDSDTNLYGAD------CGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDD  133

Query  338  TRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVR-YLKQVYSWQVYKACVPI  393
            T VL +D+C +  S +    DY + NG C   +YWL  +      Y WQ+YK C+P+
Sbjct  134  TMVLHNDDCAKAFSVE----DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPL  185

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 66/126 (52%), Gaps = 21/126 (17%)

Query  79   ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCE  135
            E GYA  +R L+D D  LY        DCG + P+ + +  PT+G+     G    GPCE
Sbjct  75   EAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFERGLAHHGPCE  128

Query  136  IWIDNTLALAGRNCHTEFP-EGHHTIDYSVCGESCRVSWFWLGIKYQGE---RYSWQVFK  191
            IW+D+T+ L   +C   F  E + +I+       C   ++WL   +QG    +Y WQ++K
Sbjct  129  IWLDDTMVLHNDDCAKAFSVEDYMSIN------GCMFRFYWLA--FQGSTSGKYVWQIYK  180

Query  192  NCINLS  197
            NCI L+
Sbjct  181  NCIPLT  186

>PHYRA_83499
Length=473

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG+T  D  PQPIP DG ++       G+TH GPCE+++DDT VL  D+C E   G 
Sbjct  83   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  142

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +DYS+CNG CTL  YWL  +  +    WQ Y  CV +
Sbjct  143  PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSL  186

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 57/117 (49%), Gaps = 17/117 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + QPIPT+G          G+T  GPCEI+ID+T+ L G +C  E+P G   
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTMIGLQ  208
                    +DYS C   C ++ +WL      +   WQ + NC++L  S   T    Q
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAF----QNAQWQAYVNCVSLKGSGSATQTQTQ  198

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 12/67 (18%)

Query  329  GPCEVWLDDTRVLQHDNCHEVISGKTYD--------LDYSACNGSCTLYWYWLGVRYLKQ  380
            GPCE++LDDT +L  DNC +  SG   D        +DYS+CNG+CTL  YWLG     Q
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF----Q  406

Query  381  VYSWQVY  387
               WQ Y
Sbjct  407  NEQWQAY  413

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 40/72 (56%), Gaps = 12/72 (17%)

Query  127  GYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGESCRVSWFWLGI  178
            G  + GPCEI++D+T+ L G NC  E+  G           IDYS C  +C ++ +WLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLG-  404

Query  179  KYQGERYSWQVF  190
             +Q E+  WQ +
Sbjct  405  -FQNEQ--WQAY  413

>PHALS_05394
Length=288

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 87/183 (48%), Gaps = 31/183 (17%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQ-----NFSTTDDFVGYLD-------ANGF  280
             +H  +  P P++  +GK+   + +  +E Q     + +T+D   G LD       AN F
Sbjct  22   QSHGFIANPPPSWK-KGKNENQEWVVQIEPQWKGDWDKATSDQ--GLLDTFKELGAANNF  78

Query  281  DSLRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDT  338
             S R+ MD + +Y  +      CG+TDP+  P  P  DG    S    H G CE+W++  
Sbjct  79   KSARSLMDGNPVYGAD------CGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINKK  132

Query  339  RVLQHDNCHEVISGKTYD-------LDYSACNG-SCTLYWYWLGVRYLKQVYSWQVYKAC  390
             VLQ+D+C      K          +DYS+C G  C L +YWL ++ +     WQ YK C
Sbjct  133  MVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNC  192

Query  391  VPI  393
            + I
Sbjct  193  ISI  195

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 66/132 (50%), Gaps = 15/132 (11%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSG-YTLDGPCEI  136
            A   + + R+LMD + +Y        DCG T PN      P++G+   S      G CEI
Sbjct  74   AANNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEI  127

Query  137  WIDNTLALAGRNCHTEFPEGH-------HTIDYSVC-GESCRVSWFWLGIKYQGERYSWQ  188
            WI+  + L   +C + + +           IDYS C G+ C + ++WL ++  G++  WQ
Sbjct  128  WINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQ  187

Query  189  VFKNCINLSASA  200
             +KNCI++  S+
Sbjct  188  AYKNCISIKGSS  199

>PYIW_15526
Length=256

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 28/137 (20%)

Query  270  DFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY----  325
            +F       G+ SL+  +D     SV+      CG+T+P+AAP  +    ++S  Y    
Sbjct  67   EFTAAWPKTGYTSLKEMLDK----SVSG-----CGYTNPNAAPVDVSG--LKSMKYQNNE  115

Query  326  -------THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVR  376
                   +H GPCE W+D+T++   D+C +   G   T  +DYS C G+C L +YWL V 
Sbjct  116  YKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVH  175

Query  377  YLKQVYSWQVYKACVPI  393
              K    WQVYK CV I
Sbjct  176  SPK----WQVYKGCVAI  188

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 62/130 (48%), Gaps = 27/130 (21%)

Query  79   ERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG----SFITSGY------  128
            + GY +L+ ++D         + +  CG T PN    P+  +G     +  + Y      
Sbjct  74   KTGYTSLKEMLD---------KSVSGCGYTNPNA--APVDVSGLKSMKYQNNEYKEGFLG  122

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKYQGERYS  186
            +  GPCE WIDNT      +C   +P    T  +DYSVC  +CR++++WL +        
Sbjct  123  SHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAV----HSPK  178

Query  187  WQVFKNCINL  196
            WQV+K C+ +
Sbjct  179  WQVYKGCVAI  188

>H310_05432
Length=301

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 84/177 (47%), Gaps = 27/177 (15%)

Query  234  AHQLVILPAPTYT--VEGKDNRWKPL---AFLEGQNFS-----TTDDFVGYLDANGFDSL  283
            +H +++ P PT    V  K N    +     L G+ +       T+ FV     + F SL
Sbjct  20   SHGILVDPKPTIRDGVPDKTNYCGTIDGYKALPGEKYDDSPEYNTNAFVRQFKKSSFTSL  79

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPCEVWLD  336
            +A +          +    CG T  D  PQP+P DGI++    + GY  +H+GPCEVW D
Sbjct  80   KALVHSQ------PTTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCD  133

Query  337  DTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             TRV  +DNC   I      ++ +AC G+  L + WL +       SWQVY  CVP+
Sbjct  134  ATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAM----HTSSWQVYINCVPL  186

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query  104  DCGLTFPNTETQPIPTNG----SFITSGY--TLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            +CG+T  +   QP+P +G         GY  + +GPCE+W D T   +  NC    P G 
Sbjct  92   ECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCDATRVYSNDNCARNIPNGA  151

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              I+ + C  + R+ + WL +       SWQV+ NC+ L
Sbjct  152  MPINVAACKGAKRLLFVWLAMHTS----SWQVYINCVPL  186

>H310_06362
Length=197

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 66/136 (49%), Gaps = 27/136 (20%)

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGYTLD--G  132
            G+ TLRA++D  G          DCG T  N   +PIPT+G  +        G+     G
Sbjct  51   GFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  133  PCEIWIDNTLALAGRNCHTEFPE---GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
            PCEIW+DNT      NC   FPE       +D+S C  SC + ++WL +        WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDLWQV  157

Query  190  FKNC---INLSASALV  202
            +KNC   + L+AS  V
Sbjct  158  YKNCAPLVGLAASPTV  173

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 67/129 (52%), Gaps = 25/129 (19%)

Query  277  ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM------RSTGY--TH  327
            A GF +LRA +D              CG+T  +   +PIP DG +         G+  +H
Sbjct  49   ATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSH  99

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
             GPCE+WLD+TRV Q++NC      K      +D+S+C GSCT+ +YWL +        W
Sbjct  100  TGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALHE----DLW  155

Query  385  QVYKACVPI  393
            QVYK C P+
Sbjct  156  QVYKNCAPL  164

>H257_11265
Length=282

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 82/180 (46%), Gaps = 35/180 (19%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAF---------LEGQNFS-----TTDDFVGYLDAN  278
            +AH  ++ P PT+   G D    P  +         L G+N++      T  F   L  +
Sbjct  22   LAHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKS  77

Query  279  GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR----STGY--THDGPC  331
             F SLRAF+D         +    CG T  D  P+ +P D  ++    S G+  +H+GPC
Sbjct  78   SFASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPC  131

Query  332  EVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
            E+W D TRV ++DNC   I      ++ S C GS  L   WL +        WQVYK CV
Sbjct  132  ELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLAL----HTSQWQVYKNCV  187

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 77/175 (44%), Gaps = 26/175 (15%)

Query  40   VLYPPPFFVVDGMD---YRGSPVAYLEQQGVHTAIEAQ-------TWLAERGYATLRALM  89
            ++ P P FV  G D   Y G+    +   G +  +  Q         L +  +A+LRA +
Sbjct  27   LVDPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSSFASLRAFI  86

Query  90   DDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI----TSGYTL--DGPCEIWIDNTLA  143
            D  G          +CGLT  +   + +P++        + G+ L  +GPCE+W D T  
Sbjct  87   DAQGNTG------GECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCELWCDATRV  140

Query  144  LAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSA  198
                NC    P+G   I+ S C  S ++   WL +        WQV+KNC+ L++
Sbjct  141  YENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTS----QWQVYKNCVRLTS  191

>PYIW_21964
Length=265

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (49%), Gaps = 15/141 (11%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR  321
            G   S T  F   L A+ + S+RA +DD +++   A+ +  CG T P  A QP+PD  + 
Sbjct  64   GDPASNTKAFTAALKASTYKSMRALVDDKAVFIKEANKE--CGVTSPTGAKQPLPDKYVE  121

Query  322  -----STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYW  372
                 S G+T  H GPCEVW DD      +NC    +    +L  D++ C G+  L   W
Sbjct  122  WSHSSSEGFTPSHQGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVW  181

Query  373  LGVRYLKQVYSWQVYKACVPI  393
            L +       +WQ+Y  C P+
Sbjct  182  LAL----HSSTWQIYINCAPL  198

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 71/154 (46%), Gaps = 22/154 (14%)

Query  51   GMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFP  110
            GM + G P +    +    A++A T      Y ++RAL+DD  ++   +E   +CG+T P
Sbjct  59   GMSFTGDPAS--NTKAFTAALKAST------YKSMRALVDDKAVF--IKEANKECGVTSP  108

Query  111  NTETQPIPTN----GSFITSGYTLD--GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDY  162
                QP+P          + G+T    GPCE+W D+ LA    NC  ++        ID+
Sbjct  109  TGAKQPLPDKYVEWSHSSSEGFTPSHQGPCEVWCDDKLAFTDENCAADYTSAPAELPIDH  168

Query  163  SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            + C  +  +   WL +       +WQ++ NC  L
Sbjct  169  AKCVGASLLKIVWLAL----HSSTWQIYINCAPL  198

>SPRG_07796
Length=322

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 78/175 (45%), Gaps = 26/175 (15%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFS-----------TTDDFVGYLDANGFDSL  283
            H  +I P PT+  E   +R K    ++G                T  F     A+ F +L
Sbjct  19   HGFLINPTPTFN-ELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQFTTQFKASPFRTL  77

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEVWLDDT  338
             AF+D  ++ S       RCG T+   A QP+P  +  + G      +H+GPCEVW D T
Sbjct  78   AAFVDSQNVASCG-----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCDST  132

Query  339  RVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            RV Q+DNC          +D + C G+  L   WL +       SWQVY  CVP+
Sbjct  133  RVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPL  183

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 19/152 (13%)

Query  58   PVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPI  117
            P +   Q      ++  T      + TL A +D   + S        CG+T      QP+
Sbjct  50   PGSSYNQDPAWNTLQFTTQFKASPFRTLAAFVDSQNVASCGR-----CGITNAIGAAQPL  104

Query  118  PT-----NG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCR  170
            P+     NG   F+ S    +GPCE+W D+T      NC      G  +ID ++C  + +
Sbjct  105  PSVLKWANGQEGFVAS---HEGPCEVWCDSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQ  161

Query  171  VSWFWLGIKYQGERYSWQVFKNCINLSASALV  202
            +   WL +       SWQV+ NC+ LS S +V
Sbjct  162  LRLLWLAL----HTPSWQVYINCVPLSGSTVV  189

>PPTG_04620
Length=342

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 17/128 (13%)

Query  277  ANGFDSLRAFMDDDS-LYSVNASADFRCGFTDPDAAPQPIPD--GIMRSTGYTHDGPCEV  333
            +N    +R  +D D+ LY  +      CG TDP A P+  P       S G  H GPCE+
Sbjct  75   SNNVKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPSTGDATFSRGIVHAGPCEI  128

Query  334  WLDDTRVLQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQ  385
            WLDD  VLQ+D+C       T         +DYS+C +G C   +YWL ++       WQ
Sbjct  129  WLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLWQ  188

Query  386  VYKACVPI  393
            VYK C+P+
Sbjct  189  VYKNCIPL  196

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 16/123 (13%)

Query  85   LRALMDDDG-LYSVTEEGLFDCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTL  142
            +R ++D D  LY        DCG T P    +  P+ G +  + G    GPCEIW+D+ +
Sbjct  81   IRTMIDGDAKLYGE------DCGNTDPKATPKDPPSTGDATFSRGIVHAGPCEIWLDDEM  134

Query  143  ALAGRNCHTEFPEGHHT-------IDYSVCGE-SCRVSWFWLGIKYQGERYSWQVFKNCI  194
             L   +C + + +G          +DYS C    C   ++WL ++ +  +  WQV+KNCI
Sbjct  135  VLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTLWQVYKNCI  194

Query  195  NLS  197
             LS
Sbjct  195  PLS  197

>PYIR_22134
Length=300

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 85/181 (47%), Gaps = 27/181 (15%)

Query  234  AHQLVILPAPTYTVEGKDNRWK-------PLAFLEGQNFST-----TDDFVGYLDANGFD  281
            AH  + +P PT+T+ G   ++         L    G +F+T     T+ F   L A+ +D
Sbjct  28   AHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTYD  87

Query  282  SLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
            S+RA ++   ++   A+ +  CG T      QP+P   +      S G+T  H GPCEVW
Sbjct  88   SVRALVEAKGVFISGATKE--CGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVW  145

Query  335  LDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
             D+ +V   +NC +       +L  D++ C G+  L   WL +       +WQ+Y  C P
Sbjct  146  CDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIYINCAP  201

Query  393  I  393
            +
Sbjct  202  L  202

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 56/128 (44%), Gaps = 14/128 (11%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD-  131
            L    Y ++RAL++  G++        +CG+T      QP+P          + G+T   
Sbjct  81   LKASTYDSVRALVEAKGVF--ISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSH  138

Query  132  -GPCEIWIDNTLALAGRNCHTEFPE--GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
             GPCE+W DN    +  NC   +P       ID++ C  +  +   WL +       +WQ
Sbjct  139  QGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQ  194

Query  189  VFKNCINL  196
            ++ NC  L
Sbjct  195  IYINCAPL  202

>PYIW_24289
Length=196

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 70/157 (45%), Gaps = 16/157 (10%)

Query  239  ILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNAS  298
            +LP P             LAF     FS+  D + Y +      LR  +D  +++S  A 
Sbjct  54   VLPVPEGMSYSGSPEMNALAFKTA--FSSQTDSIKYRN------LRDLIDTKAVFS--AG  103

Query  299  ADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLD  358
             D  CGFT+  +A QP+          TH GPCE+W D   V Q+DNC +        L 
Sbjct  104  TDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCEIWCDRVLVFQNDNCAKNYPAAPAQLP  163

Query  359  Y--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            Y  S C G+  L +YWL V  +K    W+ Y  C P+
Sbjct  164  YQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 69/161 (43%), Gaps = 17/161 (11%)

Query  40   VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99
            +L P    V +GM Y GSP   +      TA  +QT      Y  LR L+D   ++S   
Sbjct  49   MLGPEVLPVPEGMSYSGSP--EMNALAFKTAFSSQT--DSIKYRNLRDLIDTKAVFSAGT  104

Query  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTL--DGPCEIWIDNTLALAGRNCHTEFPEGH  157
            +   +CG T   +  QP+  +    T G+T    GPCEIW D  L     NC   +P   
Sbjct  105  DK--ECGFTNVTSAKQPLSAHA---TGGFTPTHQGPCEIWCDRVLVFQNDNCAKNYPAAP  159

Query  158  HTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              + Y  S C  +  + ++WL +        W+ + NC  L
Sbjct  160  AQLPYQKSRCAGAKMLKFYWLAV----HSIKWEAYINCAPL  196

>SDRG_16534
Length=320

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 77/178 (43%), Gaps = 34/178 (19%)

Query  233  MAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFST--------------TDDFVGYLDAN  278
            + H  ++ P P +T    D    P  F    N  T              TD F  +  A+
Sbjct  19   VGHGHLVDPVPAFT----DKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKAS  74

Query  279  GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-----THDGPCEV  333
             F +L+AF+D    Y         CG TD +   QP+P  +  + G      +H GPCE+
Sbjct  75   SFKTLKAFLD---AYPTGGD----CGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCEL  127

Query  334  WLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
            W D+TRV Q DNC   +      +D S C+G+  L   WL +   +    WQVYK CV
Sbjct  128  WCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCV  181

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 62/126 (49%), Gaps = 21/126 (17%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
            + TL+A +D    Y        DCG+T  N   QP+P+     NG   FI+S     GPC
Sbjct  76   FKTLKAFLD---AYPTGG----DCGITDSNGPAQPLPSTVKWANGQEGFISS---HQGPC  125

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            E+W D T      NC    P+G  +ID S C  + R++  WL +        WQV+KNC+
Sbjct  126  ELWCDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLAL----HTPEWQVYKNCV  181

Query  195  NLSASA  200
            NLS  A
Sbjct  182  NLSGVA  187

>PHYKE_5749
Length=300

 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 56/105 (53%), Gaps = 18/105 (17%)

Query  303  CGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG----  352
            CG T PD  PQPIP DG  +       G+TH GPCE++LDD  VL  D+C +   G    
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  353  --KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +T D+  DYS+CNG C    YWL      Q   WQ Y  CVP+
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAF----QNAQWQTYINCVPL  187

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (46%), Gaps = 25/136 (18%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI-----TSGY  128
            +T  AE+G +    ++D  G  +        CG T P+ + QPIP++G          G+
Sbjct  64   KTMAAEKGMSVKDVVLDMVGSQT--------CGNTLPDGDPQPIPSDGKAKWLGNEGGGF  115

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEG--------HHTIDYSVCGESCRVSWFWLGIKY  180
            T  GPCEI++D+ + L   +C  EF  G           +DYS C   C  + +WL    
Sbjct  116  THTGPCEIYLDDKMVLHSDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLAF--  173

Query  181  QGERYSWQVFKNCINL  196
              +   WQ + NC+ L
Sbjct  174  --QNAQWQTYINCVPL  187

>PYAP_18221
Length=226

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 75/159 (47%), Gaps = 41/159 (26%)

Query  257  LAFLEGQNFS-----TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAA  311
            +A  +G+ F+      T  F      +G  SLR  MD    Y         CG T+P+  
Sbjct  53   IAAFQGKPFNRSPEQNTQVFTDAFKQSGLKSLRELMDK---YVPG------CGNTNPNTT  103

Query  312  PQPI-------------PDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTY---  355
            P+ +              +G + S    H GPCEVW+D+TRV Q+++C    + K+Y   
Sbjct  104  PRDVTKLKTMTYQNNEYKEGFLNS----HHGPCEVWIDNTRVFQNNDC--AANYKSYPAA  157

Query  356  -DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              +DYS C G+C L +YWL +   K    WQ YK CVPI
Sbjct  158  LPVDYSKCKGTCRLTFYWLALHSQK----WQAYKQCVPI  192

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 69/164 (42%), Gaps = 32/164 (20%)

Query  54   YRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTE  113
            ++G P     +Q      +A     + G  +LR LMD         + +  CG T PNT 
Sbjct  56   FQGKPFNRSPEQNTQVFTDA---FKQSGLKSLRELMD---------KYVPGCGNTNPNTT  103

Query  114  TQPIPT-----------NGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPE--GHHTI  160
             + +                F+ S +   GPCE+WIDNT      +C   +        +
Sbjct  104  PRDVTKLKTMTYQNNEYKEGFLNSHH---GPCEVWIDNTRVFQNNDCAANYKSYPAALPV  160

Query  161  DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
            DYS C  +CR++++WL +  Q     WQ +K C+ +   A  +M
Sbjct  161  DYSKCKGTCRLTFYWLALHSQ----KWQAYKQCVPIKYGASRSM  200

>PPTG_07516
Length=294

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG T  +  PQPIP DG ++       G+TH GPCE++LDD  VL  D+C +   G 
Sbjct  81   DQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGG  140

Query  353  -----KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 +T D+  D+S+CNG C L  YWL      Q   WQ Y  CVP+
Sbjct  141  PNGSKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTYVNCVPL  184

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 17/105 (16%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEG  156
            CG T  N + QPIP +G          G+T  GPCEI++D+ + L G +C  EF   P G
Sbjct  84   CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  143

Query  157  HHT-----IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                    +D+S C   C ++ +WL      +   WQ + NC+ L
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTYVNCVPL  184

>PHYKE_6076
Length=272

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 74/158 (47%), Gaps = 18/158 (11%)

Query  246  TVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD-DSLYSVNASADFRCG  304
            T+E     W       G     T  F    +++ + SL+  + D   L S + + +  CG
Sbjct  46   TIEASATGWS--GSFGGSPADNTAAFTTAFESSKYSSLKELVTDLGKLTSTSYTTE--CG  101

Query  305  FTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTY  355
            +T+PD   QP+PD  +      S G+T  H+GPCEVW DD RV Q D+C  H   +    
Sbjct  102  YTNPDETAQPLPDTYVEWAHSDSEGFTPSHEGPCEVWCDDVRVFQDDDCAAHYTTAPAKL  161

Query  356  DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D+ AC GS  L  YWL +       +WQVY  C  +
Sbjct  162  PYDHDACLGSSRLTLYWLAL----HSSTWQVYTNCAAL  195

 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 59/126 (47%), Gaps = 13/126 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYT--LDGPCE  135
            Y++L+ L+ D G  + T     +CG T P+   QP+P          + G+T   +GPCE
Sbjct  78   YSSLKELVTDLGKLTSTSYTT-ECGYTNPDETAQPLPDTYVEWAHSDSEGFTPSHEGPCE  136

Query  136  IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+       +C   +      +  D+  C  S R++ +WL +       +WQV+ NC
Sbjct  137  VWCDDVRVFQDDDCAAHYTTAPAKLPYDHDACLGSSRLTLYWLAL----HSSTWQVYTNC  192

Query  194  INLSAS  199
              L ++
Sbjct  193  AALEST  198

>PPTG_07520
Length=294

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D +CG T  +  PQPIP DG ++       G+TH GPCE++LDD  VL  D+C +   G 
Sbjct  81   DQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGG  140

Query  353  -----KTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 +T D+  D+S+CNG C L  YWL      Q   WQ Y  CVP+
Sbjct  141  PNGSKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTYVNCVPL  184

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 17/105 (16%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEF---PEG  156
            CG T  N + QPIP +G          G+T  GPCEI++D+ + L G +C  EF   P G
Sbjct  84   CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNG  143

Query  157  HHT-----IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                    +D+S C   C ++ +WL      +   WQ + NC+ L
Sbjct  144  SKQTSDMPVDFSSCNGKCLLTIYWLAF----QNAQWQTYVNCVPL  184

>PHYCA_112615
Length=196

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 65/131 (50%), Gaps = 20/131 (15%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G    + D F     AN F  L+  MDD S+Y  +      CGFTDP+   QPIP DG 
Sbjct  56   DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGKAQPIPSDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSAC-NGSCT-LYWYWLGVR  376
               S    H GPCE+WLDDT+ ++            + +DYS+C NG C  + +YWL  +
Sbjct  110  ATFSRAIVHVGPCEIWLDDTKDIKS----------IFPVDYSSCDNGGCKEMRFYWLAFQ  159

Query  377  YLKQVYSWQVY  387
             +     WQ Y
Sbjct  160  GVDGKTVWQSY  170

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 15/110 (14%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWIDN  140
            +  L+ LMDD  +Y        DCG T PN + QPIP++G    S   +  GPCEIW+D+
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWLDD  128

Query  141  TLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
            T     ++  + FP  + + D   C E   + ++WL  +    +  WQ +
Sbjct  129  T-----KDIKSIFPVDYSSCDNGGCKE---MRFYWLAFQGVDGKTVWQSY  170

>PITG_11937
Length=305

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 73/135 (54%), Gaps = 15/135 (11%)

Query  268  TDDFVGYLDANGFDSLRAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIPDGI----MRS  322
            T+ F     ++ F S++ F+   +L  V A+ A+ +CG TDP+  PQP+P+ I      +
Sbjct  60   TETFWTAFSSSKFTSIKEFVT--ALGQVVATGANLQCGLTDPNETPQPLPEQIEWTHSDT  117

Query  323  TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYL  378
             G+T  H+GPCE W DDT+V Q  NC    +     L Y  +AC+G+  L +YWL +   
Sbjct  118  EGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALHS-  176

Query  379  KQVYSWQVYKACVPI  393
                +WQVY  C  +
Sbjct  177  ---STWQVYANCAAL  188

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 48/101 (48%), Gaps = 11/101 (11%)

Query  103  FDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEIWIDNTLALAGRNCHTEFPEGH  157
              CGLT PN   QP+P    +    T G+T   +GPCE W D+T      NC   F    
Sbjct  92   LQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAP  151

Query  158  HTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              + Y  + C  + R++++WL +       +WQV+ NC  L
Sbjct  152  AKLPYNKAACSGASRLAFYWLALH----SSTWQVYANCAAL  188

>PHYRA_78161
Length=373

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 28/180 (16%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQ--------NFSTTDDFVGYLDANG---FDSL  283
            H  +  P  T+T +  D   + +A +E          N + +D+   +  A G   + SL
Sbjct  21   HGYMTDPKVTFTAQAGDPT-QYIATIESTASGLTGTFNGAPSDNVAAFTKAFGSSKYSSL  79

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
            + F++D +  +V   A   CG  DP    QP+P   M      S G+T  H+GPCEVW D
Sbjct  80   KEFINDKATVTVTG-ATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCEVWCD  138

Query  337  DTRVLQHDNC---HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D R  Q D+C   + ++  +    D  AC GS TL +YW+ +       +WQVY  C P+
Sbjct  139  DVRTFQDDDCPANYPMVPAQ-LPFDRDACMGSSTLTFYWMAMHS----STWQVYVNCAPL  193

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (47%), Gaps = 13/126 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y++L+  ++D    +VT   L  CG   P  E QP+P +        + G+T   +GPCE
Sbjct  76   YSSLKEFINDKATVTVTGATLT-CGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPCE  134

Query  136  IWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+       +C   +P        D   C  S  ++++W+ +       +WQV+ NC
Sbjct  135  VWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAM----HSSTWQVYVNC  190

Query  194  INLSAS  199
              L+++
Sbjct  191  APLAST  196

>SPRG_07795
Length=335

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 16/129 (12%)

Query  268  TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTG---  324
            TD F  +  A+ F +L+AF+D              CG TDP+   QP+P  +  + G   
Sbjct  64   TDQFTKHFKASSFKTLKAFLDAHPTGG-------DCGITDPNGPAQPLPSTVKWANGELG  116

Query  325  --YTHDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
               +H GPCE+W D+TRV Q +NC          +D S C+G+  L   WL +   +   
Sbjct  117  FISSHQGPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE---  173

Query  383  SWQVYKACV  391
             WQVYK CV
Sbjct  174  -WQVYKNCV  181

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 21/126 (17%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
            + TL+A +D             DCG+T PN   QP+P+     NG   FI+S     GPC
Sbjct  76   FKTLKAFLD-------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISS---HQGPC  125

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            E+W D T      NC   +P+G   ID S C  + R++  WL +        WQV+KNC+
Sbjct  126  ELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLAL----HTPEWQVYKNCV  181

Query  195  NLSASA  200
            NLS +A
Sbjct  182  NLSGAA  187

>PYU1_G005985
Length=200

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 6/135 (4%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
            +G     T  F     A G+ SL+A +D  +    N+  D         AA +   D   
Sbjct  61   DGSPQENTQQFTSGFHAAGYSSLKALLDPVAPGCGNSRVDVPPVGVSRLAAMEFRNDEFH  120

Query  321  RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYL  378
                 +H GPCEVW+D+ R+   D+C    +G   T  +++S C G CTL +YWL +   
Sbjct  121  EGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLALHEP  180

Query  379  KQVYSWQVYKACVPI  393
                +WQVYK CVPI
Sbjct  181  ----TWQVYKQCVPI  191

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 70/158 (44%), Gaps = 33/158 (21%)

Query  50   DGMDYRGSPVAYLEQ--QGVHTAIEAQTWLAERGYATLRALMD------DDGLYSVTEEG  101
             G  + GSP    +Q   G H A          GY++L+AL+D       +    V   G
Sbjct  56   QGKKWDGSPQENTQQFTSGFHAA----------GYSSLKALLDPVAPGCGNSRVDVPPVG  105

Query  102  LFD-CGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI  160
            +     + F N E         F+ S +   GPCE+WIDN     G +C  +F     TI
Sbjct  106  VSRLAAMEFRNDEFHE-----GFVNSHH---GPCEVWIDNKRMFHGDDCRAQFAGYPATI  157

Query  161  --DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              ++SVC   C ++++WL +       +WQV+K C+ +
Sbjct  158  PVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQCVPI  191

>PHYCA_19598
Length=390

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 71/143 (50%), Gaps = 19/143 (13%)

Query  264  NFSTTDDFVGYLDA---NGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM  320
            N +  D+   Y  A   + + SL+    D +  +V+  A   CG  DP   PQP+P+ I+
Sbjct  57   NGAPKDNVAAYTKAFASSKYKSLKDLFTDKAKITVSG-ATLTCGSCDPKEEPQPMPESIV  115

Query  321  R-----STGYT--HDGPCEVWLDDTRVLQHDNCHE---VISGKTYDLDYSACNGSCTLYW  370
                  S G+T  H+GPCEVW DD R  Q DNC     ++  K    D  AC G+ TL +
Sbjct  116  EWSHSDSEGFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAK-MPFDREACMGASTLTF  174

Query  371  YWLGVRYLKQVYSWQVYKACVPI  393
            YW+ +       +WQVY  C P+
Sbjct  175  YWMAMHS----DTWQVYVNCAPL  193

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (44%), Gaps = 13/128 (10%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
             A   Y +L+ L  D    +V+   L  CG   P  E QP+P +        + G+T   
Sbjct  71   FASSKYKSLKDLFTDKAKITVSGATLT-CGSCDPKEEPQPMPESIVEWSHSDSEGFTPSH  129

Query  131  DGPCEIWIDNTLALAGRNCHTEFP--EGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQ  188
            +GPCE+W D+       NC T FP        D   C  +  ++++W+ +       +WQ
Sbjct  130  EGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMHSD----TWQ  185

Query  189  VFKNCINL  196
            V+ NC  L
Sbjct  186  VYVNCAPL  193

>PHYRA_86751
Length=163

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 56/102 (55%), Gaps = 18/102 (18%)

Query  300  DFRCGFTDPDAAPQPI-PDGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            ++ CG+T  D  P+ I  DG+         G+TH GPCE++LDDT +L  DNC +  SG 
Sbjct  6    EYPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGG  65

Query  354  TYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVY  387
              D        +DYS+CNG+CTL  YWLG     Q   WQ Y
Sbjct  66   ADDSGIMSDMPIDYSSCNGACTLAIYWLGF----QNEQWQAY  103

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 17/101 (17%)

Query  103  FDCGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
            + CG T  + + + I T+G  I       G+T  GPCEI++D+T+ L G NC  E+  G 
Sbjct  7    YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  66

Query  158  HT--------IDYSVCGESCRVSWFWLGIKYQGERYSWQVF  190
                      IDYS C  +C ++ +WLG  +Q E+  WQ +
Sbjct  67   DDSGIMSDMPIDYSSCNGACTLAIYWLG--FQNEQ--WQAY  103

>PHYRA_78174
Length=279

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 31/181 (17%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFS-----------TTDDFVGYLDANGFDSL  283
            H  + +P   YT EG   ++  +A +E                 T  F    +A+ + SL
Sbjct  23   HGYMSVPKCEYTFEGDTTQF--MATIEASASGFSGSFSGSPADNTAAFAKGFEASKYTSL  80

Query  284  RAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVW  334
            +  + D  L  V  SADF   CG+T+PD   QP+P   +        G+T  H+GPCEVW
Sbjct  81   KEMVSD--LGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHGSGEGFTSSHEGPCEVW  137

Query  335  LDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
             DD RV Q D+C  H   +      D+ AC G+  L +YWL +       +WQVY  C  
Sbjct  138  CDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLAL----HSSTWQVYTNCAA  193

Query  393  I  393
            +
Sbjct  194  L  194

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 67/139 (48%), Gaps = 18/139 (13%)

Query  68   HTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------  119
            +TA  A+ + A + Y +L+ ++ D G  + + +   +CG T P+   QP+P         
Sbjct  64   NTAAFAKGFEASK-YTSLKEMVSDLGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHG  121

Query  120  NGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLG  177
            +G   TS +  +GPCE+W D+       +C   +      +  D+  C  + R++++WL 
Sbjct  122  SGEGFTSSH--EGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLA  179

Query  178  IKYQGERYSWQVFKNCINL  196
            +       +WQV+ NC  L
Sbjct  180  L----HSSTWQVYTNCAAL  194

>PYAP_18713
Length=184

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 15/127 (12%)

Query  265  FSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD--GIMRS  322
            F T   +       GF  LR+F++D             CG T+P+A P+ +P    ++ S
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFS  107

Query  323  TGYTHDGPCEVWLDDTRVLQHDNCHEVISGK--TYDLDYSACNGSCTLYWYWLGVRYLKQ  380
                H GPCE+W+DDT V  +D+C      K   + +D+S+C G C L +YWLG++   +
Sbjct  108  RPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSGK  167

Query  381  VYSWQVY  387
               WQ Y
Sbjct  168  --RWQSY  172

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 70/138 (51%), Gaps = 18/138 (13%)

Query  64   QQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSF  123
            + G   A+ A+    ++G+  LR+ ++D G           CG T PN + + +P++   
Sbjct  58   KTGAQYAVVAK----DKGFKDLRSFLEDKGPA---------CGKTNPNAKPRNVPSDSKV  104

Query  124  ITSGYTLD-GPCEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVCGESCRVSWFWLGIKY  180
            + S   +  GPCE+WID+T+     +C  EF +      +D+S C   C + ++WLG++ 
Sbjct  105  VFSRPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQD  164

Query  181  QGERYSWQVFKNCINLSA  198
             G+R  WQ +   I  S+
Sbjct  165  SGKR--WQSYSTYIAESS  180

>PHYCA_98479
Length=276

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 59/106 (56%), Gaps = 18/106 (17%)

Query  302  RCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCH------EV  349
             CG T  D + QP+P DG+ +       G+TH GPCE+++DDT VL  DNC       +V
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  350  ISGKTYDL--DYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
             S  T D+  DYS+C G CTL  YWLG     Q   WQ Y  CVP+
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYINCVPL  186

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 54/106 (51%), Gaps = 17/106 (16%)

Query  104  DCGLTFPNTETQPIPTNG-----SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG--  156
            +CG T  +   QP+PT+G          G+T  GPCEI+ID+T+ L G NC  E+P G  
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  157  ------HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                     +DYS C   C ++ +WLG     +   WQ + NC+ L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYINCVPL  186

>PHYSO_324715
Length=274

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 22/133 (17%)

Query  277  ANGFDS-LRAFMDDDS-LYSVNASADFRCGFTDPDAAPQ-PIPDGIMR-STGYTHDGPCE  332
            A G+++ +R  +D D+ LY  +      CG++DP+A+P+ P  DG    S G  H GPCE
Sbjct  65   AEGYENNIRKLLDGDTKLYGAD------CGYSDPNASPKDPSTDGTATFSRGIAHHGPCE  118

Query  333  VWLDDTRVLQHDNCHEVISGKTYD--------LDYSACNGS-CTLYWYWL---GVRYLKQ  380
            +WLDD  +L  D+C E      Y+        +DYS+C+ + C L++YWL   G      
Sbjct  119  IWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNS  178

Query  381  VYSWQVYKACVPI  393
             Y WQ+YK  V +
Sbjct  179  KYVWQIYKCYVAL  191

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (46%), Gaps = 23/144 (16%)

Query  74   QTWLAER--GYAT-LRALMD-DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GY  128
             +W+  +  GY   +R L+D D  LY        DCG + PN   +   T+G+   S G 
Sbjct  58   SSWIKAKAEGYENNIRKLLDGDTKLYGA------DCGYSDPNASPKDPSTDGTATFSRGI  111

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHT--------IDYSVC-GESCRVSWFWLGIK  179
               GPCEIW+D+ + L   +C   F    +         IDYS C    C + ++WL  +
Sbjct  112  AHHGPCEIWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQ  171

Query  180  YQ---GERYSWQVFKNCINLSASA  200
             +     +Y WQ++K  + L+  A
Sbjct  172  GRTTGNSKYVWQIYKCYVALTGPA  195

>PPTG_03160
Length=379

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 14/132 (11%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
            F     ++ + SL+ ++ D +   V+  A   CG  DP   PQP+P   +      S G+
Sbjct  67   FTKAFTSSKYKSLKEYVTDKAKIIVSG-ATLTCGSCDPKQEPQPMPKSTVEWSHSDSEGF  125

Query  326  T--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            T  H+GPCEVW DD R  Q D+C  H  +       D  AC G+ TL +YW+ +      
Sbjct  126  TPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAMH----S  181

Query  382  YSWQVYKACVPI  393
             SWQVY  C P+
Sbjct  182  SSWQVYVNCAPL  193

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 13/124 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +L+  + D     V+   L  CG   P  E QP+P +        + G+T   +GPCE
Sbjct  76   YKSLKEYVTDKAKIIVSGATLT-CGSCDPKQEPQPMPKSTVEWSHSDSEGFTPSHEGPCE  134

Query  136  IWIDNTLALAGRNC--HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+       +C  H          D   C  +  ++++W+ +       SWQV+ NC
Sbjct  135  VWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAM----HSSSWQVYVNC  190

Query  194  INLS  197
              L+
Sbjct  191  APLA  194

>PYVX_18175
Length=147

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 68/162 (42%), Gaps = 64/162 (40%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293
            AHQ VILP P++T   +D  + PLA               +L+  GF +   F       
Sbjct  27   AHQYVILPQPSWTTSDRDVWYSPLA---------------FLENQGFKTQEDF-------  64

Query  294  SVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
                                       R+ GY        ++D              SGK
Sbjct  65   -----------------------SAWRRANGYK---TLRSFMD--------------SGK  84

Query  354  TYD--LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D  +DYS+C GSCTLYWYW+GVRYLK  YSWQVYK CVP+
Sbjct  85   YTDTAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPL  126

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 60/163 (37%), Gaps = 61/163 (37%)

Query  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97
            Q V+ P P +     D   SP+A+LE QG  T  +   W    GY TLR           
Sbjct  29   QYVILPQPSWTTSDRDVWYSPLAFLENQGFKTQEDFSAWRRANGYKTLR-----------  77

Query  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157
                                    SF+ SG   D                          
Sbjct  78   ------------------------SFMDSGKYTDT-------------------------  88

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              IDYS C  SC + W+W+G++Y    YSWQV+KNC+ LS SA
Sbjct  89   -AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLSTSA  130

>PYIW_25573
Length=279

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 77/178 (43%), Gaps = 29/178 (16%)

Query  235  HQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQNFST-----TDDFVGYLDAN  278
            H  + LP PT+           T++G      P     G +FST     T  F   L A+
Sbjct  25   HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAP----SGMSFSTDPTSNTKAFTAALKAS  80

Query  279  GFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDD  337
             + SL+A     +     + A   CGF+    A QP+PD +       +H+GPCEVW D+
Sbjct  81   SYGSLKALAF--ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDN  138

Query  338  TRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            T     DNC +  +     L Y  S C+G+  L   WL +       +WQVY  C PI
Sbjct  139  TMAFHGDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  192

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 69/168 (41%), Gaps = 23/168 (14%)

Query  32   SGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
            SG  +G   L  P      GM +   P +    +    A++A +      Y +L+AL   
Sbjct  45   SGTIDGPSALKAP-----SGMSFSTDPTS--NTKAFTAALKASS------YGSLKALAF-  90

Query  92   DGLYSVTEEGLF-DCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150
                  TE G   +CG +      QP+P    +     + +GPCE+W DNT+A  G NC 
Sbjct  91   --ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAFHGDNCA  148

Query  151  TEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              +      + Y  S C  +  +   WL +       +WQV+ NC  +
Sbjct  149  KTYTSSPAKLPYDKSKCSGAKMLMSIWLAL----HTPTWQVYTNCAPI  192

>PHYKE_6077
Length=322

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 67/135 (50%), Gaps = 18/135 (13%)

Query  268  TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADF--RCGFTDPDAAPQPIPDGIMR----  321
            T +F   + A+ + SL+ FM   +  +   S +F   CG+T+P  A QP+P+  +     
Sbjct  66   TANFNKGMAASKYTSLKEFMAAKAKVT---SPEFTLECGYTNPKGAAQPLPETYVEWSHG  122

Query  322  -STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVR  376
               G+T  H+GPCEVW DDTRV Q DNC          L Y   AC GS  L  YW+ + 
Sbjct  123  SGEGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH  182

Query  377  YLKQVYSWQVYKACV  391
                  SWQVY  C 
Sbjct  183  SP----SWQVYINCA  193

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 56/130 (43%), Gaps = 17/130 (13%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT--------NGSFITSGY  128
            +A   Y +L+  M      + + E   +CG T P    QP+P         +G   TS +
Sbjct  73   MAASKYTSLKEFMAAKAKVT-SPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSH  131

Query  129  TLDGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+T      NC   FP     + Y    C  S  ++ +W+ +       S
Sbjct  132  --EGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL----HSPS  185

Query  187  WQVFKNCINL  196
            WQV+ NC  L
Sbjct  186  WQVYINCAAL  195

>PHYKE_2454
Length=374

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 13/131 (10%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
            F     A+ + SL+A +DD +  +V + A   CG  DP AA QP+P  +      S G+T
Sbjct  67   FTKAFKASSYKSLKALIDDKAKITV-SGATLTCGSADPSAAAQPLPSTLEWSHSDSEGFT  125

Query  327  --HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVY  382
              H+GPCE W DD RV Q +NC         ++ Y  S+ +G+  L +YW+ +       
Sbjct  126  PSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP----  181

Query  383  SWQVYKACVPI  393
            SWQVY  C  +
Sbjct  182  SWQVYVNCAAL  192

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (47%), Gaps = 12/122 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYT--LDGPCEI  136
            Y +L+AL+DD    +V+   L  CG   P+   QP+P+   +  S   G+T   +GPCE 
Sbjct  76   YKSLKALIDDKAKITVSGATL-TCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEGPCEA  134

Query  137  WIDNTLALAGRNCHTEFPEGHHTIDYSVCGES--CRVSWFWLGIKYQGERYSWQVFKNCI  194
            W D+       NC   FP     + Y     S   R+ ++W+ +       SWQV+ NC 
Sbjct  135  WCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAM----HGPSWQVYVNCA  190

Query  195  NL  196
             L
Sbjct  191  AL  192

>PHALS_04411
Length=262

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 82/181 (45%), Gaps = 29/181 (16%)

Query  233  MAHQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDD------FVGYLDANGFDS  282
             AH  +  P PT+  + + N+W    KPL   +G    +  D      F      N + +
Sbjct  22   QAHGYIAKPPPTWKSK-ETNKWVVEIKPL--WDGPWDKSKGDEGLLSTFKELAAKNNYKN  78

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAP-QPIPDGIMR-STGYTHDGPCEVWLDDTRV  340
            +R  MD +  +  +      CGFTDP   P  P  DG    S G  H GPCE+W +D  +
Sbjct  79   VRTLMDGNPAFGED------CGFTDPKGKPVDPPSDGTATFSRGIVHAGPCELWCNDKMI  132

Query  341  LQHDNCHEVISGKTYD-------LDYSAC-NGSCTLYWYWLGVRYLKQVYSWQVYKACVP  392
            LQ+D+C       T         + YS C +G   L +YWL ++ L+    WQ YK C+P
Sbjct  133  LQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQAYKNCIP  192

Query  393  I  393
            +
Sbjct  193  L  193

 Score = 59.7 bits (143),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 61/130 (47%), Gaps = 15/130 (12%)

Query  78   AERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS-GYTLDGPCEI  136
            A+  Y  +R LMD +  +        DCG T P  +    P++G+   S G    GPCE+
Sbjct  72   AKNNYKNVRTLMDGNPAFGE------DCGFTDPKGKPVDPPSDGTATFSRGIVHAGPCEL  125

Query  137  WIDNTLALAGRNCHTEFPEGHHT-------IDYSVCGESCR-VSWFWLGIKYQGERYSWQ  188
            W ++ + L   +C + + +G          + YS+C      + ++WL ++    +  WQ
Sbjct  126  WCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKVVWQ  185

Query  189  VFKNCINLSA  198
             +KNCI L+ 
Sbjct  186  AYKNCIPLTG  195

>PHYCA_18657
Length=295

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 54/108 (50%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIPDGIMR------STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353
            D +CGFT  D  P+P+P             G+TH GPCE+++DD  VL  D+C     G 
Sbjct  169  DKKCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGG  228

Query  354  TYD--------LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
              D        +DYS+CNG CT   YWLG     Q   WQ Y  CVP+
Sbjct  229  PNDSGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAYINCVPL  272

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 56/113 (50%), Gaps = 17/113 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
            CG T  + + +P+PTNG  +       G+T  GPCE++ID+ + L   +C  ++P G + 
Sbjct  172  CGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPND  231

Query  160  --------IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVTM  204
                    +DYS C   C  S +WLG     +   WQ + NC+ LS +   T 
Sbjct  232  SGIMSEMPVDYSSCNGDCTFSIYWLGF----QNAQWQAYINCVPLSGTGATTQ  280

>PHYKE_7445
Length=369

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 13/129 (10%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT  326
            F     A+ + +L+A +DD +  SV   A   CG  DP+AAPQP+P  +      S G++
Sbjct  66   FTKAFKASKYKTLKALIDDKTKISV-PGATLTCGSADPNAAPQPLPAKLEWAHSDSEGFS  124

Query  327  --HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVY  382
              H+GPCE W D TRV   +NC  H   +      + S C+G+  L ++W+ +       
Sbjct  125  PSHEGPCEAWCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAMHGP----  180

Query  383  SWQVYKACV  391
            SWQVY  C 
Sbjct  181  SWQVYVNCA  189

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 58/125 (46%), Gaps = 12/125 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITS---GYTL--DGPCEI  136
            Y TL+AL+DD    SV    L  CG   PN   QP+P    +  S   G++   +GPCE 
Sbjct  75   YKTLKALIDDKTKISVPGATL-TCGSADPNAAPQPLPAKLEWAHSDSEGFSPSHEGPCEA  133

Query  137  WIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            W D T      NC   F      + Y  S C  + ++ +FW+ +       SWQV+ NC 
Sbjct  134  WCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAM----HGPSWQVYVNCA  189

Query  195  NLSAS  199
             LS S
Sbjct  190  TLSGS  194

>PYVX_22508
Length=298

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 13/135 (10%)

Query  268  TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----S  322
            T  F    +A+ + SL+  + D       +     CG TDPD   Q +PD  +      +
Sbjct  51   TASFTTAFEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSST  110

Query  323  TGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVRYL  378
             G+T  H+GPCE+W DDTRV Q D+C    +     L  D  AC G+  L +YWL +   
Sbjct  111  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH--  168

Query  379  KQVYSWQVYKACVPI  393
                +WQVY  C  +
Sbjct  169  --SSTWQVYINCAAL  181

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 55/123 (45%), Gaps = 12/123 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +L+ ++ D G    T      CGLT P+   Q +P          T G+T   +GPCE
Sbjct  63   YTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSSTEGFTASHEGPCE  122

Query  136  IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            IW D+T      +C   +      +  D   C  + +++++WL +       +WQV+ NC
Sbjct  123  IWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH----SSTWQVYINC  178

Query  194  INL  196
              L
Sbjct  179  AAL  181

>PHYKE_7717
Length=568

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 0/42 (0%)

Query  352  GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            GK Y +DYSAC G+CTL WYWLGVR+LK  YSWQVYKAC+P+
Sbjct  4    GKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  45

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)

Query  153  FPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197
            FP   +TIDYS C  +C + W+WLG+++    YSWQV+K CI L+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>PHYSO_525076
Length=366

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 82/179 (46%), Gaps = 26/179 (15%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
            H  +  PA T+     DN  + +A +E           G     T  F    +A+ + SL
Sbjct  24   HGYLTEPAVTFLSSSTDNT-QFIATIESSASDFSGTFSGSPADNTAAFTKAFEASSYTSL  82

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
            +  ++D +  +V   A   CG   PD   QP+PD  +      + G++  H GPCEVW D
Sbjct  83   KELINDKATITV-TDATLTCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCEVWCD  141

Query  337  DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  142  DVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  196

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 13/123 (11%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTLD--GPCE  135
            Y +L+ L++D    +VT+  L  CG  +P+   QP+P          T G++    GPCE
Sbjct  79   YTSLKELINDKATITVTDATL-TCGSCYPDETAQPLPDTYVEWSHSSTEGFSSSHAGPCE  137

Query  136  IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+       +C  ++      + Y    C  +  ++++WL +       +WQV+ NC
Sbjct  138  VWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINC  193

Query  194  INL  196
              L
Sbjct  194  APL  196

>SPRG_07797
Length=318

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 63/126 (50%), Gaps = 21/126 (17%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPT-----NG--SFITSGYTLDGPC  134
            + TL+A +D             DCG+T  N   QP+P+     NG   FI+S     GPC
Sbjct  76   FKTLKAFLD-------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISS---HQGPC  125

Query  135  EIWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            E+W DN       NC   +P GH +ID S C  + R++  WL +        WQV+KNC+
Sbjct  126  ELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLAL----HSPQWQVYKNCV  181

Query  195  NLSASA  200
            NLS +A
Sbjct  182  NLSGAA  187

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (48%), Gaps = 16/130 (12%)

Query  267  TTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGY-  325
             TD+F  +  A+ F +L+AF+D          +   CG TD +   QP+P  +  + G  
Sbjct  63   NTDEFTKHFKASSFKTLKAFLDAHP-------SGGDCGITDANGPAQPLPSTVKWANGQE  115

Query  326  ----THDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
                +H GPCE+W D+ RV   +NC          +D S C+G+  L   WL +   +  
Sbjct  116  GFISSHQGPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ--  173

Query  382  YSWQVYKACV  391
              WQVYK CV
Sbjct  174  --WQVYKNCV  181

>PHYRA_84947
Length=265

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 80/176 (45%), Gaps = 31/176 (18%)

Query  235  HQLVILPAPTYTVEGKDNRW----KPLAFLEGQNFSTTDDFVGYLDA-------NGFDSL  283
            H  +ILP P    EG D        P   ++      +  +  Y +A       N   SL
Sbjct  23   HGNIILPKP----EGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYEAVDSWFTKNNIASL  78

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR--STGYTHDGPCEVWLDDTRV  340
            + ++   + Y  + S    CG T  + APQP+P DG  +  + G +H GPCE+W DDTRV
Sbjct  79   KEYI---TTYGTDIS---ECGVTKKNGAPQPVPSDGYAQHDNLGNSHPGPCEIWCDDTRV  132

Query  341  LQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                NC    SG++     +D S C  S  L +YWL +     +  WQVY  CV +
Sbjct  133  FHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLAL----HIQPWQVYINCVAL  184

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 78/190 (41%), Gaps = 31/190 (16%)

Query  23   LCFAQRRLDSGLGEGQVVLYPPPFFVVDGMD----YRGSPVAYLEQQGVHTAIE------  72
            + F    + S  G G ++L  P     +G D    Y G P   ++   +  +        
Sbjct  10   IVFQATAISSTTGHGNIILPKP-----EGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYE  64

Query  73   -AQTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNG--SFITSGYT  129
               +W  +   A+L+  +   G        + +CG+T  N   QP+P++G       G +
Sbjct  65   AVDSWFTKNNIASLKEYITTYGT------DISECGVTKKNGAPQPVPSDGYAQHDNLGNS  118

Query  130  LDGPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYS  186
              GPCEIW D+T      NC  +F         ID S C  S  + ++WL +  Q     
Sbjct  119  HPGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHIQ----P  174

Query  187  WQVFKNCINL  196
            WQV+ NC+ L
Sbjct  175  WQVYINCVAL  184

>PHYRA_86241
Length=195

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 65/122 (53%), Gaps = 19/122 (16%)

Query  281  DSLRAFMDDD-SLYSVNASADFRCGFTDPDA-APQPIPDGIMR-STGYTHDGPCEVWLDD  337
            +++R  +D D SLY  +      CGF+DP+A A  P  DG      G  H GPCE+WLDD
Sbjct  79   NNIRKLLDSDTSLYGAD------CGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDD  132

Query  338  TRVLQHDNCHEVISGKTY--------DLDYSACNGS-CTLYWYWLGVR-YLKQVYSWQVY  387
            T VL +D+C +  S + Y         +DYS+C+ S C   +YWL  +      Y WQ+Y
Sbjct  133  TMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIY  192

Query  388  KA  389
             A
Sbjct  193  SA  194

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 23/127 (18%)

Query  79   ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCE  135
            E GYA  +R L+D D  LY        DCG + PN + +  P++G+     G    GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEGHHT--------IDYSVCGES-CRVSWFWLGIKYQGE---  183
            IW+D+T+ L   +C   F    +         IDYS C  S C   ++WL   +QG    
Sbjct  128  IWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLA--FQGSTSG  185

Query  184  RYSWQVF  190
            +Y WQ++
Sbjct  186  KYVWQIY  192

>PHYSO_318683
Length=352

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 66/127 (52%), Gaps = 13/127 (10%)

Query  275  LDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HD  328
             +++ + S++ F+ D      N  A+  CG TDPD  PQP+PD +      + G+T  H+
Sbjct  68   FNSSQYSSIKEFVTDLGQIVANG-ANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHE  126

Query  329  GPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQV  386
            GPCE W D+TRV Q  +C  H   +      D + C+G+  L +YWL +       +WQV
Sbjct  127  GPCEAWCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQV  182

Query  387  YKACVPI  393
            Y  C  +
Sbjct  183  YVDCAAL  189

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 58/122 (48%), Gaps = 12/122 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
            Y++++  + D G   V      +CGLT P+   QP+P    +    T G+T   +GPCE 
Sbjct  73   YSSIKEFVTDLGQI-VANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCEA  131

Query  137  WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            W DNT      +C   +      +  D + C  + R++++WL +       +WQV+ +C 
Sbjct  132  WCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDCA  187

Query  195  NL  196
             L
Sbjct  188  AL  189

>PHYKE_1913
Length=280

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 56/108 (52%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG-  352
            D  CG+T  DA P+P+P DG          G+TH GPCEV+++D  VL  D+C +   G 
Sbjct  83   DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGG  142

Query  353  -------KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                       +DYS+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  143  PDGSNKMSEMPIDYSSCNGDCTLTIYWLAF----QNAQWQAYINCVPL  186

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 17/105 (16%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  + + +P+P++G  I       G+T  GPCE++I++ + L G +C  E+P G   
Sbjct  86   CGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDKMVLHGDDCEDEYPGGPDG  145

Query  157  -----HHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
                    IDYS C   C ++ +WL      +   WQ + NC+ L
Sbjct  146  SNKMSEMPIDYSSCNGDCTLTIYWLAF----QNAQWQAYINCVPL  186

>PPTG_20376
Length=186

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 49/88 (56%), Gaps = 8/88 (9%)

Query  261  EGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGI  319
            +G    + D F     AN F  L+  MDD S+Y  +      CGFTDP+  PQPIP DG 
Sbjct  56   DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGAD------CGFTDPNGTPQPIPTDGK  109

Query  320  MR-STGYTHDGPCEVWLDDTRVLQHDNC  346
               S    H GPCE+WLDDT+VL  D+C
Sbjct  110  ATFSRAIVHVGPCEIWLDDTKVLYEDDC  137

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 38/73 (52%), Gaps = 7/73 (10%)

Query  80   RGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLD-GPCEIWI  138
              +  L+ LMDD  +Y        DCG T PN   QPIPT+G    S   +  GPCEIW+
Sbjct  73   NNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWL  126

Query  139  DNTLALAGRNCHT  151
            D+T  L   +C T
Sbjct  127  DDTKVLYEDDCFT  139

>H257_13550
Length=266

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 27/136 (20%)

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSGYTLD--G  132
            G+ TLRA++D  G          DCG +  +   +PIP++G+ +        G+     G
Sbjct  106  GFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPSHTG  156

Query  133  PCEIWIDNTLALAGRNCHTEFPE---GHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQV  189
            PCEIW+DNT      +C T FPE    H  +D++ C  SC + ++W+ +     +  WQV
Sbjct  157  PCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIAL----HQDLWQV  212

Query  190  FKNC---INLSASALV  202
            +KNC   + LSA+  +
Sbjct  213  YKNCAPLVGLSATPTI  228

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 25/129 (19%)

Query  277  ANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM------RSTGY--TH  327
            A GF +LRA +D              CG++  D   +PIP DG +         G+  +H
Sbjct  104  ATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPSH  154

Query  328  DGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGVRYLKQVYSW  384
             GPCE+WLD+TRV Q+D+C      K      +D+++C GSCT+ +YW+    L Q   W
Sbjct  155  TGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIA---LHQDL-W  210

Query  385  QVYKACVPI  393
            QVYK C P+
Sbjct  211  QVYKNCAPL  219

>PPTG_18166
Length=445

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 18/108 (17%)

Query  300  DFRCGFTDPDAAPQPIP-DGIM-----RSTGYTHDGPCEVWLDDTRVLQHDNCHE-----  348
            D +CG T  + +P+PIP DG +     R  G+TH GPCE++LDD  VL  D+C E     
Sbjct  81   DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGG  140

Query  349  ---VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                 SG    +D+S+CNG CTL  YWL      Q   WQ Y  CVP+
Sbjct  141  SDGSSSGSEMPVDFSSCNGKCTLTIYWLAF----QNAQWQTYVNCVPL  184

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159
            CG T  N   +PIP++G          G+T  GPCEI++D+ + L G +C  E+P G   
Sbjct  84   CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLHGDDCEEEYPGGSDG  143

Query  160  --------IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
                    +D+S C   C ++ +WL      +   WQ + NC+ LS S+  T
Sbjct  144  SSSGSEMPVDFSSCNGKCTLTIYWLAF----QNAQWQTYVNCVPLSGSSGST  191

>PYAP_22462
Length=210

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 83/184 (45%), Gaps = 37/184 (20%)

Query  234  AHQLVILP----APTYTVEGKDNRWKPLAFLEGQNFS-------TTDDFVGYLDANGFDS  282
            AH  + LP    A +YT  G ++     A+   Q F         T  F     A GF S
Sbjct  29   AHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFSS  88

Query  283  LRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPD-GIMR------STGY--THDGPCEV  333
            LRA +D          A   CG +  D AP  +    +M+        G+  +H GPCE 
Sbjct  89   LRALLD---------PAAPGCGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITSHHGPCEA  139

Query  334  WLDDTRVLQHDNCHEVISG--KTYDLDYSAC--NGSCTLYWYWLGVRYLKQVYSWQVYKA  389
            W+D+TRV   D+C    +G   T  ++Y+AC    +C L +YWL +       +WQVYK 
Sbjct  140  WIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLALHEA----NWQVYKQ  195

Query  390  CVPI  393
            CVPI
Sbjct  196  CVPI  199

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 63/127 (50%), Gaps = 23/127 (18%)

Query  81   GYATLRALMDDDGL---YSVTEEGLFDCG----LTFPNTETQPIPTNGSFITSGYTLDGP  133
            G+++LRAL+D        S T+    D      + F N E         FITS +   GP
Sbjct  85   GFSSLRALLDPAAPGCGNSRTDVAPVDVSGLSVMQFQNDEE-----GKGFITSHH---GP  136

Query  134  CEIWIDNTLALAGRNCHTEFPEGHHT--IDYSVC--GESCRVSWFWLGIKYQGERYSWQV  189
            CE WIDNT    G +C  +F     T  I+Y+ C  G++C ++++WL +       +WQV
Sbjct  137  CEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQV  192

Query  190  FKNCINL  196
            +K C+ +
Sbjct  193  YKQCVPI  199

>PYAP_22257
Length=247

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 68/147 (46%), Gaps = 21/147 (14%)

Query  260  LEGQNFST--TDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-  316
             EG+ ++   T +   + +A  F S + F     +  V       CG +     PQ +  
Sbjct  45   FEGRKYNNDPTSNVKAFTEA--FKSQKTFKTLKDM--VEKQLKGSCGKSSGKGKPQSVEG  100

Query  317  ------DGIMRSTGY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSC  366
                  +     TG+  +H GPCE+W+DDTRV+  DNC     G      ++YS C G C
Sbjct  101  LSDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGEC  160

Query  367  TLYWYWLGVRYLKQVYSWQVYKACVPI  393
             L +YWL +   +    WQVYK CVPI
Sbjct  161  MLRFYWLALHEPE----WQVYKNCVPI  183

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 16/99 (16%)

Query  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFP--EGH  157
            EGL D  + + NTE +       F++S     GPCEIWID+T  +   NC  +F      
Sbjct  99   EGLSD--VHWENTEEKT-----GFVSS---HSGPCEIWIDDTRVMHEDNCVAKFKGYPAK  148

Query  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
              ++YSVC   C + ++WL +        WQV+KNC+ +
Sbjct  149  MPVNYSVCKGECMLRFYWLAL----HEPEWQVYKNCVPI  183

>PYU1_G001519
Length=265

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 78/176 (44%), Gaps = 21/176 (12%)

Query  234  AHQLVILPAPTY-----------TVEGKDNRWKPLAFLEGQN-FSTTDDFVGYLDAN-GF  280
            AH  + LP PT+           T++G      P     G +  S T+ ++    A   +
Sbjct  21   AHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKAQTKY  80

Query  281  DSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-RSTGYTHDGPCEVWLDDTR  339
             SL+     D+   V + A   CGF+D +  PQP+PD +       +H GPCEVW DD  
Sbjct  81   KSLKDLAMSDA-QKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVM  139

Query  340  VLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            V Q DNC   I      L Y  + C G   L  +W+ +     V +WQ+Y  C PI
Sbjct  140  VFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIAL----HVPTWQIYTNCAPI  191

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 64/157 (41%), Gaps = 22/157 (14%)

Query  43   PPPFFVVDGMDYRGSPV----AYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVT  98
            P    V  GM +   P+    AYL+      A +AQT      Y +L+ L   D    V 
Sbjct  48   PSTLTVPAGMSFGTDPLSNTNAYLK------AFKAQT-----KYKSLKDLAMSDA-QKVE  95

Query  99   EEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHH  158
                 +CG +  N   QP+P    +     +  GPCE+W D+ +     NC    PE   
Sbjct  96   SGATKECGFSDVNGTPQPLPDTVQWDRFDNSHMGPCEVWCDDVMVFQDDNCSVNIPEVPA  155

Query  159  TIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
             + Y  + C     ++ FW+ +       +WQ++ NC
Sbjct  156  VLKYDKAKCVGKKMLTSFWIALHVP----TWQIYTNC  188

>PPTG_03143
Length=368

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 81/179 (45%), Gaps = 26/179 (15%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
            H  +  PA T+     DN  + +A +E           G     T  F    + + + SL
Sbjct  22   HGYLTDPAVTFLSSSTDNT-QFIATIESSASGFSGTFSGSPADNTAAFTTAFEVSSYTSL  80

Query  284  RAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWLD  336
            +  ++  +  +V   A   CG  DPD   QP+P+  +      S G+T  H+GPCEVW D
Sbjct  81   KELINALATITVT-DATLTCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCEVWCD  139

Query  337  DTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            D R  Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  140  DVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINCAPL  194

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +L+ L++     +VT+  L  CG   P+   QP+P          + G+T   +GPCE
Sbjct  77   YTSLKELINALATITVTDATL-TCGSCDPDETAQPLPETYVEWSHSSSEGFTSSHEGPCE  135

Query  136  IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D+  A    +C   +      + Y    C  +  ++++WL +       +WQV+ NC
Sbjct  136  VWCDDVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYINC  191

Query  194  INLSAS  199
              L ++
Sbjct  192  APLEST  197

>PYAP_18138
Length=268

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 17/124 (14%)

Query  269  DDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP--DGIMRSTGYT  326
            +++      +G   LR+++D         +    CG +  D +P+PIP  + +      T
Sbjct  73   NEWAAAAKQHGVKDLRSYID---------AKITECGDSLKDVSPKPIPKTNTVTFERALT  123

Query  327  HDGPCEVWLDDTRVLQHDNCHEVISGK-TYDLDYSACNG-SCTLYWYWLGVRYLKQVYSW  384
            H GPCE W+DDTRV Q+++C      K T  LDYS C G +C L +YWLG+    Q   W
Sbjct  124  HKGPCEFWIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGL----QNSDW  179

Query  385  QVYK  388
            QVY+
Sbjct  180  QVYR  183

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 7/102 (7%)

Query  94   LYSVTEEGLFDCGLTFPNTETQPIP-TNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTE  152
            L S  +  + +CG +  +   +PIP TN        T  GPCE WID+T      +C   
Sbjct  87   LRSYIDAKITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEFWIDDTRVFQNNDCEPY  146

Query  153  FPEGHHT-IDYSVC-GESCRVSWFWLGIKYQGERYSWQVFKN  192
            F E     +DYS C G++C + ++WLG+    +   WQV++N
Sbjct  147  FKEKSTVPLDYSPCTGKTCLLRFYWLGL----QNSDWQVYRN  184

>PYIW_24288
Length=201

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 15/127 (12%)

Query  276  DANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-------DGIMRSTGYTHD  328
            + N + +LR  +D  +++S  A AD  CGFT    A QP+P       + + +    TH+
Sbjct  81   NQNRYRNLRELVDFTAVFS--AGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHE  138

Query  329  GPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQV  386
            GPCEVW D     +  NC +   G    L Y  S C G+  L +YWL +        W+V
Sbjct  139  GPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEV  194

Query  387  YKACVPI  393
            Y  CVP+
Sbjct  195  YINCVPL  201

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 14/123 (11%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGY--TLDGPCE  135
            Y  LR L+D   ++S   +   +CG T      QP+P       + +  G   T +GPCE
Sbjct  85   YRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPCE  142

Query  136  IWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D  LA    NC   F      + Y  SVC  +  + ++WL +    +   W+V+ NC
Sbjct  143  VWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWEVYINC  198

Query  194  INL  196
            + L
Sbjct  199  VPL  201

>PHYRA_93650
Length=231

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 15/113 (13%)

Query  281  DSLRAFMDDD-SLYSVNASADFRCGFTDPDA-APQPIPDGIMR-STGYTHDGPCEVWLDD  337
            +++R  +D D SLY  +      CGF+DP+A A  P  DG      G  H GPCE+WLDD
Sbjct  79   NNIRKLLDSDTSLYGAD------CGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDD  132

Query  338  TRVLQHDNCHEVISGKTYDLDYSACNGSCTLYWYWLGVR-YLKQVYSWQVYKA  389
            T VL +D+C +  S +    DY + NG C   +YWL  +      Y WQ+YKA
Sbjct  133  TMVLHNDDCAKAFSVE----DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKA  180

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 19/119 (16%)

Query  79   ERGYAT-LRALMDDD-GLYSVTEEGLFDCGLTFPNTETQPIPTNGSF-ITSGYTLDGPCE  135
            E GYA  +R L+D D  LY        DCG + PN + +  P++G+     G    GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  136  IWIDNTLALAGRNCHTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGE---RYSWQVFK  191
            IW+D+T+ L   +C   F     +++  +    C   ++WL   +QG    +Y WQ++K
Sbjct  128  IWLDDTMVLHNDDCAKAF-----SVEDYMSINGCMFRFYWLA--FQGSTSGKYVWQIYK  179

>PYVX_19277
Length=331

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 14/137 (10%)

Query  266  STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR----  321
            + T  F    DA+ + SLR F++D     V +     CG+T+P+   Q +PD  +     
Sbjct  64   TNTASFTKAFDASTYTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHT  122

Query  322  -STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDL--DYSACNGSCTLYWYWLGVR  376
             + G+T  H+GPCEVW D+TRV Q D+C    +     L  D  AC GS  L +YWL + 
Sbjct  123  STEGFTSSHEGPCEVWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLAL-  181

Query  377  YLKQVYSWQVYKACVPI  393
                  +WQVY  C  +
Sbjct  182  ---HSSTWQVYINCAAL  195

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 53/123 (43%), Gaps = 13/123 (11%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--DGPCE  135
            Y +LR  ++D G   V  +    CG T PN   Q +P          T G+T   +GPCE
Sbjct  78   YTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGFTSSHEGPCE  136

Query  136  IWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNC  193
            +W D T      +C   +      +  D   C  S  ++++WL +       +WQV+ NC
Sbjct  137  VWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALHSS----TWQVYINC  192

Query  194  INL  196
              L
Sbjct  193  AAL  195

>PHYSO_426658
Length=210

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 77/179 (43%), Gaps = 24/179 (13%)

Query  234  AHQLVILPAPTYTVEGKDNRWK---PLAFLE---GQNFSTTDD-------FVGYLDANGF  280
            AH  ++ PA T T  G    ++   P+  L    G  F+T  D       F   L A+ +
Sbjct  22   AHGKLVKPALTLTGTGYGGNFQSTIPMTSLTPKPGDIFTTYPDYSKNTAAFDRALKASQY  81

Query  281  DSLRAFM---DDDSLYSVNASADFRCGFTDP-DAAPQPIPDGIM-RSTGYTHDGPCEVWL  335
             SL+ FM    D +    N      CGFTDP D A QP+PD +     G  HDGPCE+W 
Sbjct  82   KSLKEFMYSTQDMTKGRFNLPKTAECGFTDPVDGAVQPLPDQVEWYGGGMIHDGPCEIWC  141

Query  336  DDTRVLQHD-NCHEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            DD   +    NC        +  + + C G   L  YWLG      +  WQVY  C  I
Sbjct  142  DDEVAMPFTPNCRAAYPDGKFPYEKAKCEGKKRLTMYWLGT-----LLEWQVYIDCAKI  195

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 7/102 (7%)

Query  104  DCGLTFP-NTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALA-GRNCHTEFPEGHHTID  161
            +CG T P +   QP+P    +   G   DGPCEIW D+ +A+    NC   +P+G    +
Sbjct  106  ECGFTDPVDGAVQPLPDQVEWYGGGMIHDGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYE  165

Query  162  YSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASALVT  203
             + C    R++ +WLG   +     WQV+ +C  +      T
Sbjct  166  KAKCEGKKRLTMYWLGTLLE-----WQVYIDCAKIGEGGSAT  202

>PYVX_24563
Length=254

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 65/134 (49%), Gaps = 24/134 (18%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIM-------RST  323
            F     + G+ SLRA +D+    SV+      CG T  D +P  +    +          
Sbjct  69   FTSTFPSTGYTSLRAMIDE----SVS-----DCGNTRTDVSPVDMTGKKVLHWQNDQEGV  119

Query  324  GY--THDGPCEVWLDDTRVLQHDNCHEVISG--KTYDLDYSACNGSCTLYWYWLGVRYLK  379
            G+  +H GPCEVW+DD  V   D+C  V +      D D+S C+GSCTL +YWL +    
Sbjct  120  GFVSSHHGPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLALHEPN  179

Query  380  QVYSWQVYKACVPI  393
                WQ+YK C PI
Sbjct  180  ----WQIYKQCAPI  189

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 67/142 (47%), Gaps = 35/142 (25%)

Query  81   GYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGS-------------FITSG  127
            GY +LRA++D         E + DCG T   T+  P+   G              F++S 
Sbjct  77   GYTSLRAMID---------ESVSDCGNT--RTDVSPVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  128  YTLDGPCEIWIDNTLALAGRNC---HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGER  184
            +   GPCE+WID+ +     +C   +T +P  +   D+S C  SC + ++WL +      
Sbjct  126  H---GPCEVWIDDVMVTHQDDCRAVYTSYP-ANVDADFSKCSGSCTLRFYWLAL----HE  177

Query  185  YSWQVFKNCINLSASALVTMIG  206
             +WQ++K C  ++ S   T +G
Sbjct  178  PNWQIYKQCAPITNSDYSTTVG  199

>SPRG_19917
Length=241

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 25/135 (19%)

Query  74   QTWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI------TSG  127
            + + A+  Y TLRAL+D  G          DCG T  N   + IP+NG           G
Sbjct  65   KAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEG  115

Query  128  YTLD--GPCEIWIDNTLALAGRNCHTEF---PEGHHTIDYSVCG-ESCRVSWFWLGIKYQ  181
            + L   GPCE+W+DN       +C T F   P  +  +DYS CG + C + ++W+ +   
Sbjct  116  FILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIAL---  172

Query  182  GERYSWQVFKNCINL  196
                 WQV+KNC+ L
Sbjct  173  -HSPRWQVYKNCVPL  186

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 71/152 (47%), Gaps = 27/152 (18%)

Query  258  AFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFR---CGFTDPDAAPQP  314
            AFL G+       F G    N  +  +AF       ++ A  D     CG T  + A + 
Sbjct  46   AFLPGK-------FNGSPQNNAANFNKAFKAQSKYKTLRALLDQHGPDCGNTLTNVARKE  98

Query  315  IP-DGIMR----STG----YTHDGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSAC  362
            IP +G M      TG     +H GPCEVWLD+ RV Q+D+C      K      +DYS+C
Sbjct  99   IPSNGKMTFQNPDTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSC  158

Query  363  NGS-CTLYWYWLGVRYLKQVYSWQVYKACVPI  393
                C L +YW+ +   +    WQVYK CVP+
Sbjct  159  GAKGCMLRFYWIALHSPR----WQVYKNCVPL  186

>PHYKE_3912
Length=252

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 61/122 (50%), Gaps = 17/122 (14%)

Query  283  LRAFMD-DDSLYSVNASADFRCGFTDPDAAPQ--PIPDGIMRSTGYTHDGPCEVWLDDTR  339
            +R   D D+SLY  N      CGFTDP+A P+  P       S G  H G CE+WLDDT 
Sbjct  60   IRTLPDSDNSLYGAN------CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTM  113

Query  340  VLQHDNCHEVISGKTYD-------LDYSACNGSC-TLYWYWLGVRYLKQVYSWQVYKACV  391
            VL  D+C       T +       +D S C+ S   L +YWL  + +     WQVYK CV
Sbjct  114  VLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCV  173

Query  392  PI  393
            P+
Sbjct  174  PL  175

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 74/166 (45%), Gaps = 21/166 (13%)

Query  49   VDGMDYRGSPVAYLEQQGVH---TAIEAQTWLAERG-YATLRALMD-DDGLYSVTEEGLF  103
            ++  DY   P+A             IE Q W  E G    +R L D D+ LY        
Sbjct  21   INSHDYMNIPLAEFTDSVTSAWVVQIEPQ-WTGELGQLHDIRTLPDSDNSLYGA------  73

Query  104  DCGLTFPNTETQPIPTNG-SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT---  159
            +CG T PN   +  PT G +  + G    G CEIW+D+T+ L+  +C   + +       
Sbjct  74   NCGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDTMVLSSDDCQAAYRDDTQEKAS  133

Query  160  ----IDYSVCGESC-RVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
                ID S+C  S   + ++WL  +    +  WQV+K+C+ L+  A
Sbjct  134  VFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDCVPLTGPA  179

>PYVX_20783
Length=276

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 68/138 (49%), Gaps = 20/138 (14%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
            G  +   DD   +  ANG  SL+ ++      +   S D  CG T+ D  PQP+P DG  
Sbjct  60   GDYYQAVDD---WFTANGISSLKEYI------TTYGSFD-ECGNTEKDGTPQPVPSDGYA  109

Query  321  R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGKT---YDLDYSACNGSCTLYWYWLGV  375
            +  + G +H GPCE+W DDTRV    NC    SG++     +D + C GS    +YWL +
Sbjct  110  QHDTLGNSHPGPCEIWCDDTRVFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL  169

Query  376  RYLKQVYSWQVYKACVPI  393
                    WQVY  CV +
Sbjct  170  H----AQPWQVYINCVAL  183

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 74/175 (42%), Gaps = 26/175 (15%)

Query  35   GEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIE-------AQTWLAERGYATLRA  87
            G G +++ P P    D + Y G P   ++   +  +            W    G ++L+ 
Sbjct  22   GHGNIIV-PQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISSLKE  80

Query  88   LMDDDGLYSVTEEGLFD-CGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLAL  144
                     +T  G FD CG T  +   QP+P++G     T G +  GPCEIW D+T   
Sbjct  81   Y--------ITTYGSFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVF  132

Query  145  AGRNCHTEF---PEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
               NC TEF         ID + C  S    ++WL +  Q     WQV+ NC+ L
Sbjct  133  TSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALHAQ----PWQVYINCVAL  183

>PYVX_21297
Length=263

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 59/111 (53%), Gaps = 7/111 (6%)

Query  286  FMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIMR-STGYTHDGPCEVWLDDTRVLQH  343
            +   D +  +  +A   CG TD +AA QP+P DG++       H GPCEVWLDDT+V   
Sbjct  50   YTGSDVIRDLANAAGSNCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASA  109

Query  344  DNCHEVISGKTYDLDYSACNG-SCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            ++C    + KT  +DYS C G SC L W WL          W+++  CV +
Sbjct  110  NDCWSTYADKTIPIDYSVCTGSSCQLRWVWLATHNDP----WEIFDNCVNV  156

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query  104  DCGLTFPNTETQPIPTNG--SFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHTID  161
            +CG T  N   QP+P++G  +F  S   + GPCE+W+D+T   +  +C + + +    ID
Sbjct  66   NCGNTDGNAAVQPVPSDGLVTFDISAVHI-GPCEVWLDDTKVASANDCWSTYADKTIPID  124

Query  162  YSVC-GESCRVSWFWLGIKYQGERYSWQVFKNCINL  196
            YSVC G SC++ W WL          W++F NC+N+
Sbjct  125  YSVCTGSSCQLRWVWLATHND----PWEIFDNCVNV  156

>PHYKE_8104
Length=86

 Score = 70.5 bits (171),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)

Query  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDD  289
            AHQ+V+LP PT+T   KD ++ PLAFLEG+ F+  +DF  + + NG+ SLR FMD+
Sbjct  27   AHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

 Score = 43.5 bits (101),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  38  QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDD  91
           Q+VL P P +  +  D + +P+A+LE +G     + + W  E GY +LR  MD+
Sbjct  29  QIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDN  82

>PYVX_22510
Length=596

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 65/137 (47%), Gaps = 13/137 (9%)

Query  266  STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR----  321
            + T  F     ++ + SL+  +         +     CG TDPD   Q +PD  +     
Sbjct  310  TNTASFTTAFASSSYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHS  369

Query  322  -STGYT--HDGPCEVWLDDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVR  376
             S G+T  H+GPCE+W DDTRV Q D+C    +     L Y  ++C+G+  L +YWL + 
Sbjct  370  DSEGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLALH  429

Query  377  YLKQVYSWQVYKACVPI  393
              +    WQVY  C  +
Sbjct  430  SSQ----WQVYVNCAAL  442

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 12/130 (9%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
            T  A   Y++L+ ++   G    T      CGLT P+   Q +P          + G+T 
Sbjct  317  TAFASSSYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDSEGFTA  376

Query  131  --DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYS  186
              +GPCEIW D+T      +C   +      + Y  + C  + R++++WL +        
Sbjct  377  SHEGPCEIWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLAL----HSSQ  432

Query  187  WQVFKNCINL  196
            WQV+ NC  L
Sbjct  433  WQVYVNCAAL  442

>PHYCA_19612
Length=610

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 83/180 (46%), Gaps = 28/180 (16%)

Query  235  HQLVILPAPTYTVEGKDNRWKPLAFLE-----------GQNFSTTDDFVGYLDANGFDSL  283
            H  +  PA T+     DN  + +A +E           G     T  F     ++ + SL
Sbjct  26   HGYMTEPAVTFLSSSTDNT-QFIATIESSASKFSGTFSGSPADNTAAFTKAFASSSYTSL  84

Query  284  RAFMDDDSLYSVNAS-ADFRCGFTDPDAAPQPIPDGIMR-----STGYT--HDGPCEVWL  335
            +  +   SL +V  + A   CG  +PD   QP+PD  +      + G+T  H+GPCEVW 
Sbjct  85   KDLIT--SLATVTVTDATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEGPCEVWC  142

Query  336  DDTRVLQHDNCHEVISGKTYDLDY--SACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393
            DD RV Q D+C    +    +L Y   AC G+ TL +YWL +       +WQVY  C P+
Sbjct  143  DDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL----HSSTWQVYVNCAPL  198

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 14/132 (11%)

Query  271  FVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGIMR-----STGY  325
            F    +++ + SL+  ++D +  +V   A   CG  DPD   Q +P   +      S G+
Sbjct  374  FTTAFESSSYSSLKELINDKATITVT-DATLTCGACDPDETAQALPATYVEWAHSDSEGF  432

Query  326  T--HDGPCEVWLDDTRVLQHDNCHE--VISGKTYDLDYSACNGSCTLYWYWLGVRYLKQV  381
            T  H+GPCEVW DD RV Q D+C      +      D+ AC GS  L +YWL +      
Sbjct  433  TASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLAL----HS  488

Query  382  YSWQVYKACVPI  393
             +WQVY  C P+
Sbjct  489  STWQVYVNCAPL  500

 Score = 54.7 bits (130),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/133 (26%), Positives = 62/133 (47%), Gaps = 13/133 (10%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL  130
            T      Y++L+ L++D    +VT+  L  CG   P+   Q +P          + G+T 
Sbjct  376  TAFESSSYSSLKELINDKATITVTDATL-TCGACDPDETAQALPATYVEWAHSDSEGFTA  434

Query  131  --DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYS  186
              +GPCE+W D+     G +C  ++      +  D+  C  S  ++++WL +       +
Sbjct  435  SHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALHSS----T  490

Query  187  WQVFKNCINLSAS  199
            WQV+ NC  L ++
Sbjct  491  WQVYVNCAPLEST  503

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 58/131 (44%), Gaps = 13/131 (10%)

Query  77   LAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN----GSFITSGYTL--  130
             A   Y +L+ L+      +VT+  L  CG   P+   QP+P          T G+T   
Sbjct  76   FASSSYTSLKDLITSLATVTVTDATL-TCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSH  134

Query  131  DGPCEIWIDNTLALAGRNCHTEFPEGHHTIDY--SVCGESCRVSWFWLGIKYQGERYSWQ  188
            +GPCE+W D+       +C  ++      + Y    C  +  ++++WL +       +WQ
Sbjct  135  EGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSS----TWQ  190

Query  189  VFKNCINLSAS  199
            V+ NC  L ++
Sbjct  191  VYVNCAPLEST  201

>PHYSO_256017
Length=148

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 12/86 (14%)

Query  295  VNASADFRCGFTDPDAAPQPIP-DGIMR-----STGYTHDGPCEVWLDDTRVLQHDNCHE  348
            ++ + D +CG T  DA+PQP+P DG+++       G+TH GPCEV++DD  V+  DNC +
Sbjct  14   LDMTKDKKCGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVHGDNCED  73

Query  349  VIS----GKTYD--LDYSACNGSCTL  368
                   G T D  +DYS+CNG CTL
Sbjct  74   EFQGGGVGSTLDNPVDYSSCNGKCTL  99

 Score = 50.8 bits (120),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 11/79 (14%)

Query  105  CGLTFPNTETQPIPTNGSFI-----TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEG---  156
            CG T  +   QP+P++G          G+T  GPCE++ID+ + + G NC  EF  G   
Sbjct  22   CGETLADASPQPVPSDGLVKWLGNGGGGFTHVGPCEVYIDDKMVVHGDNCEDEFQGGGVG  81

Query  157  ---HHTIDYSVCGESCRVS  172
                + +DYS C   C ++
Sbjct  82   STLDNPVDYSSCNGKCTLT  100

>PHYCA_120062
Length=212

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 67/136 (49%), Gaps = 19/136 (14%)

Query  262  GQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIP-DGIM  320
            G  +   DD   +   N  DS++ ++      +  AS    CG T  +  PQP+P DG +
Sbjct  8    GDYYQAVDD---WFTKNNVDSVKDYV------TKYASDIPECGNTKKNGTPQPLPTDGFV  58

Query  321  R--STGYTHDGPCEVWLDDTRVLQHDNCHEVISGK---TYDLDYSACNGSCTLYWYWLGV  375
            +  S G +H GPCE+W DDTRV  + NC    +G+   +  +D   C  S  L +YWL +
Sbjct  59   KHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSLPIDLDTCKSSSELVFYWLAL  118

Query  376  RYLKQVYSWQVYKACV  391
                 V  WQVY  CV
Sbjct  119  ----HVQPWQVYINCV  130

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 52/103 (50%), Gaps = 11/103 (11%)

Query  104  DCGLTFPNTETQPIPTNGSFI---TSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT-  159
            +CG T  N   QP+PT+G F+   + G +  GPCEIW D+T      NC  E+     T 
Sbjct  39   ECGNTKKNGTPQPLPTDG-FVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTS  97

Query  160  --IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASA  200
              ID   C  S  + ++WL +  Q     WQV+ NC+ L  SA
Sbjct  98   LPIDLDTCKSSSELVFYWLALHVQ----PWQVYINCVTLDGSA  136

>HYAP_11923
Length=606

 Score = 77.0 bits (188),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 12/105 (11%)

Query  295  VNASADFRCGFTDPDAAPQPIPDGI----MRSTGYT--HDGPCEVWLDDTRVLQHDNC--  346
            V   A   CG TDP+  PQPIPD +      + G+T  H+GPCE W DDT+V Q +NC  
Sbjct  93   VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTASHEGPCEAWCDDTQVFQDENCAA  152

Query  347  HEVISGKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACV  391
            H   +      D + C+G+    +YWL +       +WQVY  C 
Sbjct  153  HFTTAPAKMPYDKAKCSGASRFTFYWLALHS----STWQVYVNCA  193

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 12/129 (9%)

Query  75   TWLAERGYATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTN---GSFITSGYTL-  130
            T      +++++ L    G   V +    +CGLT PN   QPIP         T G+T  
Sbjct  72   TAFGSSKFSSIKDLATSLGQI-VAKGATLECGLTDPNGTPQPIPDELEWSHSGTEGFTAS  130

Query  131  -DGPCEIWIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSW  187
             +GPCE W D+T      NC   F      +  D + C  + R +++WL +       +W
Sbjct  131  HEGPCEAWCDDTQVFQDENCAAHFTTAPAKMPYDKAKCSGASRFTFYWLAL----HSSTW  186

Query  188  QVFKNCINL  196
            QV+ NC  L
Sbjct  187  QVYVNCAAL  195

>PHYCA_123316
Length=316

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 67/136 (49%), Gaps = 13/136 (10%)

Query  266  STTDDFVGYLDANGFDSLRAFMDDDSLYSVNASADFRCGFTDPDAAPQPIPDGI----MR  321
            + T+ F    +++ + S++ F+ D      N  A   CG TDP+  PQ +P  +      
Sbjct  64   ANTEAFWAAFNSSKYSSIKDFVTDKGQIVANG-ATIECGLTDPNETPQSLPAELEWTHSD  122

Query  322  STGYT--HDGPCEVWLDDTRVLQHDNC--HEVISGKTYDLDYSACNGSCTLYWYWLGVRY  377
            + G+T  H+GPCE W DDT+V Q  NC  H   +      D + C+GS  L +YWL +  
Sbjct  123  TEGFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH-  181

Query  378  LKQVYSWQVYKACVPI  393
                 +WQ+Y  C  +
Sbjct  182  ---SSTWQIYVNCAAL  194

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 58/125 (46%), Gaps = 12/125 (10%)

Query  82   YATLRALMDDDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFI---TSGYTL--DGPCEI  136
            Y++++  + D G   V      +CGLT PN   Q +P    +    T G+T   +GPCE 
Sbjct  78   YSSIKDFVTDKGQI-VANGATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEA  136

Query  137  WIDNTLALAGRNCHTEFPEGHHTI--DYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194
            W D+T      NC   F      +  D + C  S R++++WL +       +WQ++ NC 
Sbjct  137  WCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLAL----HSSTWQIYVNCA  192

Query  195  NLSAS  199
             L  S
Sbjct  193  ALEGS  197

Lambda      K        H        a         alpha
   0.321    0.137    0.451    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 36945105180

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40