Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_181711475629429414820.0
PYU1_G001735147563423388134e-107
PYIR_13451147563593487806e-102
PHYSO_471523147563483347771e-101
PPTG_17127147563513397734e-101
PITG_18456147563513387711e-100
PHYRA_81100147563493377622e-99
PHYCA_556162147563513377614e-99
PYAP_17762147563483247343e-95
PHALS_06478147563453317204e-93
PYIW_19971147563483447013e-90
PYAR_13570147563223206332e-80
PHYKE_8393147563263336273e-79
CCA18899147563433345883e-73
SPRG_06336147563353104501e-52
SDRG_01781147563353064501e-52
CCI45123147563012984332e-50
H310_09223147563333233942e-44
H257_06294147563583473752e-41
CCI451271609872021952072e-18
SPRG_060581612812581121383e-08
H310_00231161281495481358e-08
SDRG_127621612813921101322e-07
H257_06722161281482521261e-06
PYAP_16997161281018571232e-06
PPTG_188981612815591161223e-06
PITG_205621612815591161214e-06
PYAR_23286161286071201205e-06
CCA18875161281514321207e-06
CCI4122514459981521197e-06
SDRG_127631251091317341197e-06
PHYRA_849161612815411281171e-05
SPRG_060591251091312391171e-05
PYVX_20438161281346541162e-05
CCA1648714459975521162e-05
PYU1_G00106314459783521152e-05
CCI44752161281526311143e-05
PYVX_1357414459950521143e-05
PHYKE_247914459171521093e-05
PHYKE_1990161281499401143e-05
PYU1_G006347161281095611143e-05
PYIR_1530914459937521134e-05
PHALS_0653314459930521134e-05
PYIW_1738116128952351125e-05
PYIW_1317214459939521116e-05
CCA17102152926884521117e-05
PHYRA_7783414459936521117e-05
PITG_1806714459924521117e-05
PPTG_1340114459927521117e-05
PYAP_1729014459835521108e-05
PYIR_21589161281568611119e-05
PHYSO_361747161281523311109e-05
HYAP_08645161281514311101e-04
PHYCA_503112152926214521061e-04
CCI42457152926906521091e-04
H310_002301251091248321091e-04
H257_067211251091238321073e-04
CCA180231526711381201063e-04
PYAR_1991414459788521053e-04
PYAR_154631526710911491054e-04
CCI4589595111721551046e-04
CCA1903395111883551038e-04
CCI462351526711551471010.001
PYVX_13312152671016521000.001
H257_0309315267975521000.002
PYAP_1863615267100952990.002
H310_048431526796852980.003
PITG_11303931829336960.003
H310_063781445983752960.004
PHYRA_8254315267119952960.005
PPTG_1937115267119552960.005
PHYSO_54459815267116352960.005
SPRG_00889122518994124950.006
SDRG_01408122518916128950.006
SDRG_014071526781552950.007
SPRG_008901526788352940.008
PYIR_1745395112619134950.008
SPRG_1702213189210742870.008
PHYCA_50471216208141910.010
PHALS_0354016904136930.013
PITG_1921315267120152930.014
CCI1048915870977737920.014
PHYKE_5678241780937920.014
H257_135671445983652920.015
PYU1_G0088481526776552920.015
PYIR_1838215267115452920.015
PYIW_169871526782152920.015
PPTG_05519241781037920.016
PITG_02762241781037920.016
PHYCA_506137241781037920.016
PHYSO_344112241781337920.016
PYIW_18480241775537920.016
PHYRA_79281241780937920.017
PHALS_04098152671183113920.017
HYAP_08026241779837920.017
CCA21715241778237910.017
CCA2186015507878237910.017
H310_048421395771081124910.020
PYVX_18338241774637910.021
PYU1_G0122741583587384910.022
PITG_178931431374738900.022
PHYRA_7353469686121051910.023
PHYSO_48454116911126900.024
PYAP_22646241781537900.025
PYU1_G0128591850118341900.025
PHALS_03645241783037900.028
PPTG_166591691662900.029
PPTG_045531431390429900.030
SDRG_088001445988152890.032
PHYRA_735351431387551890.033
PHYRA_788151691962890.035
SPRG_0275212342883154890.035
PYAR_233668366382847890.038
PHYSO_3436291445997723890.038
PYAR_19883241783349880.040
PYU1_G004386241783737880.042
H257_0336112342869955880.043
PHYSO_5561641431376529880.043
PYIR_13120241781437880.043
SPRG_054491445972353880.046
PHYSO_3501971255455799880.047
CCI40991241780138880.047
HYAP_1171212554558103870.050
SPRG_08346241779739870.053
SDRG_05150241778739870.053
HYAP_1171317645417103860.060
PHYCA_50938512554557103860.066
H257_039319639695126860.071
PITG_0002016927125860.075
HYAP_0445715267120334860.078
PYVX_233491431392451860.080
PYU1_G0089818366371241860.083
PYU1_G0032291681062860.086
PYIR_2337215835141594860.092
PHYKE_66621526776534850.092
SDRG_1448712342896454860.093
PYAP_234788506089726850.11
PYU1_G0007249278718933820.12
HYAP_06101288598433840.14
H310_01921185334152830.15
PYVX_2258915835137558840.15
PYAP_153748366359542830.15
SDRG_03175640393436830.17
H310_070709639680126830.19
H257_06469219447622750.20
PHYKE_55881675143830.20
SPRG_1631213132226156810.20
SDRG_05567819598059830.20
H310_136271431367830830.20
PYIW_219018506091335830.21
SDRG_021352194430633810.22
CCA2551013479113933820.22
H257_03363185331652810.23
PYAP_2414415835102281820.24
CCA245311853374147810.25
PYIR_144941681962820.25
H310_07701241781137820.26
PYVX_1308413479126734820.26
H257_07514241781037820.27
SPRG_091281431362048810.30
PHYKE_91461255455799810.32
H257_098231431365430810.33
PYIW_224771118386441810.33
PYAR_192918506071134810.35
PYIR_131682885135333810.38
PHYRA_7271837973250800.39
PPTG_1075537972350800.41
PITG_2010315835130183800.43
SDRG_0008012454429840790.44
PITG_033182885134333800.47
H310_02133640397036800.47
SDRG_05128126310512129790.47
PHYRA_944092885127033800.47
H257_081821685943800.48
H257_02642640397536800.48
PPTG_160442885137833800.49
PHYSO_2484812885128333800.49
SPRG_08326126310501131790.49
PITG_0041637969850790.50
PYIW_178181850118838800.51
CCI47145185339059790.53
SDRG_142861431367052790.56
SPRG_06021819598359790.57
H310_0666713886889634790.58
SPRG_01654640392336790.59
CCI4379313479111733790.61
H257_0902812554556155780.62
H310_06666863288734790.66
PYIW_1849115835168483790.67
PHYSO_478611185352252780.68
PHYRA_73430185339552780.68
PYIR_201621118388441780.70
HYAP_13690185337752780.70
H257_092621030272954780.71
H310_056861030275265780.72
PYIR_245888506090932780.72
H257_03095139577108652780.73
PYU1_G0074238506092837780.75
PHYKE_4910185237558770.76
CCI393672885204633780.77
PHALS_063341850106436780.81
SPRG_119001660550780.81
HYAP_1401316398122770.82
CCA22367319988541770.89
PHALS_06336185251158770.89
PPTG_14630185339852770.91
PITG_02109185352252770.91
PYIR_2224612554559103770.96
PYAR_1869095112455135771.1
SDRG_1277615835118454771.1
PHYCA_504801185339852761.1
PHALS_080978195106933771.1
H310_0020915835119853771.1
PHYSO_50691837975850761.2
PYIR_1511813479122232771.2
PHALS_0260812554557103761.3
PYAR_255001583547337761.4
H310_029338195105334761.4
CCI434561109212641721.4
PYIW_1891113479119632761.4
HYAP_11295319968945761.4
H257_01308863289734761.5
HYAP_132671408870535751.5
PHALS_055872885136134751.6
HYAP_08248749078427751.7
H257_13346749058748751.7
PHYKE_7856288534620741.8
PHALS_066991431388429751.8
HYAP_0951115835129583751.8
H310_14473749061326751.8
SPRG_0491212454426156741.9
CCA191181109212531711.9
H257_100638195104134751.9
PYAP_21902137242550141751.9
PPTG_0682315835132183751.9
PHYKE_258137968353742.0
SPRG_1587113098310161692.0
PYU1_G0095089576532832742.0
SPRG_01860863267434742.1
H310_14019920468347742.1
H257_007291109212126702.1
SDRG_0708612810665657742.2
SDRG_063422885129244742.3
H310_010941109212126702.3
HYAP_0930413479114454742.4
PYU1_G007013319975052742.4
SDRG_08236863286434742.4
SPRG_085322885129244742.4
PYAP_17800319978052742.4
H257_0130913886889534742.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18171

Length=294
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18171                                                            575        0.0   
PYU1_G001735                                                          317        4e-107
PYIR_13451                                                            305        6e-102
PHYSO_471523                                                          303        1e-101
PPTG_17127                                                            302        4e-101
PITG_18456                                                            301        1e-100
PHYRA_81100                                                           298        2e-99 
PHYCA_556162                                                          297        4e-99 
PYAP_17762                                                            287        3e-95 
PHALS_06478                                                           281        4e-93 
PYIW_19971                                                            274        3e-90 
PYAR_13570                                                            248        2e-80 
PHYKE_8393                                                            246        3e-79 
CCA18899                                                              231        3e-73 
SPRG_06336                                                            177        1e-52 
SDRG_01781                                                            177        1e-52 
CCI45123                                                              171        2e-50 
H310_09223                                                            156        2e-44 
H257_06294                                                            149        2e-41 
CCI45127                                                              84.3       2e-18 
SPRG_06058                                                            57.8       3e-08 
H310_00231                                                            56.6       8e-08 
SDRG_12762                                                            55.5       2e-07 
H257_06722                                                            53.1       1e-06 
PYAP_16997                                                            52.0       2e-06 
PPTG_18898                                                            51.6       3e-06 
PITG_20562                                                            51.2       4e-06 
PYAR_23286                                                            50.8       5e-06 
CCA18875                                                              50.8       7e-06 
CCI41225                                                              50.4       7e-06 
SDRG_12763                                                            50.4       7e-06 
PHYRA_84916                                                           49.7       1e-05 
SPRG_06059                                                            49.7       1e-05 
PYVX_20438                                                            49.3       2e-05 
CCA16487                                                              49.3       2e-05 
PYU1_G001063                                                          48.9       2e-05 
CCI44752                                                              48.5       3e-05 
PYVX_13574                                                            48.5       3e-05 
PHYKE_2479                                                            46.6       3e-05 
PHYKE_1990                                                            48.5       3e-05 
PYU1_G006347                                                          48.5       3e-05 
PYIR_15309                                                            48.1       4e-05 
PHALS_06533                                                           48.1       4e-05 
PYIW_17381                                                            47.8       5e-05 
PYIW_13172                                                            47.4       6e-05 
CCA17102                                                              47.4       7e-05 
PHYRA_77834                                                           47.4       7e-05 
PITG_18067                                                            47.4       7e-05 
PPTG_13401                                                            47.4       7e-05 
PYAP_17290                                                            47.0       8e-05 
PYIR_21589                                                            47.4       9e-05 
PHYSO_361747                                                          47.0       9e-05 
HYAP_08645                                                            47.0       1e-04 
PHYCA_503112                                                          45.4       1e-04 
CCI42457                                                              46.6       1e-04 
H310_00230                                                            46.6       1e-04 
H257_06721                                                            45.8       3e-04 
CCA18023                                                              45.4       3e-04 
PYAR_19914                                                            45.1       3e-04 
PYAR_15463                                                            45.1       4e-04 
CCI45895                                                              44.7       6e-04 
CCA19033                                                              44.3       8e-04 
CCI46235                                                              43.5       0.001 
PYVX_13312                                                            43.1       0.001 
H257_03093                                                            43.1       0.002 
PYAP_18636                                                            42.7       0.002 
H310_04843                                                            42.4       0.003 
PITG_11303                                                            41.6       0.003 
H310_06378                                                            41.6       0.004 
PHYRA_82543                                                           41.6       0.005 
PPTG_19371                                                            41.6       0.005 
PHYSO_544598                                                          41.6       0.005 
SPRG_00889                                                            41.2       0.006 
SDRG_01408                                                            41.2       0.006 
SDRG_01407                                                            41.2       0.007 
SPRG_00890                                                            40.8       0.008 
PYIR_17453                                                            41.2       0.008 
SPRG_17022                                                            38.1       0.008 
PHYCA_504712                                                          39.7       0.010 
PHALS_03540                                                           40.4       0.013 
PITG_19213                                                            40.4       0.014 
CCI10489                                                              40.0       0.014 
PHYKE_5678                                                            40.0       0.014 
H257_13567                                                            40.0       0.015 
PYU1_G008848                                                          40.0       0.015 
PYIR_18382                                                            40.0       0.015 
PYIW_16987                                                            40.0       0.015 
PPTG_05519                                                            40.0       0.016 
PITG_02762                                                            40.0       0.016 
PHYCA_506137                                                          40.0       0.016 
PHYSO_344112                                                          40.0       0.016 
PYIW_18480                                                            40.0       0.016 
PHYRA_79281                                                           40.0       0.017 
PHALS_04098                                                           40.0       0.017 
HYAP_08026                                                            40.0       0.017 
CCA21715                                                              39.7       0.017 
CCA21860                                                              39.7       0.017 
H310_04842                                                            39.7       0.020 
PYVX_18338                                                            39.7       0.021 
PYU1_G012274                                                          39.7       0.022 
PITG_17893                                                            39.3       0.022 
PHYRA_73534                                                           39.7       0.023 
PHYSO_484541                                                          39.3       0.024 
PYAP_22646                                                            39.3       0.025 
PYU1_G012859                                                          39.3       0.025 
PHALS_03645                                                           39.3       0.028 
PPTG_16659                                                            39.3       0.029 
PPTG_04553                                                            39.3       0.030 
SDRG_08800                                                            38.9       0.032 
PHYRA_73535                                                           38.9       0.033 
PHYRA_78815                                                           38.9       0.035 
SPRG_02752                                                            38.9       0.035 
PYAR_23366                                                            38.9       0.038 
PHYSO_343629                                                          38.9       0.038 
PYAR_19883                                                            38.5       0.040 
PYU1_G004386                                                          38.5       0.042 
H257_03361                                                            38.5       0.043 
PHYSO_556164                                                          38.5       0.043 
PYIR_13120                                                            38.5       0.043 
SPRG_05449                                                            38.5       0.046 
PHYSO_350197                                                          38.5       0.047 
CCI40991                                                              38.5       0.047 
HYAP_11712                                                            38.1       0.050 
SPRG_08346                                                            38.1       0.053 
SDRG_05150                                                            38.1       0.053 
HYAP_11713                                                            37.7       0.060 
PHYCA_509385                                                          37.7       0.066 
H257_03931                                                            37.7       0.071 
PITG_00020                                                            37.7       0.075 
HYAP_04457                                                            37.7       0.078 
PYVX_23349                                                            37.7       0.080 
PYU1_G008981                                                          37.7       0.083 
PYU1_G003229                                                          37.7       0.086 
PYIR_23372                                                            37.7       0.092 
PHYKE_6662                                                            37.4       0.092 
SDRG_14487                                                            37.7       0.093 
PYAP_23478                                                            37.4       0.11  
PYU1_G000724                                                          36.2       0.12  
HYAP_06101                                                            37.0       0.14  
H310_01921                                                            36.6       0.15  
PYVX_22589                                                            37.0       0.15  
PYAP_15374                                                            36.6       0.15  
SDRG_03175                                                            36.6       0.17  
H310_07070                                                            36.6       0.19  
H257_06469                                                            33.5       0.20  
PHYKE_5588                                                            36.6       0.20  
SPRG_16312                                                            35.8       0.20  
SDRG_05567                                                            36.6       0.20  
H310_13627                                                            36.6       0.20  
PYIW_21901                                                            36.6       0.21  
SDRG_02135                                                            35.8       0.22  
CCA25510                                                              36.2       0.22  
H257_03363                                                            35.8       0.23  
PYAP_24144                                                            36.2       0.24  
CCA24531                                                              35.8       0.25  
PYIR_14494                                                            36.2       0.25  
H310_07701                                                            36.2       0.26  
PYVX_13084                                                            36.2       0.26  
H257_07514                                                            36.2       0.27  
SPRG_09128                                                            35.8       0.30  
PHYKE_9146                                                            35.8       0.32  
H257_09823                                                            35.8       0.33  
PYIW_22477                                                            35.8       0.33  
PYAR_19291                                                            35.8       0.35  
PYIR_13168                                                            35.8       0.38  
PHYRA_72718                                                           35.4       0.39  
PPTG_10755                                                            35.4       0.41  
PITG_20103                                                            35.4       0.43  
SDRG_00080                                                            35.0       0.44  
PITG_03318                                                            35.4       0.47  
H310_02133                                                            35.4       0.47  
SDRG_05128                                                            35.0       0.47  
PHYRA_94409                                                           35.4       0.47  
H257_08182                                                            35.4       0.48  
H257_02642                                                            35.4       0.48  
PPTG_16044                                                            35.4       0.49  
PHYSO_248481                                                          35.4       0.49  
SPRG_08326                                                            35.0       0.49  
PITG_00416                                                            35.0       0.50  
PYIW_17818                                                            35.4       0.51  
CCI47145                                                              35.0       0.53  
SDRG_14286                                                            35.0       0.56  
SPRG_06021                                                            35.0       0.57  
H310_06667                                                            35.0       0.58  
SPRG_01654                                                            35.0       0.59  
CCI43793                                                              35.0       0.61  
H257_09028                                                            34.7       0.62  
H310_06666                                                            35.0       0.66  
PYIW_18491                                                            35.0       0.67  
PHYSO_478611                                                          34.7       0.68  
PHYRA_73430                                                           34.7       0.68  
PYIR_20162                                                            34.7       0.70  
HYAP_13690                                                            34.7       0.70  
H257_09262                                                            34.7       0.71  
H310_05686                                                            34.7       0.72  
PYIR_24588                                                            34.7       0.72  
H257_03095                                                            34.7       0.73  
PYU1_G007423                                                          34.7       0.75  
PHYKE_4910                                                            34.3       0.76  
CCI39367                                                              34.7       0.77  
PHALS_06334                                                           34.7       0.81  
SPRG_11900                                                            34.7       0.81  
HYAP_14013                                                            34.3       0.82  
CCA22367                                                              34.3       0.89  
PHALS_06336                                                           34.3       0.89  
PPTG_14630                                                            34.3       0.91  
PITG_02109                                                            34.3       0.91  
PYIR_22246                                                            34.3       0.96  
PYAR_18690                                                            34.3       1.1   
SDRG_12776                                                            34.3       1.1   
PHYCA_504801                                                          33.9       1.1   
PHALS_08097                                                           34.3       1.1   
H310_00209                                                            34.3       1.1   
PHYSO_506918                                                          33.9       1.2   
PYIR_15118                                                            34.3       1.2   
PHALS_02608                                                           33.9       1.3   
PYAR_25500                                                            33.9       1.4   
H310_02933                                                            33.9       1.4   
CCI43456                                                              32.3       1.4   
PYIW_18911                                                            33.9       1.4   
HYAP_11295                                                            33.9       1.4   
H257_01308                                                            33.9       1.5   
HYAP_13267                                                            33.5       1.5   
PHALS_05587                                                           33.5       1.6   
HYAP_08248                                                            33.5       1.7   
H257_13346                                                            33.5       1.7   
PHYKE_7856                                                            33.1       1.8   
PHALS_06699                                                           33.5       1.8   
HYAP_09511                                                            33.5       1.8   
H310_14473                                                            33.5       1.8   
SPRG_04912                                                            33.1       1.9   
CCA19118                                                              32.0       1.9   
H257_10063                                                            33.5       1.9   
PYAP_21902                                                            33.5       1.9   
PPTG_06823                                                            33.5       1.9   
PHYKE_2581                                                            33.1       2.0   
SPRG_15871                                                            31.2       2.0   
PYU1_G009508                                                          33.1       2.0   
SPRG_01860                                                            33.1       2.1   
H310_14019                                                            33.1       2.1   
H257_00729                                                            31.6       2.1   
SDRG_07086                                                            33.1       2.2   
SDRG_06342                                                            33.1       2.3   
H310_01094                                                            31.6       2.3   
HYAP_09304                                                            33.1       2.4   
PYU1_G007013                                                          33.1       2.4   
SDRG_08236                                                            33.1       2.4   
SPRG_08532                                                            33.1       2.4   
PYAP_17800                                                            33.1       2.4   
H257_01309                                                            33.1       2.5   
CCI11474                                                              32.7       2.5   
SDRG_06288                                                            32.7       2.6   
HYAP_13757                                                            32.3       2.6   
PYIW_21944                                                            33.1       2.6   
SDRG_14070                                                            32.7       2.6   
SPRG_11537                                                            32.7       2.7   
CCI49433                                                              32.7       2.7   
PYVX_19982                                                            32.7       2.7   
SDRG_07310                                                            33.1       2.7   
SPRG_14955                                                            32.7       2.7   
SDRG_05608                                                            31.2       2.8   
PYIW_20221                                                            32.7       2.8   
SPRG_02502                                                            31.2       3.0   
H257_11802                                                            32.7       3.0   
H310_01999                                                            32.7       3.0   
CCI42088                                                              32.7       3.0   
SDRG_14486                                                            32.3       3.0   
H310_12448                                                            32.7       3.1   
PYVX_14527                                                            32.7       3.1   
CCA19097                                                              32.7       3.2   
PYAP_22685                                                            32.7       3.2   
PYU1_G011261                                                          32.7       3.2   
PYAP_16658                                                            32.3       3.5   
PHYSO_529931                                                          32.7       3.6   
SPRG_02753                                                            32.3       3.6   
PYAP_16161                                                            32.3       3.6   
PPTG_18989                                                            32.7       3.6   
PHALS_11367                                                           32.7       3.7   
PHYRA_83071                                                           32.7       3.7   
PHALS_07930                                                           32.3       3.8   
PYVX_14593                                                            32.3       3.8   
PHALS_06568                                                           32.3       3.8   
PYVX_14287                                                            32.3       3.9   
H257_03477                                                            32.3       4.0   
SPRG_00364                                                            32.0       4.1   
PYAR_15792                                                            30.8       4.1   
SDRG_04871                                                            32.3       4.2   
SPRG_08217                                                            32.3       4.3   
PYIW_14463                                                            31.6       4.3   
PYAP_22133                                                            32.3       4.3   
PHYSO_489872                                                          32.3       4.4   
PITG_07652                                                            32.3       4.5   
CCA15513                                                              32.3       4.5   
PYIR_15898                                                            32.3       4.5   
PHYKE_8689                                                            32.3       4.6   
PHYRA_81944                                                           32.3       4.6   
PHYRA_76931                                                           32.3       4.7   
PPTG_19153                                                            32.3       4.7   
H257_06698                                                            32.3       4.8   
PHALS_01227                                                           32.0       4.9   
HYAP_08916                                                            31.6       4.9   
CCI10928                                                              32.0       5.0   
PITG_09930                                                            32.0       5.0   
PITG_18687                                                            32.0       5.1   
PYVX_15906                                                            30.4       5.2   
HYAP_02230                                                            32.0       5.2   
PYIW_23677                                                            30.0       5.2   
PHYCA_539981                                                          32.0       5.3   
CCI42711                                                              32.0       5.3   
PHYSO_315255                                                          32.0       5.4   
H310_09363                                                            32.0       5.5   
PPTG_02150                                                            32.0       5.6   
SDRG_03531                                                            31.6       5.6   
PYAR_24323                                                            32.0       5.7   
HYAP_13689                                                            31.6       5.8   
PHYKE_4911                                                            28.5       5.9   
PHYRA_84786                                                           32.0       5.9   
PYU1_G008119                                                          30.4       6.3   
PITG_13665                                                            30.4       6.3   
PYAP_24440                                                            31.6       6.3   
PHYKE_7347                                                            30.4       6.3   
PHYSO_552247                                                          31.6       6.4   
PPTG_19631                                                            30.4       6.5   
SPRG_06061                                                            31.6       6.5   
PYU1_G010818                                                          30.8       6.5   
H310_07683                                                            31.6       6.5   
PHALS_07062                                                           30.4       6.5   
PHYCA_510506                                                          30.0       6.6   
PHYRA_82888                                                           31.6       6.7   
PHYSO_289146                                                          30.0       6.7   
PHALS_09273                                                           31.6       6.8   
PPTG_06991                                                            31.6       6.8   
PYIW_26522                                                            30.0       6.9   
PHYRA_85100                                                           30.0       6.9   
PHYRA_85097                                                           30.0       6.9   
PITG_16799                                                            31.6       6.9   
PYAR_21162                                                            31.6       7.2   
SDRG_02154                                                            31.6       7.2   
PYIR_15407                                                            30.0       7.2   
HYAP_02360                                                            30.0       7.2   
PPTG_11714                                                            31.6       7.3   
PITG_11578                                                            31.6       7.4   
H257_11443                                                            31.6       7.5   
PYAR_15029                                                            31.6       7.7   
PYIR_22667                                                            31.6       7.7   
SDRG_00756                                                            31.6       8.0   
PYAP_23744                                                            30.0       8.2   
PHYSO_478442                                                          31.2       8.5   
PYAP_17844                                                            31.2       8.8   
PHYSO_249387                                                          30.4       8.9   
PYU1_G009249                                                          31.2       9.0   
PITG_02106                                                            31.2       9.0   
PHYCA_504798                                                          31.2       9.2   
PHYSO_561742                                                          31.2       9.4   
PHALS_12503                                                           30.8       9.4   
CCI45857                                                              31.2       9.4   
PHALS_03335                                                           31.2       9.5   
PYAR_14615                                                            31.2       9.5   
H310_04667                                                            31.2       9.6   
H257_05175                                                            31.2       9.7   
CCA23572                                                              31.2       9.8   
H257_10151                                                            31.2       9.8   
PYVX_16095                                                            31.2       9.9   
PHYRA_73431                                                           30.8       9.9   
PYAP_19753                                                            31.2       9.9   

>PYVX_18171
Length=294

 Score = 575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/294 (100%), Positives = 294/294 (100%), Gaps = 0/294 (0%)

Query  1    MSGAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE  60
            MSGAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE
Sbjct  1    MSGAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE  60

Query  61   FYLSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH  120
            FYLSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH
Sbjct  61   FYLSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH  120

Query  121  NALESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGA  180
            NALESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGA
Sbjct  121  NALESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGA  180

Query  181  KLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPSP  240
            KLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPSP
Sbjct  181  KLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPSP  240

Query  241  TKTLSNAGDGRAALEQLSTQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            TKTLSNAGDGRAALEQLSTQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF
Sbjct  241  TKTLSNAGDGRAALEQLSTQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYU1_G001735
Length=342

 Score = 317 bits (813),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 224/338 (66%), Gaps = 56/338 (17%)

Query  4    AGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFY  62
            +G  V +PTSCEGYVTKRGHFRKSWRVRYLV +GADL+V+YFES+  A   G   KG FY
Sbjct  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73

Query  63   LSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNA  122
            +SS++KH Y  G MG    +EKPFGFK+VGHAP KGY ELDIFVE+L D+ KWLEV  NA
Sbjct  74   VSSVEKHEYWIGVMGG---KEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130

Query  123  LESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKL  182
            L++A  ++RK   D     +TKS+FGF  + SPQ Q+K ++ +K+ELL++ALRE+EGAKL
Sbjct  131  LDAAKKLTRKGMTD-----STKSMFGFGASISPQLQVKKLAATKEELLREALREIEGAKL  185

Query  183  IGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRR------  236
            IGREA  E+V QGEKLD +E +LG +E DLD+ DKLLR LKSPVLH+ + D R+      
Sbjct  186  IGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKGAPT  245

Query  237  ---------------PPSPTK------------TLSNAGDGRAALEQL------------  257
                           P S T+            TL++      AL +L            
Sbjct  246  AATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLMNAEAA  305

Query  258  -STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
             ST+QIARIEERLT+VNDRVQ QTK+AT+ + + GN+F
Sbjct  306  RSTEQIARIEERLTSVNDRVQHQTKKATATM-KAGNLF  342

>PYIR_13451
Length=359

 Score = 305 bits (780),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 173/348 (50%), Positives = 225/348 (65%), Gaps = 63/348 (18%)

Query  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGA-------  55
            GAG +  +PTSCEGYVTKRGHFRKSWRVRYLV +GA+L+VAY+ES+ A +  +       
Sbjct  19   GAG-DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDASKGSSSSGGTGV  77

Query  56   -ASKGEFYLSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTK  114
               KG FY+SS++KH Y  G MG    +EKPFGFK+VGHAPKKGY ELDIFVE+L DL K
Sbjct  78   PVPKGSFYVSSVEKHEYWVGVMGG---REKPFGFKLVGHAPKKGYIELDIFVESLGDLNK  134

Query  115  WLEVAHNALESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDAL  174
            W+EV  NAL++A   SR   G    ++TTK++FGFS + SPQ Q+K ++ +K++LL+DAL
Sbjct  135  WVEVVQNALDAAKKRSR--TGGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDAL  192

Query  175  RELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL  234
            RE+EGAKLIGREA  E+VVQGEKLD +E++LG +E DLD+ DKLLR +K P+LHL + D 
Sbjct  193  REIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDE  252

Query  235  RRPPSPTKTLSNAGDGRAA----------------------------LEQL---------  257
            R   SP    ++    RA+                            LE+L         
Sbjct  253  RVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSDLEKLALALGELEE  312

Query  258  -----------STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
                       ST+QIAR+E+RLT VNDRVQ QTK+A + + + GN+F
Sbjct  313  QANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM-KAGNLF  359

>PHYSO_471523
Length=348

 Score = 303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 214/334 (64%), Gaps = 53/334 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65
            RPTSCEGYVTKRGHFRKSWRVR+LVLDG++L V+Y+ES+ A        +A KG FYLSS
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA    EKPFGFKMVGHAP+KGY ELD+FVETL D  KWLEVA NAL +
Sbjct  79   IEPHEYVVGVMGAA---EKPFGFKMVGHAPRKGYVELDVFVETLNDRNKWLEVARNALSA  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S   K+LFGF+ +       SPQ+Q++ ++ S+DELL DALR++E 
Sbjct  136  KRQLTRQAI-DQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTKSRDELLSDALRDIEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR----  235
            AK +GREAC E+V QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D R    
Sbjct  195  AKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKAS  254

Query  236  --------------RPPSPTKTLSNAGD-GRAALEQLS--------------------TQ  260
                          RPP     + +  D G + LE+L+                    TQ
Sbjct  255  ASKASSPQRSQQSGRPPRLPPAMDSINDAGVSDLERLAQALGELEVQAELLNGEAGRGTQ  314

Query  261  QIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            QI RIE +L+ V  RV++QTKQA++ +  G  +F
Sbjct  315  QIERIEHQLSNVTARVEKQTKQASAALDSGPRLF  348

>PPTG_17127
Length=351

 Score = 302 bits (773),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 175/339 (52%), Positives = 215/339 (63%), Gaps = 60/339 (18%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65
            RPTSCEGYVTKRGHFRKSWRVR+LV+DG++L+V+Y+ES+ A        +A KG FYLSS
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPTGEPSAPKGSFYLSS  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA    +KPFGFKMVGHAPKKGY ELD+FV+TLAD  KWLEVA NAL  
Sbjct  79   IEPHEYVVGVMGAA---DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALSV  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S   K+LFGFS         SPQ+Q++ ++ SKDELL +ALRELE 
Sbjct  136  KRQLTRQAI-DQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAKSKDELLSEALRELEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR----  235
            AKL+GREAC E+V+QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D R    
Sbjct  195  AKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKST  254

Query  236  --------------------RPPSPTKTLSNAGDGRAALEQL------------------  257
                                R P    T S+AG   + LE+L                  
Sbjct  255  GGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGG--SDLERLAQALGELEVQAEMLNGEA  312

Query  258  --STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
              S+QQI RIE  LT V  RV++QTKQA++ +  G  +F
Sbjct  313  SHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PITG_18456
Length=351

 Score = 301 bits (771),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/338 (53%), Positives = 218/338 (64%), Gaps = 58/338 (17%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ----NGAASKGEFYLSS  65
            RPTSCEGYVTKRGHFRKSWRVR+LV+DG++L+V+Y+ES+ A        +A KG FYLSS
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAACHPPIGQPSAPKGIFYLSS  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA    +KPFGFKMVGHAPKKGY ELD+FV+TLAD  KWLEVA NAL +
Sbjct  79   IEPHEYVVGVMGAA---DKPFGFKMVGHAPKKGYVELDVFVDTLADRNKWLEVARNALGA  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTT------TSPQQQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S   K+LFGFS +       SPQ+Q++ +S SKDELL  ALRELE 
Sbjct  136  KRQLTRQAI-DQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSKSKDELLSQALRELEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRP--  237
            AKL+GREAC E+VVQGEKLD IE +L  I+ DLD+GDKLLRRLKSP LHL + D  RP  
Sbjct  195  AKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHLFSDD-SRPKS  253

Query  238  -----------------PSPTK---TLSNAGD-GRAALEQL-------------------  257
                              SPT+    L  + D G + LE+L                   
Sbjct  254  TGSSKGSSPQRSHQSGGSSPTRLPPALEISSDAGVSDLERLAQALGELEVQAELLNGEAG  313

Query  258  -STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
             S+QQI RIE  LT V  RV++QTKQA++ +  G  +F
Sbjct  314  RSSQQIERIEHHLTNVTTRVEKQTKQASATLSAGPRLF  351

>PHYRA_81100
Length=349

 Score = 298 bits (762),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/337 (50%), Positives = 219/337 (65%), Gaps = 58/337 (17%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAA----SKGEFYLSS  65
            RPTSCEGYVTKRGHFRKSWRVR+LVL+G++L+++Y+ES+ A    AA     KG FYLSS
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAACHPPAAEPSAPKGSFYLSS  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA G   KPFGFKM+GHAPKKGY ELD+FVET  D  KWLEVA NAL +
Sbjct  79   IEPHEYVVGVMGAAG---KPFGFKMIGHAPKKGYVELDVFVETQGDRNKWLEVARNALSA  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S+  K+LFGF  + SPQ      +Q++ ++ +KDELL  ALR++E 
Sbjct  136  KRQLTRQAI-DQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQNKDELLSGALRDIEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR----  235
            AKL+GREAC E+V+QGEKLD IE +LG I+ DLD+GDKLLRRLKSP LHL + D R    
Sbjct  195  AKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKSPTLHLFSDDSRPKST  254

Query  236  ------------------RPPSPTKTLSNAGDGRAALEQL--------------------  257
                              R P   +T+++A  G + LE+L                    
Sbjct  255  ASKGHSPQRSQQSGGSPSRLPPAMETINDA--GVSDLERLAQALGELEVQAEILNGEAGR  312

Query  258  STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            STQQI R+E +L+ V  RV++QTKQA++ ++ G  +F
Sbjct  313  STQQIERVEHQLSNVTARVEKQTKQASATLRAGPKLF  349

>PHYCA_556162
Length=351

 Score = 297 bits (761),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 217/337 (64%), Gaps = 56/337 (17%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ--NGAAS--KGEFYLSS  65
            RPTSCEGYVTKRGHFRKSWRVR+LVLDG++L+V Y+ES+ A     G AS  KG FYLSS
Sbjct  19   RPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAACHPTTGEASPPKGSFYLSS  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA G   KPFGFKMVGHAPKKGY ELD+FVET+ D  KWLEVA NAL +
Sbjct  79   IEPHEYVVGVMGAAG---KPFGFKMVGHAPKKGYVELDVFVETVGDRNKWLEVARNALSA  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S   K+LFGFS + SPQ      +Q++ ++ +KD+LL DALR++E 
Sbjct  136  KRQLTRQAI-DQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTKNKDDLLSDALRDIEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR----  235
            AK IGREAC E+V+QGEKLD IE +L  I+ DLD+GDKLLRRLKSP LH+ + D R    
Sbjct  195  AKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKSPTLHMFSNDSRPKST  254

Query  236  ---RPPSPTKTLSNAGD---------------GRAALEQL--------------------  257
               +  SP ++  + G                G + LE+L                    
Sbjct  255  SSSKANSPQRSQQSGGSSPTRLAQAAESRIDPGASDLERLAQALGELELQAELLNDEAGH  314

Query  258  STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            STQQI  IE  L+TV  RV++QTKQA++ ++ G  +F
Sbjct  315  STQQIQTIEHHLSTVTGRVEKQTKQASATLRAGPRLF  351

>PYAP_17762
Length=348

 Score = 287 bits (734),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 205/324 (63%), Gaps = 52/324 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFYLSSIDK  68
            +PTSCEGYVTKRGHFRKSWRVR+LVL+GADL V+Y++SK  A   GA  KG FYLSS++K
Sbjct  28   KPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLVSYYDSKEVARTAGAVPKGSFYLSSVEK  87

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
            H Y  G +GA   QEKPFGFKMVGHAP+KGY ELDIFVETL DL KWLEV  NAL++A  
Sbjct  88   HEYYVGVLGA---QEKPFGFKMVGHAPRKGYVELDIFVETLGDLNKWLEVCQNALDAAKK  144

Query  129  MSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188
            ++R    +   +   KSLFGFS  TSPQQQ+K M+ +K+++LK A+ E+E AKLIGR AC
Sbjct  145  LTRTGQPE---ALAPKSLFGFSPATSPQQQMKKMTATKEQMLKQAIEEIESAKLIGRSAC  201

Query  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR---------RPPS  239
             E+ +QGE+LD I   L  +E DLDY DKLLR +K+P LH+ + D R         +P S
Sbjct  202  QEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGLHMFSSDARDRAKNTGRTKPSS  261

Query  240  PTKTLSNAGDGRAA--------------------------LEQLS----------TQQIA  263
                 + + + RAA                          LEQ +          T Q+ 
Sbjct  262  RDTPSAVSEETRAAILSDSHDAVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVE  321

Query  264  RIEERLTTVNDRVQRQTKQATSGI  287
            R+ E+L  VN+RV+ QT++A + I
Sbjct  322  RVGEQLAHVNERVKAQTRKANASI  345

>PHALS_06478
Length=345

 Score = 281 bits (720),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 214/331 (65%), Gaps = 50/331 (15%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ--NGAAS--KGEFYLSS  65
            +PTSCEGYVTKRGHFRKSWRVR+LVLDG++L+VAY+ES+ A    NG ++  KG FYLS+
Sbjct  19   QPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAACHPPNGESTMPKGSFYLSN  78

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALES  125
            I+ H YV G MGA    ++PFGFKMVGHAP+KG+ ELD+FVET  D  KWLEVA NAL++
Sbjct  79   IEPHEYVIGVMGAA---DRPFGFKMVGHAPRKGFVELDVFVETQTDRNKWLEVACNALKA  135

Query  126  AAAMSRKAAGDGGGSATTKSLFGFSTTTS------PQQQLKAMSVSKDELLKDALRELEG  179
               ++R+A  D   S   K LFGFS  +S      PQ+Q++ ++ SK+ LL +ALRE+E 
Sbjct  136  KRQLTRQAI-DQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLATSKEGLLLEALREIEA  194

Query  180  AKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-RPP  238
            AKL+GREAC E+V QGEKLD IE +L  I+ DLD+GDKLL RLKSP LH  + D R + P
Sbjct  195  AKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKSPTLHFFSDDTRPKVP  254

Query  239  -----------SPTKTLSNAGDGRAA----LEQL--------------------STQQIA  263
                       SP++ +      R A    L++L                    S+QQI 
Sbjct  255  LGDHPHHSGSTSPSRLIPAIEITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIE  314

Query  264  RIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            RIE  L+ V +RV++QTKQA + +  G  +F
Sbjct  315  RIEHHLSHVTERVEKQTKQAVATLSAGPRLF  345

>PYIW_19971
Length=348

 Score = 274 bits (701),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 168/344 (49%), Positives = 218/344 (63%), Gaps = 63/344 (18%)

Query  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFY  62
            G+G +  + TSCEGYVTKRGHFRKSWRVRYLV +GADL+ A     +     A  KG F+
Sbjct  16   GSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGGASP----ATPKGSFF  71

Query  63   LSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNA  122
            +SS++KH Y  G MG    +EKPFGFK+VGHAPKKGY ELDIFVETL DL KW+EV  NA
Sbjct  72   VSSVEKHEYWVGVMGG---REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNA  128

Query  123  LESAAAMSRK-AAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAK  181
            L++A   +R   A D   S+TTK++FGFS T SPQ Q+K ++ +K+ELL+DALRE+EGAK
Sbjct  129  LDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALREIEGAK  185

Query  182  LIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPSP-  240
            LIGREA +++  QG KL+ IE +LG +ESDLD+G KLL  +K P+LHL + D R  P+  
Sbjct  186  LIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNAH  245

Query  241  -TKTLSNAGDGRAA-----------------------------LEQL-------------  257
             + + S+  DG +                              LE+L             
Sbjct  246  HSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELEEQATA  305

Query  258  -------STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
                   ST+QIAR+E+RLT VNDRVQ QTK+AT+ + + GN+F
Sbjct  306  MNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATM-KAGNLF  348

>PYAR_13570
Length=322

 Score = 248 bits (633),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/320 (48%), Positives = 197/320 (62%), Gaps = 65/320 (20%)

Query  27   SWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKP  85
            SWRVRYLVL+GADL V+YF+SK  A   GA+ KG FYLSS++KH YV G +GA   Q+KP
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGA---QKKP  64

Query  86   FGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRKAAGDGGGSATTKS  145
            FGFKMVGHAP+KGY ELDIFVE+  DL KWLEV  +AL +A  ++R    D   +A+TKS
Sbjct  65   FGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSD---AASTKS  121

Query  146  LFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREACTEMVVQG----------  195
            LFGFS  TSPQ+Q++ +S SK+ELLK A+ E+E AKL+GREAC E+VVQG          
Sbjct  122  LFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSG  181

Query  196  -----EKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-----RPP-SPTKT-  243
                 EKLD IE+ L  +++DLDYGDKLL  LKSP+L+L + D R      P  SP K+ 
Sbjct  182  FSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKSK  241

Query  244  ---LSNAGDGRA---ALEQLS------------------------------TQQIARIEE  267
               LS+A    A    +E+ S                              T Q+ R+ +
Sbjct  242  QSALSSAARADALGQGVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGD  301

Query  268  RLTTVNDRVQRQTKQATSGI  287
             L  +N+RVQ QTK+A S +
Sbjct  302  ALAHINERVQNQTKKADSAV  321

>PHYKE_8393
Length=326

 Score = 246 bits (627),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 194/333 (58%), Gaps = 73/333 (22%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            RPTSCEGYVTKRGHF                               A KG FYLS+I  H
Sbjct  19   RPTSCEGYVTKRGHF---------------------PCHPPHGETPAHKGSFYLSNIAPH  57

Query  70   ayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAM  129
             YV G MGA    +KPFGFKMVGHAP+KGY ELD+FVETL+D  KWLEVA NAL +   +
Sbjct  58   EYVVGVMGAA---DKPFGFKMVGHAPRKGYVELDVFVETLSDRNKWLEVARNALGAKRQI  114

Query  130  SRKAAGDGGGSATTKSLFGFSTTTSPQ------QQLKAMSVSKDELLKDALRELEGAKLI  183
             R+A  D   S T K +FGF  + SPQ      +Q++A++ +K+ELL +ALRELE AK++
Sbjct  115  MRQAI-DQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKEELLAEALRELEAAKMV  173

Query  184  GREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLR-------R  236
            GREAC E+VVQGEKLD +E +L  I+ DLD+GDKLLRRLK+P LHL + D R        
Sbjct  174  GREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTLHLFSDDTRPKSHANSN  233

Query  237  PPSPTKTLSNAG--------------DGRAA-LEQL--------------------STQQ  261
              SP +T  +AG              D  A+ LE+L                    STQQ
Sbjct  234  ESSPQRTHQSAGSNPIHLPFSMGSANDADASDLERLAHALGELELQAELLNGEAGRSTQQ  293

Query  262  IARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294
            IARIE++L+ V  RV++QTKQA++ +  G  +F
Sbjct  294  IARIEQQLSNVTARVEKQTKQASATLSAGPRLF  326

>CCA18899
Length=343

 Score = 231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 196/334 (59%), Gaps = 55/334 (16%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQN-GAASKGEFYLSSIDKH  69
            PTSCEGYVTKRGHFRKSWRVRYLV+ G +++V+Y+ESK + ++  A  KG F L S +KH
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQSAEKH  74

Query  70   ayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAM  129
             Y    M     +EKPFGFKMVGHAPK+GY ELD+FV++ +D+ +WL+V +N L+++  M
Sbjct  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134

Query  130  SRKAAGDGGGSATTKSLFGFSTT-TSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188
            +R+A        TTKS+ GFS   T+ +QQ++ +   K + + +AL+++E AK  G  AC
Sbjct  135  AREAF--MAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMAKSAGNAAC  192

Query  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSP-----------------------  225
             E+V QGE+L  +E NL  I++DL++ +KL++ ++ P                       
Sbjct  193  DEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATISKSSSIH  252

Query  226  -------VLH---------LLARDLRRPPSPTKTLSNAGDGRAALEQL-------STQQI  262
                   +LH          LA ++R P +  + L+ A        QL       S +QI
Sbjct  253  RSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQI  312

Query  263  ARIEERLTTVNDRVQRQTKQA--TSGIQRGGNIF  294
            ARIE +L+ +NDR+Q QT Q   +SG Q   N+F
Sbjct  313  ARIEGQLSGINDRIQAQTSQVITSSGKQ---NLF  343

>SPRG_06336
Length=335

 Score = 177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 171/310 (55%), Gaps = 51/310 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ-NGAASKGEFYLSSIDK  68
            + TSCEGYVTKRGH  KSWR RY+VLDG  L+V+Y++SKT ++ +    KG F L+ I+K
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL----E  124
            H Y   G G      KP+GFK+VGHAP  GY E  ++VET  D T+WLEVAHNAL     
Sbjct  69   HDYSDEGGGV-----KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGKNVT  123

Query  125  SAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIG  184
              A++ ++A+   G  A +    GF   TS   QL+ ++ +K+ELL+ A+  LE A+ +G
Sbjct  124  PQASVDQRASALLGHRAPS----GF--LTSAPVQLRNVNKTKEELLRKAIVTLEHARTVG  177

Query  185  REACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL----------  234
                +EM    E LD  EAN+  +E++LD GD +++++ SP  +  +             
Sbjct  178  DNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPK  237

Query  235  ------RRPPSPTKT----------------LSNAGDGRAALEQLSTQQIARIEERLTTV  272
                   +P +P  +                 ++AGD    L+QLS + +A +E    T+
Sbjct  238  SKSARSHQPQTPMNSPTHKKSSGPASKAGGATTDAGDDE--LDQLS-KILASLEVHANTI  294

Query  273  NDRVQRQTKQ  282
            +  V+R T+Q
Sbjct  295  STEVERTTEQ  304

>SDRG_01781
Length=335

 Score = 177 bits (450),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 113/306 (37%), Positives = 166/306 (54%), Gaps = 43/306 (14%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ-NGAASKGEFYLSSIDK  68
            + TSCEGYVTKRGH  KSWR RY+VLDG  L+V+YF+SKT ++ +    KG F L+ I+K
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
            H Y   G G      KP+GFK+VGHAP  GY E  ++VET  D T+WLEVAHNAL     
Sbjct  69   HDYSDEGGGV-----KPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKN  121

Query  129  MSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188
            ++ +A+ D   +A           TS   QL+ ++ +K+ELL+ A+  LE A+ +G    
Sbjct  122  VAPQASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181

Query  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL--------------  234
            +EM    E LD  EAN+  + ++LD GD +++++ SP  +  +                 
Sbjct  182  SEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSA  241

Query  235  --------------RRPPSPTK----TLSNAGDGRAALEQLSTQQIARIEERLTTVNDRV  276
                          ++P  PT       ++AGD    L+QLS + +A +E    T++  V
Sbjct  242  RSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDE--LDQLS-KILASLEVHANTISTEV  298

Query  277  QRQTKQ  282
            +R T+Q
Sbjct  299  ERTTEQ  304

>CCI45123
Length=301

 Score = 171 bits (433),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 165/298 (55%), Gaps = 53/298 (18%)

Query  40   LRVAYFESKTAFQN-GAASKGEFYLSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKG  98
            ++V+Y+ESK +++N  A  KG F L +++KH Y    M     +E+PFGFKMVGHAPK+G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  99   YTELDIFVETLADLTKWLEVAHNALESAAAMSRKAAGDGGGSATTKSLFGFSTT-TSPQQ  157
            Y ELD+FV++L+++ +WL+V +N L++   M+R+A        TTK + GFS   T+ +Q
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAF--MAEMDTTKGVLGFSFAGTTSKQ  118

Query  158  QLKAMSVSKDELLKDALRELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDK  217
            Q+K +   K + + +AL+++E AK  G  AC E+V QGE+L  +E NL  IESDL++ +K
Sbjct  119  QVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEK  178

Query  218  LLRRLKSP-------------------------------VLHL---------LARDLRRP  237
            L++ ++ P                               +LH+         +A ++  P
Sbjct  179  LIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVP  238

Query  238  PSPTKTLSNAGDGRAALEQL-------STQQIARIEERLTTVNDRVQRQTKQ--ATSG  286
             +  + L+ A        QL       S  QI RIE +L+ +NDR+Q QT Q  A+SG
Sbjct  239  TNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSG  296

>H310_09223
Length=333

 Score = 156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 153/323 (47%), Gaps = 58/323 (18%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            +  TSCEGYVTKRGH  K+W+ RY+VL G  L VAY++SK  +++    KG F LS  +K
Sbjct  8    IHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECEK  67

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
                  G        KPFGFK +GH P +GY E  +FVET  D TKWL VAHNAL     
Sbjct  68   QDLSDEGGSV-----KPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTY  122

Query  129  MSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKLIGREAC  188
            +   +    GG+   +S        S + Q+K +  +  ELL+ A+ + + A  IG    
Sbjct  123  IPSPSMESHGGAGHKESA---GLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATV  179

Query  189  TEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVL----HLLARDLRR--------  236
             EM  Q E L+  E  +  +   +D  + L + +K P+L    H+ +R   +        
Sbjct  180  DEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASS  239

Query  237  -----------------------PPSP------------TKTLSNAG---DGRAALEQLS  258
                                   PP P            +K L+  G   D  + +   +
Sbjct  240  KKRGGGKSTRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDITTRT  299

Query  259  TQQIARIEERLTTVNDRVQRQTK  281
            T+Q+ RI++++T+V++RV ++ K
Sbjct  300  TEQVDRIDQKVTSVDERVTKEAK  322

>H257_06294
Length=358

 Score = 149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 103/347 (30%), Positives = 156/347 (45%), Gaps = 81/347 (23%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            +  TSCEGYVTKRGH  KSW+ RY+VL+G  L V+Y++SK  + +    KG F LS  +K
Sbjct  8    IHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECEK  67

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL----E  124
                  G        KPFGFK +GH P +GY E  ++VE+  D TKWL VAHNAL     
Sbjct  68   QDLSDEGASV-----KPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGKNSS  122

Query  125  SAAAMSRKAAGDGGG---------SATTKSLFGFST---------TTSPQQQLKAMSVSK  166
               +MS++     G          +   + +   +T           S + Q+K +  + 
Sbjct  123  PQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTS  182

Query  167  DELLKDALRELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPV  226
             ELL+ A+ + + A  IG     EMV Q + L+  E  +  +   +D+ + L R LK P+
Sbjct  183  QELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPI  242

Query  227  LHLLARDLRR--------------------------------PPSPTKTLSNAGDGRAAL  254
            L+ L     R                                PP      +   D +  L
Sbjct  243  LYKLTHLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQ--L  300

Query  255  EQLS--------------------TQQIARIEERLTTVNDRVQRQTK  281
            +QLS                    T+Q+ RI++++T+V+DRV+++ K
Sbjct  301  DQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKEAK  347

>CCI45127
Length=202

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 95/195 (49%), Gaps = 50/195 (26%)

Query  142  TTKSLFGFSTT-TSPQQQLKAMSVSKDELLKDALRELEGAKLIGREACTEMVVQGEKLDG  200
            TTK + GFS   T+ +QQ+K +   K + + +AL+++E AK  G  AC E+V QGE+L  
Sbjct  3    TTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGK  62

Query  201  IEANLGGIESDLDYGDKLLRRLKSP-------------------------------VLHL  229
            +E NL  IESDL++ +KL++ ++ P                               +LH+
Sbjct  63   VEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQTGILHM  122

Query  230  ---------LARDLRRPPSPTKTLSNAGDGRAALEQL-------STQQIARIEERLTTVN  273
                     +A ++  P +  + L+ A        QL       S  QI RIE +L+ +N
Sbjct  123  RKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGIN  182

Query  274  DRVQRQTKQ--ATSG  286
            DR+Q QT Q  A+SG
Sbjct  183  DRIQSQTTQVVASSG  197

>SPRG_06058
Length=1258

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query  6    VNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            ++  RP  CEGY+TKRGH   S+R+RY V+ G+   V Y+  +TA++ GA++  E  + S
Sbjct  39   LHCARPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRTGASALAEIEVKS  96

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLE  117
              +             +     FK   +      + + +  E +ADL KW+E
Sbjct  97   GGR----------WDGESTGLFFKTATN------STMFVCAENVADLQKWIE  132

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADL  40
            P +C G++TK+GH RKSW+ RY VL G  L
Sbjct  146  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL  175

>H310_00231
Length=1495

 Score = 56.6 bits (135),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 2/48 (4%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEF  61
            CEGY+TKRGH   S+R+RY VL GA ++  YF  +TA+++GA++  E 
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK--YFADETAYRSGASALAEM  296

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 2/37 (5%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            V+P +C G++TK+GH RKSW+ RY VL G  L  AY+
Sbjct  347  VQPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYY  381

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            GY+TKRGH   +W+ R+ VL  A  R++Y+
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>SDRG_12762
Length=1392

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 54/110 (49%), Gaps = 18/110 (16%)

Query  8    VVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            V  P  CEGY+TKRGH   S+R+RY V+ G+   V Y+  +TA++ GA++  E  + S  
Sbjct  252  VPDPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRTGASALAEIEVKSGG  309

Query  68   KHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLE  117
            +             +     FK   +      + + +  E +ADL KW+E
Sbjct  310  R----------WDGESTGLFFKTATN------STMFVCAENVADLQKWIE  343

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            P +C G++TK+GH RKSW+ RY VL G  L  +YF
Sbjct  357  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYF  389

 Score = 31.2 bits (69),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            GY+TKRGH   +W+ R+  L     R++Y+
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQG-RLSYY  192

>H257_06722
Length=1482

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 2/52 (4%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            CEGY+TKRGH   S+R+RY VL G+ ++  Y+  +TA+++GA++  E  + S
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETAYRSGASALAEMEVRS  300

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 50/121 (41%), Gaps = 17/121 (14%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            ++P +C G++TK+GH RKSW+ RY VL G  L  AY+   T F       G        K
Sbjct  347  MQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYY---TDFDASNLRHG--------K  393

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
                           +P GF  + +     Y    +F +   D  KWL       ESA +
Sbjct  394  PLGEVTVREVSAWDGEPSGFMFITNDSVPYY----VFADNDRDQAKWLAALRKLFESATS  449

Query  129  M  129
            M
Sbjct  450  M  450

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            GY+TKRGH   +W+ R+ VL  A  R++Y+
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>PYAP_16997
Length=1018

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 5/57 (9%)

Query  4    AGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE  60
            A  N+  P +C GY+TK+GH RKSW+ RY VL G    + YF   T F    ++KG+
Sbjct  392  ATANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGNS--ITYF---TDFDTANSNKGK  443

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 2/33 (6%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            +CEG++TKRGH   +W++RY VL G  L   YF
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YF  236

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            +CEG++T+RGH   S R  Y VL+G  LR  ++  + A+++  ++  +  + S+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR--HYADQQAYRDNQSAIADVEVRSV  352

>PPTG_18898
Length=1559

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (45%), Gaps = 21/116 (18%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASK--GEFYLS  64
            +V  P SC GY+TK+GH RKSW+ RY +L G    ++Y+ S     N A  K   E  + 
Sbjct  401  SVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYY-SDYDMANNAKGKPLAEVLVE  457

Query  65   SIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH  120
             + K               +PFGF  + +     Y    ++ +   + TKW+   H
Sbjct  458  DVQKWDG------------EPFGFMFMTNEQVPYY----VYADNDRERTKWMNALH  497

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+G  LR  ++  + A+++  ++  E  + S+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQSAMAEVEIRSV  358

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLEYYSSEEKS  248

>PITG_20562
Length=1559

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (45%), Gaps = 21/116 (18%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASK--GEFYLS  64
            +V  P SC GY+TK+GH RKSW+ RY +L G    ++Y+ S     N A  K   E  + 
Sbjct  402  SVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYY-SDYDMANNAKGKPLAEVLVE  458

Query  65   SIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH  120
             + K               +PFGF  + +     Y    ++ +   + TKW+   H
Sbjct  459  DVQKWDG------------EPFGFMFMTNEQVPYY----VYADNDRERTKWMNALH  498

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+G  LR  ++  + A+++  ++  E  + S+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQSAMAEVEIRSV  359

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLEYYSSEEKS  249

>PYAR_23286
Length=607

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 21/120 (18%)

Query  4    AGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
            A  N+  P +C GY+TK+GH RKSW+ RY VL G+   V+Y+   T +    + KG    
Sbjct  379  ATANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYY---TDYDTANSPKG----  429

Query  64   SSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL  123
                K               +PFGF  +       Y    ++ +   + TKW+    NAL
Sbjct  430  ----KPLAEVVIEDVQRWDGEPFGFMFMTSEQIPYY----VYADNERERTKWM----NAL  477

 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            CEG++TKRGH   +W++RY VL G  L   YF
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YF  223

 Score = 39.3 bits (90),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            +CEGY+T+RGH   S R  Y VL+G  LR  ++  + A+++  ++  +  + S+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR--HYADQQAYRDNQSAIADVDIRSV  339

>CCA18875
Length=1514

 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)

Query  6    VNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDG  37
             NVV P +C GY+TK+GH RKSW+ RY +L G
Sbjct  410  TNVVEPVTCAGYLTKQGHKRKSWKKRYFILRG  441

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            +CEGY+T+RGH   S RV Y VL G  LR  ++  + A+++  ++  E  + SI
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR--HYADQQAYRDNDSAMAEVEVRSI  367

 Score = 38.9 bits (89),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            EGY+TKRGH   +W+ R+ VL G  L     E KT
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLEYYSSEEKT  257

>CCI41225
Length=981

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G   R++Y+ESK   Q  A  KG   ++S+
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGN--RLSYYESKVDAQQRAHLKGRVKVASV  189

>SDRG_12763
Length=1317

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 26/34 (76%), Gaps = 0/34 (0%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADL  40
            + ++P SC GY+TK+GH RKSW+ RY VL GA L
Sbjct  217  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL  250

 Score = 36.2 bits (82),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 16/22 (73%), Gaps = 0/22 (0%)

Query  14  CEGYVTKRGHFRKSWRVRYLVL  35
           C GY+TKRGH   +W+ R+ VL
Sbjct  10  CAGYLTKRGHVVTNWKTRFFVL  31

>PHYRA_84916
Length=1541

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 53/128 (41%), Gaps = 19/128 (15%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            NV  P SC GY+TK+GH RKSW+ RY +L G  +   Y +   A         E  +  +
Sbjct  398  NVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNTISY-YSDYDMANNTKGKPLAEVLVEDV  456

Query  67   DKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAH--NALE  124
             K               +PFGF  + +     Y    ++ +   +  KW+   +  N +E
Sbjct  457  QKWDG------------EPFGFMFMTNEQVPYY----VYADNDRERNKWMNALNKLNTVE  500

Query  125  SAAAMSRK  132
                + +K
Sbjct  501  EEPEIEKK  508

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 34/54 (63%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+G  LR  ++  + A+++  ++  E  + S+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQSAMAEVEIRSV  355

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS  245

>SPRG_06059
Length=1312

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 2/39 (5%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            + ++P SC GY+TK+GH RKSW+ RY VL G  L  AY+
Sbjct  219  SAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYY  255

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  14  CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
           C GY+TKRGH   +W+ R+ VL    +   Y +   A
Sbjct  12  CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMA  48

>PYVX_20438
Length=1346

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 5/54 (9%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE  60
            N+  P +C GY+TK+GH RKSW+ RY +L G    ++YF     F+   ++KG+
Sbjct  312  NLPEPVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFAD---FEMANSAKGK  360

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL G  LR  ++  + A++   ++  E  + S+
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLR--HYADQQAYRENQSAMAEVEVRSV  269

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 25/45 (56%), Gaps = 6/45 (13%)

Query  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            GA V +     CEGY+TKRGH   +W+ RY  L G  L   YF S
Sbjct  116  GAPVEI----KCEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFAS  154

>CCA16487
Length=975

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G   R++Y+E+K   Q  A  KG   ++S+
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGN--RLSYYENKVDAQQRAHLKGRVKVASV  187

>PYU1_G001063
Length=783

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W+ R+  L+G +L  +Y+ESK   +N +  KG   ++S+
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKVDARNRSHLKGRVQVASV  196

>CCI44752
Length=1526

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDG  37
            N V P +C GY+TK+GH RKSW+ RY +L G
Sbjct  411  NTVEPVACAGYLTKQGHKRKSWKKRYFILRG  441

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            +CEGY+T+RGH   S RV Y VL G  LR  ++  + A+++  ++  E  + SI
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR--HYADQQAYRDNDSAMAEVEIRSI  367

 Score = 38.9 bits (89),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            EGY+TKRGH   +W+ R+ VL G  L     E KT
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLEYYSSEEKT  257

>PYVX_13574
Length=950

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+ESK   +N +  KG   ++S+
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYESKVDARNRSHLKGRVNVASV  208

>PHYKE_2479
Length=171

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  76   EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASV  125

>PHYKE_1990
Length=1499

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  6    VNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
             N+  P +C GY+TK+GH RKSW+ RY +L G+   ++Y+
Sbjct  398  TNIPEPVACAGYLTKQGHKRKSWKKRYFILRGS--TISYY  435

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+GA LR  ++  + A+++  ++  E  + S+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR--HYADQQAYRDNQSAMAEVEIRSV  356

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS  246

>PYU1_G006347
Length=1095

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 4/61 (7%)

Query  8    VVRP--TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            VV P   SCEGY+T+RGH   S R+ Y VL+GA LR  ++  ++A+++  ++  E  + S
Sbjct  287  VVEPEEVSCEGYLTRRGHLVPSQRMAYYVLNGASLR--HYADQSAYRDNQSAIAEVEVRS  344

Query  66   I  66
            +
Sbjct  345  V  345

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDG  37
            P SC GY+TK+GH RKSW+ RY +L G
Sbjct  392  PVSCAGYLTKQGHKRKSWKKRYFILRG  418

 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            CEG++TKRGH   +W+ RY VL G  L   YF
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YF  229

>PYIR_15309
Length=937

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W+ R+  L+G +L  +Y+ESK   +N +  KG   ++S+
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRSHLKGRVNVASV  197

>PHALS_06533
Length=930

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVEARNRSHLKGRVNVASV  160

>PYIW_17381
Length=952

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            P SC GY+TK+GH RKSW+ RY +L G    +AYF
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYF  435

 Score = 44.3 bits (103),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 36/61 (59%), Gaps = 4/61 (7%)

Query  8    VVRP--TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            VV P    CEGY+T+RGH   S R+ Y VL+G  LR  ++  ++A++   ++  E  + S
Sbjct  298  VVEPEEVGCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRENQSAIAEVDVKS  355

Query  66   I  66
            I
Sbjct  356  I  356

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            CEG++TKRGH   +W+ RY VL G  L   YF
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YF  240

>PYIW_13172
Length=939

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W+ R+  L+G +L  +Y+ESK   +N    KG   ++S+
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRNHLKGRVNVASV  199

>CCA17102
Length=884

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV KRGH  ++W++R+  L+G   R++Y+ESK   Q     KG   L+S+
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGN--RLSYYESKGDAQQRVHLKGRVKLASV  159

>PHYRA_77834
Length=936

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASV  168

>PITG_18067
Length=924

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASV  158

>PPTG_13401
Length=927

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASV  158

>PYAP_17290
Length=835

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 35/52 (67%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W++R+  L+G +L  +Y+E+K   +N    KG   ++S+
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVASV  202

>PYIR_21589
Length=1568

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 4/61 (7%)

Query  8    VVRP--TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            VV P   SCEGY+T+RGH   S R+ Y VL+G  LR  ++  ++A+++  ++  E  + S
Sbjct  298  VVEPEEVSCEGYLTRRGHLVPSQRMAYYVLNGTSLR--HYADQSAYRDNQSAIAEVEVRS  355

Query  66   I  66
            I
Sbjct  356  I  356

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%), Gaps = 2/35 (6%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            P SC GY+TK+GH RKSW+ RY +L G    +AY+
Sbjct  403  PVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYY  435

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            CEG++TKRGH   +W+ RY VL G  L   YF
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YF  240

>PHYSO_361747
Length=1523

 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDG  37
            +V  P SC GY+TK+GH RKSW+ RY +L G
Sbjct  407  SVPEPVSCAGYLTKQGHKRKSWKKRYFILRG  437

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+G  LR  ++  + A+++   +  E  + S+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRDNQLAMAEVEIRSV  364

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS  254

>HYAP_08645
Length=1514

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDG  37
            +V  P SC GY+TK+GH RKSW+ RY +L G
Sbjct  301  SVPEPVSCAGYLTKQGHKRKSWKKRYFILRG  331

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 33/54 (61%), Gaps = 2/54 (4%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            SCEGY+TKRGH   S R+ Y VL+G  LR  ++  + A++   ++  E  + S+
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR--HYADQQAYRENQSAMAEVEIRSV  258

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSGEEKS  148

>PHYCA_503112
Length=214

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W+ R+  L+G    V+Y+E+K   +N +  KG   ++S+
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASV  166

>CCI42457
Length=906

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV KRGH  ++W++R+  L+G   RV+Y+ESK   Q     KG   + S+
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKGDAQQRVHLKGRVKVVSV  179

>H310_00230
Length=1248

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADL  40
            ++P +C GY+TK+GH RKSW+ RY VL GA L
Sbjct  221  LQPIACAGYLTKQGHKRKSWKRRYFVLRGALL  252

 Score = 37.7 bits (86),  Expect = 0.094, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 24/36 (67%), Gaps = 1/36 (3%)

Query  14  CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
           C GY+TKRGH   +W++R+ VL      ++Y+E ++
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDES  46

>H257_06721
Length=1238

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADL  40
            ++P +C GY+TK+GH RKSW+ RY VL G+ L
Sbjct  227  LQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL  258

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 24/36 (67%), Gaps = 1/36 (3%)

Query  14  CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
           C GY+TKRGH   +W++RY VL      ++Y+E ++
Sbjct  14  CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYEDES  48

>CCA18023
Length=1138

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 17/120 (14%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvag  74
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++    +G+  +  +    Y   
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPENYG--  180

Query  75   gmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRKAA  134
                     K  GF +      KG+    +   T  +   W+E+   A+E AA  S  A+
Sbjct  181  ---------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAAPFSSNAS  227

>PYAR_19914
Length=788

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYVTKRGH  ++W+ R+  L+G +L  +Y+E+K   +N    KG   + S+
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVVSV  195

>PYAR_15463
Length=1091

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 61/149 (41%), Gaps = 30/149 (20%)

Query  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFY  62
            GA   +      EGYV K+G +   W  RYLVLDGA L   Y+ SK   ++G   +G   
Sbjct  66   GAASGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARSGRNLRGRMI  123

Query  63   LSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLE-----  117
            +S +    Y            K  GF +      KG+    +   T  +   W+E     
Sbjct  124  ISKVRPENYG-----------KAHGFLIE----TKGHKLFHLCCSTELEKDMWVEMMQAA  168

Query  118  ----VAHNALE----SAAAMSRKAAGDGG  138
                V HN L+    SAAA++  ++  G 
Sbjct  169  IDEGVKHNTLDRSLLSAAALTSTSSASGA  197

>CCI45895
Length=1721

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK---TAFQNGAASKGEFYLSSI  66
            EGY+ KRGH   S R RY VL   D  + YFE+K     F+ G+   GEF ++++
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKEDAEGFECGSKPLGEFQVANV  897

>CCA19033
Length=1883

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query  15    EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT---AFQNGAASKGEFYLSSI  66
             EGY+ KRGH   S R RY VL   +  + YFE+K    +FQ G  + GEF + ++
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDADSFQYGLKALGEFQIGNV  1075

>CCI46235
Length=1155

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/147 (26%), Positives = 58/147 (39%), Gaps = 27/147 (18%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvag  74
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++    +G+  +  +    Y   
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNLRGKMMIVKVRPENYG--  175

Query  75   gmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRKAA  134
                     K  GF +      KG+    +   T  +   W+E+   A+E A   S    
Sbjct  176  ---------KAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAVPFSN---  219

Query  135  GDGGGSATTKSLFGFSTTTSPQQQLKA  161
                   TT S      + +P +Q  A
Sbjct  220  -------TTHSFVSLHHSIAPFEQSPA  239

>PYVX_13312
Length=1016

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (58%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++G   +G   LS +
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARSGRNLRGRMQLSRV  125

>H257_03093
Length=975

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ SK   + G   +G   ++ +
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEARTGTNLRGRMIITKV  153

>PYAP_18636
Length=1009

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++G   +G   +S +
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSGRNLRGRMIISKV  152

>H310_04843
Length=968

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ SK   + G   +G   ++ +
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEARTGKNLRGRMIITRV  152

>PITG_11303
Length=293

 Score = 41.6 bits (96),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 0/36 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            CEGY+TKRGH   +W+ RY  L G  L     E K+
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLEYYSSEEKS  249

>H310_06378
Length=837

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 33/52 (63%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EG+V K+GH  ++W+VRY  L+G  L  +Y+E+K   +     KG  +L+++
Sbjct  59   EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETKEDARKRRFLKGRVHLTTV  108

>PHYRA_82543
Length=1199

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++    +G   +S +
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKV  110

>PPTG_19371
Length=1195

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++    +G   +S +
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKV  120

>PHYSO_544598
Length=1163

 Score = 41.6 bits (96),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
           EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++    +G   +S +
Sbjct  19  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIISKV  68

>SPRG_00889
Length=994

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 53/124 (43%), Gaps = 16/124 (13%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            V+    EG+V K+G +   W  RYLVLDG  L   Y+  +   ++G   +G   L+ +  
Sbjct  117  VQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLTYVGP  174

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
                          +K  GF +      KG+    +   T  +   W+E+   AL+ A++
Sbjct  175  ----------DFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASS  220

Query  129  MSRK  132
             S K
Sbjct  221  ASTK  224

>SDRG_01408
Length=916

 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/128 (26%), Positives = 53/128 (41%), Gaps = 16/128 (13%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            V+    EG+V K+G +   W  RYLVLDG  L   Y+  +   ++G   +G   L+ +  
Sbjct  119  VQEVHWEGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARSGKNLRGRMVLTYVGP  176

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
                          +K  GF +      KG+    +   T  +   W+E+   AL+ A  
Sbjct  177  ----------DFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEANG  222

Query  129  MSRKAAGD  136
             + K A D
Sbjct  223  AANKPAQD  230

>SDRG_01407
Length=815

 Score = 41.2 bits (95),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++G   +G   ++ +
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRV  134

>SPRG_00890
Length=883

 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (58%), Gaps = 2/52 (4%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
           EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++G   +G   ++ +
Sbjct  31  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARSGRNLRGRMIITRV  80

>PYIR_17453
Length=2619

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 58/134 (43%), Gaps = 24/134 (18%)

Query  14    CEGYVTKRGHFR-KSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayv  72
             CEGYV  R HF   +WR R+ VL+   L + Y ++  A   G   K      +++KH  +
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQK------ALEKHDLI  2212

Query  73    aggmgavgaQ------EKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALE--  124
             A                  FGF++   A   GY E  + +E   + TKWL    NA+   
Sbjct  2213  AVKKWHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKWLAAITNAVSEI  2268

Query  125   ----SAAAMSRKAA  134
                 S+  M+R AA
Sbjct  2269  STHVSSKVMTRDAA  2282

 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query  2     SGAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGA  55
             S AG N  R    EGY+ KRGH   S R RY VL    L   YF +    +N A
Sbjct  1211  SEAGSN--RQILMEGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPA  1260

>SPRG_17022
Length=107

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  9   VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
           +  T  EGY+ K+GH  ++WR RY VL G      Y+ SK A
Sbjct  29  IMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PHYCA_504712
Length=208

 Score = 39.7 bits (91),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 59/141 (42%), Gaps = 26/141 (18%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L G  L   YF+S     NGA  +  F +  +    
Sbjct  82   PVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS----DNGALLRS-FTVCHV----  130

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                    V  + +    ++     +K    L +  ET ADL +WL+  H A+   AA  
Sbjct  131  --------VTLRTRRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI---AAEK  175

Query  131  RKAAGDGGGSATTKSLFGFST  151
            RK  G+     T ++    +T
Sbjct  176  RKKHGEDAPQWTEQAPVAVAT  196

>PHALS_03540
Length=904

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 38/136 (28%), Positives = 57/136 (42%), Gaps = 23/136 (17%)

Query  8    VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
            V R + C+  G+  K+G   KSW+ R+ VL G +L   YFE ++    G   KG   +S 
Sbjct  36   VARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERSPSGKGIDEKGRLRISG  93

Query  66   IDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWL----EVAHN  121
            ++ +         V  + K    KM               VE+  ++ +W     E  H 
Sbjct  94   VE-YTPEFTNALLVRGELKNQAVKMQ--------------VESNEEIDEWFVKISEALHA  138

Query  122  ALESAAAMSRKAAGDG  137
            A E+ AA  RK  G G
Sbjct  139  ATEALAANQRKTTGSG  154

 Score = 38.5 bits (88),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L GA L   YF+S     NGA  +  F +  +    
Sbjct  783  PVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS----DNGALLRS-FTVCHV----  831

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL  123
                    V  + K    ++     +K    L +  ET ADL +WL+  H A+
Sbjct  832  --------VTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI  872

 Score = 32.7 bits (73),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            CEG++ KRG     W+ RY +L G  L+
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PITG_19213
Length=1201

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++    +G   ++ +
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNLRGRMIINKV  120

>CCI10489
Length=777

 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ KRGH  +SWR R+ VL G  L  +Y+ SK
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSK  138

>PHYKE_5678
Length=809

 Score = 40.0 bits (92),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSK  134

>H257_13567
Length=836

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 33/52 (63%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EG+V K+GH  ++W+VRY  L+G  L  +Y+E+K   +     KG  +++++
Sbjct  61   EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETKEDARKRRFLKGRVHVTTV  110

>PYU1_G008848
Length=765

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++    +G   +S +
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKV  183

>PYIR_18382
Length=1154

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++    +G   +S +
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKV  178

>PYIW_16987
Length=821

 Score = 40.0 bits (92),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (56%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EGYV K+G +   W  RYLVLDGA L   Y+ +K   ++    +G   +S +
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNLRGRMIISKV  169

>PPTG_05519
Length=810

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PITG_02762
Length=810

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYCA_506137
Length=810

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PHYSO_344112
Length=813

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  135

>PYIW_18480
Length=755

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           T  EGYV K+GH  +SWR RY +L G     +Y+ SK
Sbjct  50  TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSK  84

>PHYRA_79281
Length=809

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  134

>PHALS_04098
Length=1183

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 48/113 (42%), Gaps = 17/113 (15%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvag  74
            EGYV K+G +   W  RYL+LDGA L   Y+ SK   ++    +G   +  +    Y   
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNMRGRMTVYKVRPENYG--  130

Query  75   gmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAA  127
                     K  GF +      + + +  +   T  +   W+E+ H A+E  A
Sbjct  131  ---------KAHGFLL----ETQSHKQFHLCCATELEKDMWVEMMHAAVEEGA  170

>HYAP_08026
Length=798

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  122

>CCA21715
Length=782

 Score = 39.7 bits (91),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>CCA21860
Length=782

 Score = 39.7 bits (91),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSK  140

>H310_04842
Length=1081

 Score = 39.7 bits (91),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 53/124 (43%), Gaps = 16/124 (13%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvag  74
            EG V K+G +   W  RYLVLDG  LR  Y+  +   + G   +G+  L+ +        
Sbjct  118  EGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARLGKHLRGKLILTHVSP------  169

Query  75   gmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMSRKAA  134
                   +E  F  +  G   K  +   D  +E   D+  W+E+   A+  AAA  R+ A
Sbjct  170  --EIHKKKEHTFAVETTGR--KMFFMSCDTELE--KDM--WVEMIQAAISEAAAPQRQHA  221

Query  135  GDGG  138
               G
Sbjct  222  NRHG  225

>PYVX_18338
Length=746

 Score = 39.7 bits (91),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  79   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSK  113

>PYU1_G012274
Length=873

 Score = 39.7 bits (91),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 40/84 (48%), Gaps = 17/84 (20%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI-DKHay  71
            S EGY+ K+    +SW+  Y VL+G  +  AY+ES+  F       G  ++ S+ D H  
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESREDFIMNTKLIGRIHIQSVEDDHMG  367

Query  72   vaggmgavgaQEKPFGFKMV--GH  93
                        KP GF+++  GH
Sbjct  368  ------------KPNGFRILTEGH  379

>PITG_17893
Length=747

 Score = 39.3 bits (90),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 1/38 (3%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
            S  G++ KRGH RK+W+ RY VL+ + LR  Y +S  A
Sbjct  218  SMSGWLRKRGHVRKNWKARYFVLEKSVLRY-YTDSSCA  254

>PHYRA_73534
Length=1210

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 6/51 (12%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
            S  G++ KRGH RK+W+ RY VL+ + LR  Y+   +     A  KGE  L
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDPSC----AKLKGEVLL  383

>PHYSO_484541
Length=911

 Score = 39.3 bits (90),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 54/126 (43%), Gaps = 25/126 (20%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L G  L   YF+S     NGA  +  F +  +    
Sbjct  778  PVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS----DNGALLR-SFTVCHV----  826

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                    V  + K    ++     +K    L +  ET ADL +WL+  H A+  AA   
Sbjct  827  --------VTLRTKKLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI--AAEKR  872

Query  131  RKAAGD  136
            +K  GD
Sbjct  873  KKHGGD  878

 Score = 38.5 bits (88),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           VVR + C+  G+  K+G   KSW+ RY VL G +L   YF  ++    G   KG   +S 
Sbjct  36  VVRSSYCDHSGWGLKQGSIIKSWKRRYFVLKGREL--IYFAERSPSGKGIDEKGRLRVSG  93

Query  66  ID  67
           ++
Sbjct  94  VE  95

>PYAP_22646
Length=815

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY +L G     +Y+ SK
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISK  134

>PYU1_G012859
Length=1183

 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (66%), Gaps = 2/41 (5%)

Query  7    NVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            ++V+P    G++ K+GH  +SW+ RY VL G  L+  YFE+
Sbjct  488  SIVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFEN  526

 Score = 34.3 bits (77),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            ++C G++ K+G   K+W+ RY  L G  LR  YF+ +T
Sbjct  809  SNCHGWLNKQGGTIKTWKRRYFSLHGTTLR--YFKRET  844

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDG  37
            +CEG++ K+GH  K W+ RY  L+ 
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLNN  382

 Score = 31.2 bits (69),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 27/52 (52%), Gaps = 9/52 (17%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
           G+ +K+G   K+W+ R+ VL G DL  AYF       +G   KG   +  +D
Sbjct  11  GWGSKQGSKVKTWKTRFFVLRGTDL--AYF-------SGTDEKGRLRVVDVD  53

>PHALS_03645
Length=830

 Score = 39.3 bits (90),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY VL G     +Y+ SK
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSK  135

>PPTG_16659
Length=916

 Score = 39.3 bits (90),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           VVR + C+  G+  K+G   KSW+ RY VL G +L   YF  ++    G   KG   +S 
Sbjct  36  VVRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL--IYFSERSPSGKGIDEKGRLRISG  93

Query  66  ID  67
           ++
Sbjct  94  VE  95

 Score = 38.1 bits (87),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 53/125 (42%), Gaps = 26/125 (21%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L G  L   YF+S     NGA  +  F +  +    
Sbjct  784  PVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS----DNGALLR-SFTICHV----  832

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                    V  + K    ++     +K    L +  ET ADL +WL+  H A+   AA  
Sbjct  833  --------VTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI---AAEK  877

Query  131  RKAAG  135
            RK  G
Sbjct  878  RKKHG  882

>PPTG_04553
Length=904

 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            S  G++ KRGH RK+W+ RY VL+ + LR
Sbjct  361  SMSGWLRKRGHVRKNWKARYFVLEKSVLR  389

>SDRG_08800
Length=881

 Score = 38.9 bits (89),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 32/52 (62%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EG+V+K+GH  ++W++RY  L+   L  +Y+ESK   +     KG  +L+ +
Sbjct  66   EGFVSKKGHLVRNWKLRYFTLESNLL--SYYESKEDARKRRHLKGRVHLTRV  115

>PHYRA_73535
Length=875

 Score = 38.9 bits (89),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (57%), Gaps = 6/51 (12%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
            S  G++ KRGH RK+W+ RY VL+ + LR  Y+   +     A  KGE  L
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDPSC----AKLKGEVLL  383

>PHYRA_78815
Length=919

 Score = 38.9 bits (89),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           VVR + C+  G+  K+G   KSW+ RY VL G +L   YF  ++    G   KG   +S 
Sbjct  36  VVRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL--IYFAERSPSGKGIDEKGRLRISG  93

Query  66  ID  67
           ++
Sbjct  94  VE  95

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 23/113 (20%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L G  L   YF+S     NGA  +  F +  +    
Sbjct  791  PVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS----DNGALLR-SFTVCHV----  839

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNAL  123
                    V  + +    ++     +K    L +  ET ADL +WL+  H A+
Sbjct  840  --------VTLRTRKLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI  880

>SPRG_02752
Length=831

 Score = 38.9 bits (89),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 3/54 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
           EG++ K+G    +W+ RY+VL G    +AY++ K      A  KG F L+++++
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKG--RHIAYYD-KEVTNPRAKEKGTFTLAAVER  57

 Score = 31.2 bits (69),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
            G++ K G   KSW+ R+ VL G DL   Y++
Sbjct  134  GWLEKEGQNVKSWKKRFFVLSGTDL--TYYD  162

>PYAR_23366
Length=828

 Score = 38.9 bits (89),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 2/47 (4%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS  57
            P   EGYV +RG +   W   YL +DG  LR  ++ESKT +    A+
Sbjct  72   PILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESKTKYIEAQAA  116

>PHYSO_343629
Length=977

 Score = 38.9 bits (89),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 19/23 (83%), Gaps = 0/23 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDG  37
            EGYVTKRGH  ++W++R+  L+G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>PYAR_19883
Length=833

 Score = 38.5 bits (88),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK-TAFQNGAASKG  59
            T  EGY+ K+GH  ++WR RY +L G     +Y+ SK  A Q+    +G
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVAMQDTEKYRG  146

>PYU1_G004386
Length=837

 Score = 38.5 bits (88),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY +L G     +Y+ SK
Sbjct  136  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  170

>H257_03361
Length=699

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
           +G++ K+G    SW+ RYLVL G +  ++YF+ K      A  KG F L+ +  +
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD-KEVSNPRAKEKGSFVLAGVQPN  62

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (52%), Gaps = 3/60 (5%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            RPT   G++ K+G   +SW+ RY VL G +  +AYF++    Q G     +  +S    H
Sbjct  207  RPTYT-GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDTVDGNQKGGGRLADVTMSDTGLH  263

>PHYSO_556164
Length=765

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            S  G++ KRGH RK+W+ RY VL+ + LR
Sbjct  220  SMSGWLRKRGHVRKNWKARYFVLEKSVLR  248

>PYIR_13120
Length=814

 Score = 38.5 bits (88),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            T  EGY+ K+GH  +SWR RY +L G     +Y+ SK
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSK  138

>SPRG_05449
Length=723

 Score = 38.5 bits (88),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 32/53 (60%), Gaps = 2/53 (4%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
             EG+V+K+GH  ++W++RY  L+   L  +Y+ESK   +     KG  +L+ +
Sbjct  65   WEGFVSKKGHLVRNWKLRYFTLESNLL--SYYESKEDARKRRHLKGRVHLTRV  115

>PHYSO_350197
Length=557

 Score = 38.5 bits (88),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 17/99 (17%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+  A  +G+   SS+                 KP G
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDFEKRAI-RGKIPFSSV------------HAWDGKPNG  88

Query  88   FKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESA  126
            F+   + P        ++ ET  D  KWLEV   AL++A
Sbjct  89   FQF--YTPSNNC--FRVYTETPEDQLKWLEVMQKALDNA  123

>CCI40991
Length=801

 Score = 38.5 bits (88),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (61%), Gaps = 2/38 (5%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGA--DLRVAYFES  47
            T  EGY+ K+GH  +SWR RY VL G      VA+ +S
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQS  143

>HYAP_11712
Length=558

 Score = 38.1 bits (87),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (43%), Gaps = 25/103 (24%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+     +G+   SS+                 KP G
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTI-RGKIPFSSV------------HAWDGKPNG  88

Query  88   FKMVGHAPKKGYTELD----IFVETLADLTKWLEVAHNALESA  126
            F+         YT  D    ++ ET AD  KWLEV    +++A
Sbjct  89   FQF--------YTPADHCFRVYTETAADQLKWLEVMQKCIDNA  123

>SPRG_08346
Length=797

 Score = 38.1 bits (87),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
           T  EGY+ K+GH  ++WR RY VL G      Y+ SK A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>SDRG_05150
Length=787

 Score = 38.1 bits (87),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
           T  EGY+ K+GH  ++WR RY VL G      Y+ SK A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>HYAP_11713
Length=417

 Score = 37.7 bits (86),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (43%), Gaps = 25/103 (24%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+     +G+   SS+                 KP G
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTI-RGKIPFSSV------------HAWDGKPNG  88

Query  88   FKMVGHAPKKGYTELD----IFVETLADLTKWLEVAHNALESA  126
            F+         YT  D    ++ ET AD  KWLEV    +++A
Sbjct  89   FQF--------YTPADHCFRVYTETAADQLKWLEVMQKCIDNA  123

>PHYCA_509385
Length=557

 Score = 37.7 bits (86),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (43%), Gaps = 25/103 (24%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+  A  +G+   SS+                 KP G
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDFEKRAI-RGKIPFSSV------------HAWDGKPNG  88

Query  88   FKMVGHAPKKGYTELD----IFVETLADLTKWLEVAHNALESA  126
            F+         YT  D    ++ ET  D  KW+E   N +++A
Sbjct  89   FQF--------YTPSDNCFRVYTETAEDQAKWIETMQNCIDNA  123

>H257_03931
Length=695

 Score = 37.7 bits (86),  Expect = 0.071, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            PTS  G + K+ +  K+W+ R++VL G  +   Y+ S T+ +     +G   LS +D H 
Sbjct  108  PTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTSSEE-TFPRGVISLSGVDVHP  164

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                        +K F F+ + H     Y  L +  +  ADL +WL    ++++SA+   
Sbjct  165  LDTAKF------KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWL----SSIKSASLPV  210

Query  131  RKAAGD  136
            R    D
Sbjct  211  RDGVAD  216

>PITG_00020
Length=927

 Score = 37.7 bits (86),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 53/125 (42%), Gaps = 26/125 (21%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L G  L   YF+S     NGA  +  F +  +    
Sbjct  795  PVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS----DNGALLR-SFTVCHV----  843

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                    V  + K    ++     +K    L +  ET ADL +WL+  H A+   AA  
Sbjct  844  --------VTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI---AAEK  888

Query  131  RKAAG  135
            RK  G
Sbjct  889  RKKHG  893

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (52%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           VVR + C+  G+  K+G   KS + RY VL G +L   YF  ++    G   KG   +S 
Sbjct  36  VVRSSYCDHSGWGYKQGSIIKSRKRRYFVLKGREL--IYFAERSPSGKGIDEKGRLRISG  93

Query  66  ID  67
           +D
Sbjct  94  VD  95

>HYAP_04457
Length=1203

 Score = 37.7 bits (86),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGYV K+G +   W  RYL+LDG  L   Y+ SK
Sbjct  62  EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSK  93

>PYVX_23349
Length=924

 Score = 37.7 bits (86),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (55%), Gaps = 6/51 (12%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
            S  G++ K GH RK+W+ RY VL+ + LR    ES++        KGE  L
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRL------KGEVLL  488

>PYU1_G008981
Length=712

 Score = 37.7 bits (86),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAF  51
           P + EG V K+G +   W   Y+ LDG  LRV  FESK  F
Sbjct  29  PVAWEGIVKKKGEWLPRWEEVYVTLDGLALRV--FESKAKF  67

>PYU1_G003229
Length=810

 Score = 37.7 bits (86),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (52%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           V + T C+  G+ +K+G   KSW+ RY VL G +L   YF  ++    G   KG   +  
Sbjct  21  VAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERSPSGKGINEKGRLKIVG  78

Query  66  ID  67
           ++
Sbjct  79  VE  80

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 22/31 (71%), Gaps = 2/31 (6%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
            G++ K+GH  KSW+ R+ V++G+   + YFE
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 2/34 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            C G++ K G   K+W++RY  L G  L   YF+S
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS  733

 Score = 32.0 bits (71),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            CEG++ KRG    +W+ R+  L+G  L+
Sbjct  260  CEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

 Score = 31.2 bits (69),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADL  40
            +G++ K+G   K+W+ RY VLDG  L
Sbjct  520  KGWLMKKGKNFKTWKRRYFVLDGKKL  545

>PYIR_23372
Length=1415

 Score = 37.7 bits (86),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 43/94 (46%), Gaps = 21/94 (22%)

Query  2    SGAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEF  61
            SG G+      S EGY+ K+    +SW+  Y VL+G  +  AY+ES+  F + +   G  
Sbjct  317  SGDGI------SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESREDFISNSKLMGRI  368

Query  62   YLSSIDKHayvaggmgavgaQEKPFGFKMV--GH  93
             +  ++                KP GF+++  GH
Sbjct  369  QIQGVEDDNMG-----------KPNGFRVITEGH  391

>PHYKE_6662
Length=765

 Score = 37.4 bits (85),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            EG+V K+G +   W  RYL+LDGA L   Y+ SK
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSK  103

>SDRG_14487
Length=964

 Score = 37.7 bits (86),  Expect = 0.093, Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 33/54 (61%), Gaps = 3/54 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
           EG++ K+G    +W+ RY+VL G    +AY++ + +    A  KG F L+++++
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGR--HIAYYDKEVS-NPRAKEKGTFTLAAVER  57

 Score = 32.7 bits (73),  Expect = 3.6, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            R  +  G++ K G   KSW+ R+ VL G DL   Y++     + G A KG
Sbjct  127  RAVTHSGWLEKEGQNVKSWKKRFFVLSGTDL--TYYD-----RIGGAEKG  169

>PYAP_23478
Length=897

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 20/26 (77%), Gaps = 0/26 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLR  41
            G++ K GH RK+W++RY VLD + LR
Sbjct  380  GWLRKLGHVRKNWKLRYFVLDKSVLR  405

>PYU1_G000724
Length=189

 Score = 36.2 bits (82),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  AD   AY+++K
Sbjct  111  GWLTKQGHMWKSWKTRFFVLF-ADGTFAYYKNK  142

>HYAP_06101
Length=984

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  AD   AY+++K
Sbjct  143  GWLTKQGHLWKSWKTRFFVL-FADGTFAYYKNK  174

>H310_01921
Length=341

 Score = 36.6 bits (83),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
           G+V K+G   KSW+ RY+VL    L   YFES+    N  A KG F + +++
Sbjct  24  GWVYKQGSMIKSWKKRYMVLKNKQL--TYFESEKVEGNSKA-KGSFQVITVE  72

>PYVX_22589
Length=1375

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            R  S EGY+ K+     +W+V Y VL+   L  AYFES+  F + +   G   + +++
Sbjct  276  RSISFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESREDFISNSKLIGRVQIQAVE  331

>PYAP_15374
Length=595

 Score = 36.6 bits (83),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (60%), Gaps = 2/42 (5%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            P   EGYV ++G +   W   Y+ +DG  LR  ++ESK+ +Q
Sbjct  76   PILWEGYVRRKGDWLPRWEEMYVTMDGLWLR--FYESKSKYQ  115

>SDRG_03175
Length=934

 Score = 36.6 bits (83),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 2/36 (6%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
           P   EGY+ KRG +   W   Y+VL G DL  AYF+
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFD  55

>H310_07070
Length=680

 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 57/126 (45%), Gaps = 17/126 (13%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            PTS  G + K+ +  K+W+ R++VL G  +   Y+ S T  +     +G   LS +D H 
Sbjct  118  PTSKSGVLVKQANHLKNWKKRFMVLRGQSM--FYYVSGTTSEE-TYPRGVISLSGVDVHP  174

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                        +K F F+ + H     Y  L +  +  ADL +W+    ++++SA+   
Sbjct  175  LDVSKF------KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWM----SSIKSASLPV  220

Query  131  RKAAGD  136
            R    D
Sbjct  221  RDGIAD  226

>H257_06469
Length=76

 Score = 33.5 bits (75),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)

Query  15  EGYVTKRGHFRKSWRVRYLVLD  36
           EGYV K+GH  KSW+ RY  LD
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLD  23

>PHYKE_5588
Length=751

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 23/43 (53%), Gaps = 2/43 (5%)

Query  5    GVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
             V+V  P  C G++ K G   K+W+ RY  L G  L   YF+S
Sbjct  432  AVDVEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  472

>SPRG_16312
Length=261

 Score = 35.8 bits (81),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 32/56 (57%), Gaps = 5/56 (9%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
           P    GYV K+G F K+W+ R++VL   D  + Y+ S+ A    A  +G F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRFMVLH--DDTLFYYVSERAM---AKPRGFFRVTSV  88

>SDRG_05567
Length=980

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 32/59 (54%), Gaps = 7/59 (12%)

Query  1    MSGAGVNVVRPTS-------CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            +S A  +V +PT+         GY++KRG +RK+W+ RY +L      + Y +S+   +
Sbjct  115  LSKASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE  173

>H310_13627
Length=678

 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            G++ K+GH  K+W+ R+ VLDG+ LR  YF
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YF  297

>PYIW_21901
Length=913

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            S  G++ K GH RK+W+ RY VLD + LR    ES
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADES  457

>SDRG_02135
Length=306

 Score = 35.8 bits (81),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 2/33 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
           EGY+ K+GH  K+WR RY  L   D  +AY++S
Sbjct  2   EGYLLKQGHVVKNWRRRYFRL--VDASLAYYDS  32

>CCA25510
Length=1139

 Score = 36.2 bits (82),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            GY+ K+G F KSWR RY +L      +AY+ SK
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSK  229

>H257_03363
Length=316

 Score = 35.8 bits (81),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 3/52 (6%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
           G+V K+G   KSW+ RY+VL    L   YFE++    N  A KG F + +I+
Sbjct  8   GWVYKQGSMVKSWKKRYMVLKNKQL--TYFENEKIEGNSKA-KGSFQVITIE  56

>PYAP_24144
Length=1022

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 11/81 (14%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvag  74
            EGY+ K+      WR  Y VL+G  L  AY+ES+  F   A   G   +  +D     A 
Sbjct  314  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESREDFILNARLIGRIQVQGVDDDNLPAA  371

Query  75   gmgavgaQEKPFGFKMV--GH  93
                     KP GF+++  GH
Sbjct  372  TG-------KPHGFRVLTEGH  385

>CCA24531
Length=374

 Score = 35.8 bits (81),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 35/147 (24%), Positives = 64/147 (44%), Gaps = 25/147 (17%)

Query  9    VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            +R     G++ K+G   +SW+ RY+VL G  L  +Y+++          KG F + +++ 
Sbjct  20   IRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITVE-  76

Query  69   HayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKW----LEVAHNALE  124
                        + E   G  + G    +G   L ++ ET  + + W    +E    ++E
Sbjct  77   -----------LSNEIKNGLLVHG----RGGRILKLYTETTEEASGWYNAIMEATVISVE  121

Query  125  SAAAM---SRKAAGDGGGSATTKSLFG  148
            +AAA+       AG  G + T  S+ G
Sbjct  122  TAAAIVAGRTSRAGSVGSNETASSIDG  148

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            G++ K G   KSW+ RY VL G  L  AYF S+     GA++KG
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASE---DTGASAKG  222

>PYIR_14494
Length=819

 Score = 36.2 bits (82),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query  8   VVRPTSCE--GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSS  65
           V + + C+  G+ +K+G   KSW+ RY VL G +L   YF  ++    G   KG   + +
Sbjct  22  VTKNSYCDHAGWASKQGSIIKSWKRRYFVLKGREL--IYFAERSPSGKGIDEKGRLKIVA  79

Query  66  ID  67
           ++
Sbjct  80  VE  81

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            C G++ K G   K+W++RY  L+GA L  +YF+S
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 31.6 bits (70),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            CEG++ KRG    +W+ R+  L+G  L+
Sbjct  265  CEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

>H310_07701
Length=811

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           T  EGYV K+GH  ++WR RY +L G      Y+ SK
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>PYVX_13084
Length=1267

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRV-AYFESK  48
            GY+ K+G F K+WR RY VL   DL V +YF SK
Sbjct  242  GYLVKQGSFWKTWRRRYFVLR-RDLPVMSYFSSK  274

>H257_07514
Length=810

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           T  EGYV K+GH  ++WR RY +L G      Y+ SK
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSK  84

>SPRG_09128
Length=620

 Score = 35.8 bits (81),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
            G++ K GH RKSW+ R+ VLDG+ L+  Y+    +       KGE  L
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YYTDDVSKVKTPKLKGEVLL  313

>PHYKE_9146
Length=557

 Score = 35.8 bits (81),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 17/99 (17%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+  +  +G+   SS+                 KP G
Sbjct  42   WKKRYCVVYKDELQITYFLSLEDFEKRSI-RGKIPFSSV------------HAWDGKPNG  88

Query  88   FKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESA  126
            F+   + P    T   ++ ET  D  KWLEV    L+++
Sbjct  89   FQF--YTPSN--TCFRVYTETAEDQLKWLEVMQKVLDNS  123

>H257_09823
Length=654

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 2/30 (7%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            G++ K GH RK+W+ R+ VLDG+ L+  YF
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YF  292

>PYIW_22477
Length=864

 Score = 35.8 bits (81),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 5/41 (12%)

Query  15   EGYVTK--RGH-FRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
             GY+ +  +GH F KSWR  Y VLD A L+   FESK+A++
Sbjct  760  HGYLKRFEKGHLFSKSWRQYYYVLDHAMLKC--FESKSAYE  798

>PYAR_19291
Length=711

 Score = 35.8 bits (81),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            G++ K GH RK+W++RY VL+ + LR    E+ T
Sbjct  212  GWLRKLGHVRKNWKMRYFVLEKSVLRYYADEAMT  245

>PYIR_13168
Length=1353

 Score = 35.8 bits (81),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  K+W+ R+ VL  AD   AY+++K
Sbjct  116  GWLTKQGHMWKTWKTRFFVL-YADGTFAYYKNK  147

>PHYRA_72718
Length=732

 Score = 35.4 bits (80),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9    VRPTSCEGYVTKRG-HFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS  57
            VR     G + KRG  +RK W++R++ LDG  L  AY+E   AF    AS
Sbjct  87   VRAPVVSGSLEKRGFRWRKKWKLRFVELDGRQL--AYYEDTGAFCATTAS  134

>PPTG_10755
Length=723

 Score = 35.4 bits (80),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9    VRPTSCEGYVTKRG-HFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS  57
            V+     G + KRG  +RK W++RY+ LDG  L  AY+E   AF    A+
Sbjct  96   VKAPVVSGSLEKRGFRWRKKWKLRYVELDGRQL--AYYEDSGAFSATTAT  143

>PITG_20103
Length=1301

 Score = 35.4 bits (80),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 23/83 (28%), Positives = 38/83 (46%), Gaps = 13/83 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            R  S EGY++K+     SW+  Y VL+   L  A++E++  F + +   G   L SI+  
Sbjct  221  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQSIEDE  278

Query  70   ayvaggmgavgaQEKPFGFKMVG  92
                          KP GF+++ 
Sbjct  279  DMG-----------KPNGFRVIA  290

>SDRG_00080
Length=298

 Score = 35.0 bits (79),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTA  50
            P +  GYV K+G F K+W+ RY+VL   D  + Y+ S+ A
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLH--DDTLFYYVSERA  107

>PITG_03318
Length=1343

 Score = 35.4 bits (80),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  +D   AY+++K
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNK  170

>H310_02133
Length=970

 Score = 35.4 bits (80),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
           P   EGY+ KRG +   W    +VLDG  LR++YF+
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRLSYFD  60

>SDRG_05128
Length=512

 Score = 35.0 bits (79),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 52/129 (40%), Gaps = 17/129 (13%)

Query  15   EGYVTKRGH--FRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayv  72
            EGY+ K+    FR  W  R+  +D   L + YF SK     G A +G F LS I      
Sbjct  376  EGYLEKKSSSIFR-GWERRWFKVDTRTLVMTYFHSKEDQMRGFAPRGSFALSRI------  428

Query  73   aggmgavgaQEKPFGFKMV----GHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
               +     +   + F +V      A        ++  E+ ADL  W+    + +E   A
Sbjct  429  THLVTHTHLRGNRYAFDIVVDLGTRANPHATRTFELRCESEADLKYWV----DTIEKYQA  484

Query  129  MSRKAAGDG  137
             SR+ + + 
Sbjct  485  FSRRTSSNA  493

>PHYRA_94409
Length=1270

 Score = 35.4 bits (80),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  +D   AY+++K
Sbjct  113  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNK  144

>H257_08182
Length=859

 Score = 35.4 bits (80),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (63%), Gaps = 6/43 (14%)

Query  10   RPTSC----EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            R TSC    EG++ K+G   KSW+ RY V+ G DL  AY++ +
Sbjct  655  RRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYKDE  695

 Score = 31.2 bits (69),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 29/54 (54%), Gaps = 3/54 (6%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
           G++ K+G   K+W+ RY+VL G    V Y++ K+  +     KG   L  + ++
Sbjct  10  GWIYKQGSRVKTWKKRYMVLQGR--HVTYYD-KSVLEPNPTEKGALVLVDVTQN  60

>H257_02642
Length=975

 Score = 35.4 bits (80),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
           P   EGY+ KRG +   W    +VLDG  LRV+Y++
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYD  60

>PPTG_16044
Length=1378

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  +D   AY+++K
Sbjct  139  GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNK  170

>PHYSO_248481
Length=1283

 Score = 35.4 bits (80),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (73%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+GH  KSW+ R+ VL  +D   AY+++K
Sbjct  92   GWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKNK  123

>SPRG_08326
Length=501

 Score = 35.0 bits (79),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 52/131 (40%), Gaps = 17/131 (13%)

Query  15   EGYVTKRGH--FRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayv  72
            EGY+ K+    FR  W  R+  +D   L + YF SK     G A +G F LS I      
Sbjct  368  EGYLEKKSSSIFR-GWERRWFKVDTRTLVLTYFHSKEDQMRGFAPRGSFALSRI------  420

Query  73   aggmgavgaQEKPFGFKMV----GHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAA  128
               +     +   + F +V      A        ++  E+ ADL  W++     +E   A
Sbjct  421  THLVTHAHLRGNRYAFDIVVDLGTRANPHATRTFELRCESEADLKYWVDT----IEKYQA  476

Query  129  MSRKAAGDGGG  139
             SR+ + +   
Sbjct  477  FSRRTSSNAAA  487

>PITG_00416
Length=698

 Score = 35.0 bits (79),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9    VRPTSCEGYVTKRG-HFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS  57
            V+     G + KRG  +RK W++RY+ LDG  L  AY+E   AF    A+
Sbjct  72   VKAPVVSGALEKRGFRWRKKWKLRYVELDGRQL--AYYEDSGAFSVTTAT  119

>PYIW_17818
Length=1188

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            P  C G++ K G   K+W+ RY  L G  LR  YF+S+
Sbjct  827  PGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR--YFKSE  862

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query  8    VVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            V  P    G++ K+G   KSW+ RY VL+G  L+  YF++
Sbjct  497  VAEPEIKYGWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDN  534

>CCI47145
Length=390

 Score = 35.0 bits (79),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (53%), Gaps = 2/59 (3%)

Query  9   VRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
           +R     G++ K+G   +SW+ RY+VL G  L  +Y+++          KG F + +++
Sbjct  32  IRRGQYSGWIFKQGSLVRSWKKRYMVLKGRQL--SYYDTDNILSLKVKEKGSFQVITVE  88

 Score = 32.7 bits (73),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 4/44 (9%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            G++ K G   KSW+ RY VL G  L  AYF S+     GA++KG
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASEDT--GGASAKG  238

>SDRG_14286
Length=670

 Score = 35.0 bits (79),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 2/52 (4%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K GH RK+W+ R+ VLDG+ L+  Y+    +       KGE  L   D
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YYTDDVSKAKTPKLKGEVLLFHKD  326

>SPRG_06021
Length=983

 Score = 35.0 bits (79),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 32/59 (54%), Gaps = 7/59 (12%)

Query  1    MSGAGVNVVRPTS-------CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            +S A  +V +PT+         GY++KRG +RK+W+ RY +L      + Y +S+   +
Sbjct  117  LSKASSSVGQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLE  175

>H310_06667
Length=896

 Score = 35.0 bits (79),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L  +YF +K
Sbjct  37  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTK  68

>SPRG_01654
Length=923

 Score = 35.0 bits (79),  Expect = 0.59, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 2/36 (6%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFE  46
           P   EGY+ KRG +   W   Y+VL G DL   YF+
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--TYFD  55

>CCI43793
Length=1117

 Score = 35.0 bits (79),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            GY+ K+G F KSWR R+ +L      +AY+ SK
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASK  207

>H257_09028
Length=556

 Score = 34.7 bits (78),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 64/155 (41%), Gaps = 30/155 (19%)

Query  7    NVVRPTSCEGYVTKRGHFRKS--WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLS  64
            ++  PT C GYV  + H + S  W+ RY VL    L + ++++  A   G   KG+   S
Sbjct  15   SIAVPTLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAATQGEL-KGKIPYS  72

Query  65   SIDKHayvaggmgavgaQEKPFGFKMVGHAP-KKGYTELDIFVETLADLTKWLEVAHNAL  123
            S+               + KP GF+   + P  K Y    ++ +T  +  KW+      L
Sbjct  73   SV------------HDWEGKPHGFQF--YTPTNKCYK---VYTDTEEEKLKWVSTMQKQL  115

Query  124  ESAAAMSRKAAGDGGGSATTKSLFGFSTTT-SPQQ  157
            + A  +         G     + FG S+   SP+Q
Sbjct  116  DDAPDVP-------DGEQVPYARFGASSPVGSPRQ  143

>H310_06666
Length=887

 Score = 35.0 bits (79),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L  +Y+ SK
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>PYIW_18491
Length=1684

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 39/83 (47%), Gaps = 15/83 (18%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayv  72
            S EGY+ K+    ++W+  Y VL+G  +  AY+ES+  F + +   G   +  ++     
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESREDFISNSKLIGRIQIQGVEDDNMG  364

Query  73   aggmgavgaQEKPFGFKMV--GH  93
                       KP GF+++  GH
Sbjct  365  -----------KPNGFRIITEGH  376

>PHYSO_478611
Length=522

 Score = 34.7 bits (78),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G  L  +YF S+     GAA+KG  ++ +++
Sbjct  283  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE---DTGAAAKGYGHVRAVE  329

>PHYRA_73430
Length=395

 Score = 34.7 bits (78),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G  L  +YF S+     GAA+KG  ++ +++
Sbjct  152  GWIKKEGARVKSWKRRYFVLRGNAL--SYFNSE---DTGAAAKGYGHVRAVE  198

>PYIR_20162
Length=884

 Score = 34.7 bits (78),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (66%), Gaps = 5/41 (12%)

Query  15   EGYVTK--RGH-FRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            +GY+ +  +GH F KSWR  Y VLD A L+   +ESK +F+
Sbjct  780  QGYLKRFEKGHLFSKSWRQYYYVLDHAMLKC--YESKNSFE  818

>HYAP_13690
Length=377

 Score = 34.7 bits (78),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (62%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G+ L  +YF S+     GAA+KG  ++ +++
Sbjct  138  GWLKKEGARVKSWKRRYFVLRGSVL--SYFNSE---DTGAAAKGYGHVRAVE  184

>H257_09262
Length=729

 Score = 34.7 bits (78),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  15   EGYVT-KRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            +GY T K+G    +W+ R++V+D A  RV Y+ +    +   A KG F + S+D
Sbjct  96   DGYCTMKKGSSSTTWKKRWVVVD-AYARVKYYPNAEGSRRNTAPKGTFTVLSVD  148

>H310_05686
Length=752

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (54%), Gaps = 2/65 (3%)

Query  4    AGVNVVRPTSCEGYVT-KRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFY  62
            A V  +  +  +GY T K+G    +W+ R++V+D A  RV Y+ +    +   A KG F 
Sbjct  88   ADVQTLGDSVLDGYCTIKKGTSSSTWKKRWVVVD-AYARVKYYSNAEGSRRNMAPKGTFT  146

Query  63   LSSID  67
            + S+D
Sbjct  147  VLSVD  151

>PYIR_24588
Length=909

 Score = 34.7 bits (78),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            G++ K GH RK+W+ RY VL+ + LR    ES
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLRYYADES  443

>H257_03095
Length=1086

 Score = 34.7 bits (78),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 27/52 (52%), Gaps = 2/52 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
            EG V K+G +   W  RYLVLDG  LR  Y+      + G   +G+  L+ +
Sbjct  117  EGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKHEDARMGKNLRGKMTLTHV  166

>PYU1_G007423
Length=928

 Score = 34.7 bits (78),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            S  G++ K GH RK+W+ RY VL+ + LR    +S T
Sbjct  433  SMRGWLRKLGHVRKNWKSRYFVLERSVLRYYSDDSMT  469

>PHYKE_4910
Length=375

 Score = 34.3 bits (77),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (57%), Gaps = 3/58 (5%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            P +  G+V K G   +SW+ R+LV  GA+L  AY+++ T  +N A   G    + I++
Sbjct  125  PVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN-TDEENHAQLLGALTAAHIER  179

>CCI39367
Length=2046

 Score = 34.7 bits (78),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 1/33 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++ K+GH  KSWRVR+ VL   D  +AY+  +
Sbjct  86   GWLRKQGHLWKSWRVRFFVL-YTDGTLAYYRKR  117

>PHALS_06334
Length=1064

 Score = 34.7 bits (78),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  14   CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            C G++ K G   KSW+ RY  L G+ L  +Y++SKT
Sbjct  726  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSKT  759

>SPRG_11900
Length=605

 Score = 34.7 bits (78),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            +P  C GY+ K+G   K+WR RY  +DG   +++Y ++     +GA  KG
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDA-----DGAPPKG  277

>HYAP_14013
Length=398

 Score = 34.3 bits (77),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 51/122 (42%), Gaps = 26/122 (21%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHa  70
            P  C G++ K G   K+W+ RY  L    L   YF+S     NGA  +  F +  +    
Sbjct  296  PVVCSGWLRKEGGTVKNWKRRYFTLHSTIL--CYFKS----DNGALLRS-FTVCHV----  344

Query  71   yvaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
                    V  + K    ++     +K    L +  ET ADL +WL+  H A+   AA  
Sbjct  345  --------VTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI---AAEK  389

Query  131  RK  132
            RK
Sbjct  390  RK  391

>CCA22367
Length=885

 Score = 34.3 bits (77),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGA  55
            +G++ KRGH +K+W+ RY  ++   L+  YF        GA
Sbjct  544  DGFLWKRGHLKKNWKKRYFRIEDGQLQ--YFTENKKLMRGA  582

>PHALS_06336
Length=511

 Score = 34.3 bits (77),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (57%), Gaps = 3/58 (5%)

Query  11   PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            P +  G+V K G   +SW+ R+LV  GA+L  AY+++ T  +N A   G    + I++
Sbjct  131  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKN-TDEENHAQLLGALTAAHIER  185

>PPTG_14630
Length=398

 Score = 34.3 bits (77),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G  L  +YF S+     GAA+KG  ++ +++
Sbjct  155  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE---DTGAAAKGYGHVKAVE  201

>PITG_02109
Length=522

 Score = 34.3 bits (77),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G  L  +YF S+     GAA+KG  ++ +++
Sbjct  281  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE---DTGAAAKGYGHVRAVE  327

 Score = 31.2 bits (69),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 29/52 (56%), Gaps = 3/52 (6%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G+V K+G   K+W+ R++VL G  L   Y+++ +        KG F + +++
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQL--TYYDT-SKLNPTVKPKGSFQVITVE  186

>PYIR_22246
Length=559

 Score = 34.3 bits (77),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 45/103 (44%), Gaps = 17/103 (17%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+    L++ YF+S+  ++ G   +G+   S++ K               KP G
Sbjct  43   WKKRYCVIYKESLQIVYFQSEADYEKGTI-RGKIPFSTVHKWDG------------KPNG  89

Query  88   FKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNALESAAAMS  130
            F+    + K       ++ ET  +  +WL     A++++   S
Sbjct  90   FQFYTPSNKC----FRVYTETAEEQEQWLAAMQTAIDNSPDKS  128

>PYAR_18690
Length=2455

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 25/135 (19%)

Query  15    EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASK--GEFYLSSI-DKHay  71
             EGY+ KRGH   S R RY VL    L   Y+ ++   +N   S+  G F +  + D H  
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVLVKNVL--TYYLTQEDSRNSDTSQPLGSFRVEIVSDWH--  1193

Query  72    vaggmgavgaQEKPFGFKMVGHAPKKGYTELDIFVETLA--DLTKWLEVAHNAL-----E  124
                  G    Q   FG ++  H  K        F    +  + T+W+   H+ +     E
Sbjct  1194  -----GKTAMQTYEFGMELETHDGKT------FFCAAFSSEEKTQWIRAFHHGIAISRAE  1242

Query  125   SAAAMSRKAAGDGGG  139
             +AA++     GD G 
Sbjct  1243  AAASVPDSTPGDAGA  1257

>SDRG_12776
Length=1184

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (52%), Gaps = 2/54 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDK  68
            EGY+ K+G    +W+  Y VL+G  L  A +ES+  F      K    L ++D+
Sbjct  228  EGYLNKKGDLLAAWKSCYCVLEGKTL--AVYESREDFIADVGLKVRMLLLAVDE  279

>PHYCA_504801
Length=398

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (60%), Gaps = 5/52 (10%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            G++ K G   KSW+ RY VL G  L  +YF S+     GAA+KG  ++ +++
Sbjct  156  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSE---DTGAAAKGYGHVRAVE  202

>PHALS_08097
Length=1069

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            G++TK+G +R++W+ R+ +L      + YF S+
Sbjct  144  GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTSE  176

>H310_00209
Length=1198

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSID  67
            EGY++K+G    +W+  Y VL+G  L +A ++S+  F   A  K    L  ++
Sbjct  261  EGYLSKKGDLLAAWKSCYCVLEG--LTLAIYDSREDFMADAGLKVRVILVDVN  311

>PHYSO_506918
Length=758

 Score = 33.9 bits (76),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9    VRPTSCEGYVTKRG-HFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAAS  57
            V+     G + KRG  +R+ W++R++ LDG  L  AY+E   AF    AS
Sbjct  114  VKAPVVSGSLEKRGFRWRRKWKLRFVELDGRQL--AYYEDSGAFSATTAS  161

>PYIR_15118
Length=1222

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            GY+ K+G F K+WR RY +L      ++Y++S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>PHALS_02608
Length=557

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (43%), Gaps = 25/103 (24%)

Query  28   WRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFG  87
            W+ RY V+   +L++ YF S   F+  A  +G+   SS+                 KP G
Sbjct  42   WKKRYCVIYAGELQIVYFLSLDDFEKRAI-RGKIPFSSVHPWDG------------KPNG  88

Query  88   FKMVGHAPKKGYTELD----IFVETLADLTKWLEVAHNALESA  126
            F+         YT  D    ++ ++  +  KWL+V    L++A
Sbjct  89   FQF--------YTPADNCFRVYTDSAEEQQKWLDVMQQCLDNA  123

>PYAR_25500
Length=473

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (57%), Gaps = 2/37 (5%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAF  51
           EGY+ K+      WR  Y VL+G  L  AY+ES+  F
Sbjct  62  EGYLHKKSEVLSHWRATYCVLEGDTL--AYYESREDF  96

>H310_02933
Length=1053

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            +GY++K+G +RK+W+ RY +L   +  + Y +S+
Sbjct  179  QGYLSKQGSWRKNWKRRYFILRIDEPSLVYCDSE  212

>CCI43456
Length=126

 Score = 32.3 bits (72),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query  5   GVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
            ++ ++  + EG +TKR  + K WR RY +L G  L   YF
Sbjct  11  SIDRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL---YF  48

>PYIW_18911
Length=1196

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            GY+ K+G F K+WR RY +L      ++Y++S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>HYAP_11295
Length=689

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 27/45 (60%), Gaps = 4/45 (9%)

Query  11   PTS---CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            PTS    EG + KRGH  K+WR R+  ++  +LR  Y E+++  +
Sbjct  339  PTSHIHMEGLLLKRGHVNKNWRNRFFRIEKGELRY-YTENQSVLK  382

>H257_01308
Length=897

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L  +Y+ +K
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>HYAP_13267
Length=705

 Score = 33.5 bits (75),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 3/35 (9%)

Query  15  EGYVTKR-GHFRKSWRVRYLVLDGADLRVAYFESK  48
           EG++TKR  H    WR RY +LDG  LR  YF  +
Sbjct  2   EGWLTKRRDHMNLIWRDRYFLLDGNQLR--YFRKR  34

>PHALS_05587
Length=1361

 Score = 33.5 bits (75),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 1/34 (3%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKT  49
            G++ K+GH  KSW+ R+ VL  +D  V Y+++K+
Sbjct  139  GWLKKQGHMWKSWKARFFVL-FSDGTVVYYKNKS  171

>HYAP_08248
Length=784

 Score = 33.5 bits (75),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRV  42
            G +TKRGHF K+W  R+LVL    L+V
Sbjct  84   GALTKRGHFFKAWLPRHLVLSRGALQV  110

>H257_13346
Length=587

 Score = 33.5 bits (75),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYL  63
           G + KRGH RK+W +R+ VL    LR  Y+      ++   S    YL
Sbjct  25  GILLKRGHVRKNWLMRFFVLTSGALR--YYRKPPGSRSTTWSVDPRYL  70

>PHYKE_7856
Length=346

 Score = 33.1 bits (74),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  16  GYVTKRGHFRKSWRVRYLVL  35
           G++TK+GH  KSW+ R+ VL
Sbjct  63  GWLTKQGHMWKSWKTRFFVL  82

>PHALS_06699
Length=884

 Score = 33.5 bits (75),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLR  41
            S  G++ KRGH  K+W+ RY VL  + LR
Sbjct  335  SMSGWLRKRGHVCKNWKDRYFVLHKSVLR  363

>HYAP_09511
Length=1295

 Score = 33.5 bits (75),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (46%), Gaps = 13/83 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            R  + EGY++K+     SW+  Y VL+   +  A++E++  F +     G   L +I+  
Sbjct  238  RDIAFEGYLSKKSDVLVSWKATYCVLEEDTM--AFYETREDFISNMKLIGRIQLQAIEDE  295

Query  70   ayvaggmgavgaQEKPFGFKMVG  92
                         +KP GF+++ 
Sbjct  296  DA-----------DKPNGFRLIA  307

>H310_14473
Length=613

 Score = 33.5 bits (75),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  16  GYVTKRGHFRKSWRVRYLVLDGADLR  41
           G + KRGH RK+W  R+ VL    LR
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR  52

>SPRG_04912
Length=261

 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 5/56 (9%)

Query  11  PTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSI  66
           P    GYV K+G F K+W+ R + L   D  + Y+ S+ A    A  +G F ++S+
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRIMALH--DDTLFYYVSERAM---AKPRGVFRVTSV  88

>CCA19118
Length=125

 Score = 32.0 bits (71),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (10%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYF  45
           EG +TKR  + K WR RY +L G  L   YF
Sbjct  20  EGELTKRSMWMKEWRKRYFILKGNKL---YF  47

>H257_10063
Length=1041

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (71%), Gaps = 0/34 (0%)

Query  15   EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
            +GY++K+G +RK+W+ RY +L   +  + Y +S+
Sbjct  168  QGYLSKQGSWRKNWKHRYFILRIDEPALVYCDSE  201

>PYAP_21902
Length=2550

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 59/141 (42%), Gaps = 25/141 (18%)

Query  45    FESKTAFQNGAASKGEFYLSSIDKHayvaggmgavgaQEKPFGFKMVGHAPKKGYTELDI  104
             FE+    ++ +   GEF L  +D               EK   +K V    +   + +DI
Sbjct  1131  FETLRNVRHASRITGEFGLLLLD-------------VAEKASDWKTVADVAESLRSRVDI  1177

Query  105   FVETLADLTKWLEVAHNALESAA----AMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLK  160
               E L D+T    VA  +L +AA    + + K   D    A      GFS+  +P  QLK
Sbjct  1178  SEEHLKDITTLHAVAMASLGNAAFGGVSSNSKKEQDPLIQAKILRRIGFSSRRNPPLQLK  1237

Query  161   AMSVSKDELLKDALRELEGAK  181
             A++         AL+ELEG K
Sbjct  1238  ALAT--------ALKELEGRK  1250

>PPTG_06823
Length=1321

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 37/83 (45%), Gaps = 13/83 (16%)

Query  10   RPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            R  S EGY++K+     SW+  Y VL+   L  A++E++  F + +   G   L  I+  
Sbjct  244  RDISFEGYLSKKSDVLMSWKATYCVLEEDTL--AFYETREDFISNSKLIGRIQLQGIEDE  301

Query  70   ayvaggmgavgaQEKPFGFKMVG  92
                          KP GF+++ 
Sbjct  302  DMG-----------KPNGFRVIA  313

>PHYKE_2581
Length=683

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 5/53 (9%)

Query  9   VRPTSCEGYVTKRGHFR--KSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
           V+     G + KRG FR  + W+VR++ LDG  L  AY+E   AF    A+ G
Sbjct  48  VKAPVVSGSLEKRG-FRWWRKWKVRFVELDGRHL--AYYEDSGAFSATTATAG  97

>SPRG_15871
Length=101

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (43%), Gaps = 4/61 (7%)

Query  8   VVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF---ESKTAFQNGAASKGEFYLS  64
           V   T  EGY+ KR  + K W   Y VL G  L   Y    E+K   +N     G F  +
Sbjct  28  VAVTTRWEGYLQKRSDWLKQWEAYYFVLHGCALY-CYLSADEAKRQPENSKIKHGAFSFT  86

Query  65  S  65
           S
Sbjct  87  S  87

>PYU1_G009508
Length=328

 Score = 33.1 bits (74),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            GY+ K+G + K+WR RY +L      ++Y++S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>SPRG_01860
Length=674

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 1/34 (3%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L   Y  SK
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSLSY-YISSK  55

>H310_14019
Length=683

 Score = 33.1 bits (74),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 7/47 (15%)

Query  13   SCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            S EG++ KRG   K+W+ RY  L+G +L+  Y E       GA  KG
Sbjct  171  SFEGWLLKRGQRVKNWKRRYFTLNGQELK--YMEGP-----GAKPKG  210

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 0/41 (0%)

Query  12   TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQ  52
            T+CEG++ K+G   K+W+ R+  L G  L     +S  A +
Sbjct  342  TTCEGWLYKQGSLVKNWKKRWFTLLGEVLSYRDMQSSVAIK  382

>H257_00729
Length=121

 Score = 31.6 bits (70),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADL  40
           EG +TKR  + K WR RY VL G  L
Sbjct  13  EGELTKRSVWLKEWRTRYFVLKGNKL  38

>SDRG_07086
Length=656

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 25/57 (44%), Gaps = 4/57 (7%)

Query  12  TSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYF---ESKTAFQNGAASKGEFYLSS  65
           T  EGY+ KR  + K W   Y VL G  L   Y    E+K   +N     G F  +S
Sbjct  33  TRWEGYLQKRSDWLKQWEAYYFVLHGCAL-YCYLSADEAKRQPENSKIKHGAFSFTS  88

>SDRG_06342
Length=1292

 Score = 33.1 bits (74),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query  8    VVRPTSC----EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            VV P++     EG++ KRGH   +W+ R+ VL   D R+ Y+ +
Sbjct  73   VVSPSASTVLKEGWLVKRGHNWHTWKTRWFVL-YRDARLVYYRN  115

>H310_01094
Length=121

 Score = 31.6 bits (70),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADL  40
           EG +TKR  + K WR RY VL G  L
Sbjct  13  EGELTKRSVWLKEWRARYFVLKGNKL  38

>HYAP_09304
Length=1144

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (52%), Gaps = 7/54 (13%)

Query  16   GYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFYLSSIDKH  69
            GY+ K+G F KSWR R+ +L      ++Y+ S        A  GE    +ID+H
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAEEL----AKLGEI---TIDEH  171

>PYU1_G007013
Length=750

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  11   PTS---CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            PTS    EG + KRGH  K+W+ R+  ++  +LR  Y E++   +     KG
Sbjct  404  PTSYIHMEGCLLKRGHVNKNWKNRFFRIEKGELRY-YTENQEELKGSVKLKG  454

>SDRG_08236
Length=864

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (56%), Gaps = 1/34 (3%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L   Y  SK
Sbjct  23  EGYLQKKGQLLKGWKKRWFVCDGRSLSY-YISSK  55

>SPRG_08532
Length=1292

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 5/44 (11%)

Query  8    VVRPTSC----EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFES  47
            VV P++     EG++ KRGH   +W+ R+ VL   D R+ Y+ +
Sbjct  73   VVSPSASTVLKEGWLVKRGHNWHTWKTRWFVL-YRDARLVYYRN  115

>PYAP_17800
Length=780

 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  11   PTS---CEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKG  59
            PTS    EG + KRGH  K+W+ R+  ++  +LR  Y E++   +     KG
Sbjct  434  PTSYIHIEGCLMKRGHVNKNWKNRFFRIEKGELRY-YTENQDQLRGSVPLKG  484

>H257_01309
Length=895

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 2/34 (6%)

Query  15  EGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK  48
           EGY+ K+G   K W+ R+ V DG  L  +YF + 
Sbjct  48  EGYLQKQGQLLKGWKKRWFVCDGRTL--SYFHTN  79

Lambda      K        H        a         alpha
   0.315    0.131    0.369    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 17689382514

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40