Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_181701475351051024800.0
PHYKE_83911475377856118460.0
PHYCA_5561601475364953718460.0
PYIR_134521475364553718420.0
PYAP_177619907562251318080.0
PITG_184521475385655718060.0
HYAP_070951475361356717640.0
PHYSO_3489011475352647117590.0
PHYRA_508551475348944617520.0
PHALS_064811475364452217400.0
PYAR_135699907549444217350.0
PYIW_199721475360946617340.0
H310_085901475364054315730.0
H257_084361475364254115690.0
SPRG_141031475362854015440.0
SDRG_167201475362854015370.0
SPRG_0407412408750947910102e-131
SDRG_144081240875284779941e-128
SDRG_03823114284974515906e-69
SDRG_038221356704944475802e-67
SDRG_150451241574944475541e-63
SDRG_111311368074944475487e-63
H310_144471462305014495453e-62
SPRG_05609114284964545435e-62
CCA23647114284964545417e-62
CCI11048114284964575419e-62
H257_170371462304984495288e-60
PYAP_21882109045024355261e-59
PPTG_09787114284934515224e-59
H257_09722114285184545211e-58
SDRG_12187109044624475152e-58
PHALS_08068109044974735163e-58
HYAP_08763114284734485135e-58
PHYCA_504517114284934515147e-58
PHYSO_254571109044894735121e-57
SPRG_11769109044534465101e-57
PYAR_17512109045334575141e-57
PYAP_234351008029514515283e-57
PHYRA_72037114284934515093e-57
PITG_14083114284934515093e-57
PYIR_17506109045094325104e-57
PHYKE_103271090612004755295e-57
PHYSO_550665114284914525061e-56
PHALS_09136114284934495042e-56
H310_11259114285194524983e-55
PHYCA_7619109044624674847e-54
PYIW_25301109045124314878e-54
PHYKE_6836114284934554813e-53
PPTG_18033109045004694805e-53
PHYRA_71927109044854734795e-53
PITG_13427109044634654769e-53
HYAP_04843109044304194321e-46
PYVX_21517109044824444271e-45
PYIR_23431114284684524093e-43
PYAR_177141008024444473777e-39
PYVX_16175114284464493541e-35
PYAP_226451707615654522663e-23
PYIW_251901648732061772459e-23
CCA22989124014944532581e-22
PYIR_20273124015054582543e-22
PYAR_20075170764694572534e-22
CCI10477124014944532482e-21
SPRG_199431356703432902405e-21
PYVX_21248124015024542412e-20
PHYKE_9680124014984562341e-19
PHYSO_556052124015004582216e-18
PITG_15359124014964592191e-17
PYU1_G014259109042441762091e-17
PYIW_24688114282592502073e-17
HYAP_12621124015014612073e-16
PHYRA_72215124014994352073e-16
PHYCA_123621124014954662055e-16
PHALS_09942124014964631975e-15
SPRG_09825124014924651922e-14
SDRG_06945124014924641913e-14
CCI50816151568074581871e-13
CCA16670151565204651824e-13
PHYRA_7388315665513141824e-13
PYIW_19795151565194571781e-12
PYAR_16840151565364741701e-11
PPTG_13000124013873011681e-11
PHYSO_48941815664713131672e-11
PYU1_G011605151565244591673e-11
PHYCA_50444515665483181647e-11
PPTG_0093815665503141647e-11
SDRG_14446151564954491638e-11
PYVX_20512151565284641621e-10
H257_01186151564964481574e-10
PYIR_1413215665133181575e-10
PYAP_1914815665353131565e-10
PITG_0177815664703131565e-10
PHYKE_980715665573161566e-10
PHYSO_562795151564152971548e-10
PITG_18935150674801911548e-10
SDRG_0506015665593241522e-09
SPRG_1205415665583241522e-09
PYU1_G00569915665503171512e-09
PHYRA_47253151564812991503e-09
PHALS_1202815665791821513e-09
PYIW_2025715665033181494e-09
H310_0764115665483201494e-09
PHALS_10055151565164531485e-09
PITG_19065151564162961476e-09
PPTG_09121151565202971478e-09
PYAP_19280151565124561461e-08
H257_16541124014941921461e-08
SPRG_04114151563762981441e-08
H310_00561151564972981451e-08
PHYCA_555180151565213001432e-08
HYAP_0414915665643231423e-08
PYAR_1666415665771721397e-08
H310_02523124014941921389e-08
H257_0745015665673051389e-08
PYVX_2349915665193141371e-07
PHYKE_2864151564861881371e-07
PYIR_21896151565183041325e-07
CCA1403015665601861245e-06
PPTG_247122910367441071e-05
CCI3999315665501861192e-05
PITG_19802156311851511071e-04
PYU1_G0017371475313328890.014
HYAP_0806965026255108930.016
SPRG_042311241579043800.12
PHYCA_524942105671028171850.24
PYIW_2756812401128112741.3
PYIW_16666105671078149781.6
PHYSO_317690105671057154781.7
PYU1_G000378105671070157772.4
PHYKE_6590105671054153753.8
PHYSO_3260536963722372724.7
PHYSO_5399276072956172745.1
HYAP_136131515642392735.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_18170

Length=510
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_18170                                                            959        0.0   
PHYKE_8391                                                            715        0.0   
PHYCA_556160                                                          715        0.0   
PYIR_13452                                                            714        0.0   
PYAP_17761                                                            701        0.0   
PITG_18452                                                            700        0.0   
HYAP_07095                                                            684        0.0   
PHYSO_348901                                                          682        0.0   
PHYRA_50855                                                           679        0.0   
PHALS_06481                                                           674        0.0   
PYAR_13569                                                            672        0.0   
PYIW_19972                                                            672        0.0   
H310_08590                                                            610        0.0   
H257_08436                                                            608        0.0   
SPRG_14103                                                            599        0.0   
SDRG_16720                                                            596        0.0   
SPRG_04074                                                            393        2e-131
SDRG_14408                                                            387        1e-128
SDRG_03823                                                            231        6e-69 
SDRG_03822                                                            228        2e-67 
SDRG_15045                                                            218        1e-63 
SDRG_11131                                                            215        7e-63 
H310_14447                                                            214        3e-62 
SPRG_05609                                                            213        5e-62 
CCA23647                                                              213        7e-62 
CCI11048                                                              213        9e-62 
H257_17037                                                            207        8e-60 
PYAP_21882                                                            207        1e-59 
PPTG_09787                                                            205        4e-59 
H257_09722                                                            205        1e-58 
SDRG_12187                                                            202        2e-58 
PHALS_08068                                                           203        3e-58 
HYAP_08763                                                            202        5e-58 
PHYCA_504517                                                          202        7e-58 
PHYSO_254571                                                          201        1e-57 
SPRG_11769                                                            201        1e-57 
PYAR_17512                                                            202        1e-57 
PYAP_23435                                                            207        3e-57 
PHYRA_72037                                                           200        3e-57 
PITG_14083                                                            200        3e-57 
PYIR_17506                                                            201        4e-57 
PHYKE_10327                                                           208        5e-57 
PHYSO_550665                                                          199        1e-56 
PHALS_09136                                                           198        2e-56 
H310_11259                                                            196        3e-55 
PHYCA_7619                                                            191        7e-54 
PYIW_25301                                                            192        8e-54 
PHYKE_6836                                                            189        3e-53 
PPTG_18033                                                            189        5e-53 
PHYRA_71927                                                           189        5e-53 
PITG_13427                                                            187        9e-53 
HYAP_04843                                                            171        1e-46 
PYVX_21517                                                            169        1e-45 
PYIR_23431                                                            162        3e-43 
PYAR_17714                                                            149        7e-39 
PYVX_16175                                                            140        1e-35 
PYAP_22645                                                            107        3e-23 
PYIW_25190                                                            99.0       9e-23 
CCA22989                                                              103        1e-22 
PYIR_20273                                                            102        3e-22 
PYAR_20075                                                            102        4e-22 
CCI10477                                                              100        2e-21 
SPRG_19943                                                            97.1       5e-21 
PYVX_21248                                                            97.4       2e-20 
PHYKE_9680                                                            94.7       1e-19 
PHYSO_556052                                                          89.7       6e-18 
PITG_15359                                                            89.0       1e-17 
PYU1_G014259                                                          85.1       1e-17 
PYIW_24688                                                            84.3       3e-17 
HYAP_12621                                                            84.3       3e-16 
PHYRA_72215                                                           84.3       3e-16 
PHYCA_123621                                                          83.6       5e-16 
PHALS_09942                                                           80.5       5e-15 
SPRG_09825                                                            78.6       2e-14 
SDRG_06945                                                            78.2       3e-14 
CCI50816                                                              76.6       1e-13 
CCA16670                                                              74.7       4e-13 
PHYRA_73883                                                           74.7       4e-13 
PYIW_19795                                                            73.2       1e-12 
PYAR_16840                                                            70.1       1e-11 
PPTG_13000                                                            69.3       1e-11 
PHYSO_489418                                                          68.9       2e-11 
PYU1_G011605                                                          68.9       3e-11 
PHYCA_504445                                                          67.8       7e-11 
PPTG_00938                                                            67.8       7e-11 
SDRG_14446                                                            67.4       8e-11 
PYVX_20512                                                            67.0       1e-10 
H257_01186                                                            65.1       4e-10 
PYIR_14132                                                            65.1       5e-10 
PYAP_19148                                                            64.7       5e-10 
PITG_01778                                                            64.7       5e-10 
PHYKE_9807                                                            64.7       6e-10 
PHYSO_562795                                                          63.9       8e-10 
PITG_18935                                                            63.9       8e-10 
SDRG_05060                                                            63.2       2e-09 
SPRG_12054                                                            63.2       2e-09 
PYU1_G005699                                                          62.8       2e-09 
PHYRA_47253                                                           62.4       3e-09 
PHALS_12028                                                           62.8       3e-09 
PYIW_20257                                                            62.0       4e-09 
H310_07641                                                            62.0       4e-09 
PHALS_10055                                                           61.6       5e-09 
PITG_19065                                                            61.2       6e-09 
PPTG_09121                                                            61.2       8e-09 
PYAP_19280                                                            60.8       1e-08 
H257_16541                                                            60.8       1e-08 
SPRG_04114                                                            60.1       1e-08 
H310_00561                                                            60.5       1e-08 
PHYCA_555180                                                          59.7       2e-08 
HYAP_04149                                                            59.3       3e-08 
PYAR_16664                                                            58.2       7e-08 
H310_02523                                                            57.8       9e-08 
H257_07450                                                            57.8       9e-08 
PYVX_23499                                                            57.4       1e-07 
PHYKE_2864                                                            57.4       1e-07 
PYIR_21896                                                            55.5       5e-07 
CCA14030                                                              52.4       5e-06 
PPTG_24712                                                            45.8       1e-05 
CCI39993                                                              50.4       2e-05 
PITG_19802                                                            45.8       1e-04 
PYU1_G001737                                                          38.9       0.014 
HYAP_08069                                                            40.4       0.016 
SPRG_04231                                                            35.4       0.12  
PHYCA_524942                                                          37.4       0.24  
PYIW_27568                                                            33.1       1.3   
PYIW_16666                                                            34.7       1.6   
PHYSO_317690                                                          34.7       1.7   
PYU1_G000378                                                          34.3       2.4   
PHYKE_6590                                                            33.5       3.8   
PHYSO_326053                                                          32.3       4.7   
PHYSO_539927                                                          33.1       5.1   
HYAP_13613                                                            32.7       5.7   

>PYVX_18170
Length=510

 Score = 959 bits (2480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/510 (100%), Positives = 510/510 (100%), Gaps = 0/510 (0%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQVPRPNAASKPQANGEVEASKFGQKVLVLDYVK  60
            MSSPFVWTSNPTAFVGGCDALLDRFRSQVPRPNAASKPQANGEVEASKFGQKVLVLDYVK
Sbjct  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQVPRPNAASKPQANGEVEASKFGQKVLVLDYVK  60

Query  61   PSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAPKFDWSQLASS  120
            PSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAPKFDWSQLASS
Sbjct  61   PSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAPKFDWSQLASS  120

Query  121  VSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggr  180
            VSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGR
Sbjct  121  VSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKPSKTVTTRRVVVAVGGR  180

Query  181  prllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILL  240
            PRLLPCPGGELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILL
Sbjct  181  PRLLPCPGGELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILL  240

Query  241  RGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVL  300
            RGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVL
Sbjct  241  RGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVL  300

Query  301  NATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAG  360
            NATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAG
Sbjct  301  NATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAG  360

Query  361  RLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE  420
            RLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE
Sbjct  361  RLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE  420

Query  421  WALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVS  480
            WALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVS
Sbjct  421  WALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVS  480

Query  481  VVGIHPttaetfttlevtKSSGASAAGGNC  510
            VVGIHPTTAETFTTLEVTKSSGASAAGGNC
Sbjct  481  VVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>PHYKE_8391
Length=778

 Score = 715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/561 (70%), Positives = 439/561 (78%), Gaps = 52/561 (9%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRS-------QVPRPNAASKPQANGEV---------  44
            ++SPFVW+SNP  FVGGCD LL  FRS       Q   P   ++  A+ EV         
Sbjct  219  VTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQGADPAEKAEAAASIEVAESSMTVTE  278

Query  45   ------------------------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTC  74
                                          EA+ FGQKV VLDYVKPSPQGT WGLGGTC
Sbjct  279  TPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  338

Query  75   VNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENA----PKFDWSQLASSVSTYIKTLNF  130
            VNVGCIPKKLMHQS+LIGE MH D+A FGW   +       FDW QL S+V +YIK++NF
Sbjct  339  VNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINF  398

Query  131  KYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggE  190
            KYKV+LR K VKYENFLG+F+DPHT+EL +PRK +K +TTR VVVAVGGRP+ L CPG E
Sbjct  399  KYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAE  458

Query  191  LSITSDDIFW-RKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMAN  249
             +I+SDDIFW +KTAPGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQDMAN
Sbjct  459  YAISSDDIFWMKKTAPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAN  518

Query  250  RIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDV  309
            +IGEYMEV+AGIEFIR+TVP SITKLE+G+LLVKWT  D  + EE FDTVLNATGR+PDV
Sbjct  519  KIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDV  578

Query  310  DKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             KL LDKAGVKLN KTGRI   NEQTSTPNIFAIGDVIDAPELTPVAIQAGR L+RRLYN
Sbjct  579  AKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYN  638

Query  370  NETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRP  429
            N T  MDY+KVCTAVFTPIEYGCCGLSEE+S ERFGEDN+EVYH+NF PLEW+LS ++R 
Sbjct  639  NSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLS-ESRT  697

Query  430  SMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPtta  489
            S  +CY+KVICD TRD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIHPTTA
Sbjct  698  SSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTA  757

Query  490  etfttlevtKSSGASAAGGNC  510
            E FTTLEVTKSSGA+  GG C
Sbjct  758  EAFTTLEVTKSSGATTTGGGC  778

>PHYCA_556160
Length=649

 Score = 715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/537 (71%), Positives = 424/537 (79%), Gaps = 51/537 (9%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRS-------QVPRPNA--------ASKPQANGEVE  45
            ++SPFVW+SNPTAFVGGCD LL  FRS       Q   PN         A  P +   VE
Sbjct  89   VTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQGATPNGSPTEKTAEADVPMSETSVE  148

Query  46   -------------------------------ASKFGQKVLVLDYVKPSPQGTKWGLGGTC  74
                                           A+ FGQKV VLDYVKPSPQGT WGLGGTC
Sbjct  149  ETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTC  208

Query  75   VNVGCIPKKLMHQSALIGEVMHKDAALFGWQFE----NAPKFDWSQLASSVSTYIKTLNF  130
            VNVGCIPKKLMHQS+LIGEV+H D A FGW       NAP F+W QL S+V  YIK++NF
Sbjct  209  VNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGDGNAPTFNWKQLVSNVDGYIKSINF  268

Query  131  KYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggE  190
            KYKV+LR K VKYENFLG+FV+PHT+EL +PRK +K +TTR VV+AVGGRP+ L CPGGE
Sbjct  269  KYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGE  328

Query  191  LSITSDDIFW-RKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMAN  249
             +I+SDDIFW +K  PGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQDMA+
Sbjct  329  HAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMAD  388

Query  250  RIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDV  309
            +IGEYMEV++GIEFIR+TVP SITKLE+G+LLVKWT  DG + EEAFDTVLNATGR+PDV
Sbjct  389  KIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDTVLNATGRDPDV  448

Query  310  DKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             KL LDKAGVKLN K+GRI V NEQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+RRLYN
Sbjct  449  AKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYN  508

Query  370  NETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRP  429
            N T  MDYEKVCTAVFTPIEYGCCG+SEE+S ERFGEDNIEVYH NF PLEW+LS DTR 
Sbjct  509  NSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFGEDNIEVYHTNFVPLEWSLSTDTRT  568

Query  430  SMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +  +CYLKVICDKTRD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIHP
Sbjct  569  AAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHP  625

>PYIR_13452
Length=645

 Score = 714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/537 (73%), Positives = 436/537 (81%), Gaps = 31/537 (6%)

Query  2    SSPFVWTSNPTAFVGGCDALLDRFRSQVPRP-NAASKPQ---------------------  39
            SSPFVW +N   F+GGCD  L  FRS V  P   A+ P                      
Sbjct  112  SSPFVW-ANTRGFIGGCDDTLALFRSGVSAPATLAATPTMVAAAPAPADDAKYDYDLIVI  170

Query  40   --ANGEV----EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
               +G +    EASK+G+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQS+LIGE
Sbjct  171  GGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGE  230

Query  94   VMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDP  153
             +HKDA  FGW       FDWSQ+  SV++YIK++NFKYKV+LRDKKVKYEN LG+FVD 
Sbjct  231  TIHKDAKAFGWTV-GEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDA  289

Query  154  HTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGA  213
            HT+EL +P+K +KTVTTR VV+AVGGRP+ L C GG+L+I+SDDIFWRK APGKTLVVGA
Sbjct  290  HTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGA  349

Query  214  SYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSIT  273
            SYVALECAGF+KG GYDVK+MVRSILLRGFDQDMAN+IGE+ME E+ IEFIR  VP SIT
Sbjct  350  SYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSIT  409

Query  274  KLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333
            KLE G+LLVKW   DG   EEAFDTVLNATGR+PDV KL LDK GVKLNPKTGRI VTNE
Sbjct  410  KLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE  469

Query  334  QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCC  393
            QTSTPNI+AIGDVIDAPELTPVAIQAGRLLARRLYNNET LMDY+KVCTAVFTPIEYGCC
Sbjct  470  QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCC  529

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHY  453
            GLSEE SIE++GE+N+E+YHQNFTPLEW+LS D R +  +CY+KVICD  R+  VVGFHY
Sbjct  530  GLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHY  588

Query  454  LGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGNC  510
            LGPNAGEVTQAIGLAMKLGFTY+QMV+VVGIHPTTAE FTTLEVTKSSG SAA G C
Sbjct  589  LGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645

>PYAP_17761
Length=622

 Score = 701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/513 (72%), Positives = 416/513 (81%), Gaps = 31/513 (6%)

Query  2    SSPFVWTSNPTAFVGGCDALLDRFRSQV-------PRPNAASKPQANGEV----------  44
            SSPFVW SN   F+GGCDA L  FRS V       P  +    P A  E           
Sbjct  89   SSPFVW-SNARGFIGGCDATLAHFRSGVAARPLAGPSASPTMTPVAVDESKTYDYDLVVI  147

Query  45   -----------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
                       EA+K+G+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQSALIGE
Sbjct  148  GGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLMHQSALIGE  207

Query  94   VMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDP  153
            +MHKDA  FGW      KF W+QL  SV+ YIK +NFKYKV+LRDKKVKYENFLG+FVDP
Sbjct  208  LMHKDAGAFGWNM-GEQKFTWTQLVESVNNYIKGINFKYKVELRDKKVKYENFLGSFVDP  266

Query  154  HTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGA  213
            HTIEL + +K +KT+TTR VVVAVGGRPR L CPGGE +I+SDDIFWRKT PGKTLVVGA
Sbjct  267  HTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFWRKTEPGKTLVVGA  326

Query  214  SYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSIT  273
            SYVALECAGFLKG GY+VKVMVRSILLRGFD+DMANRIG++M+ E+ IEFIR  VP SI 
Sbjct  327  SYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESKIEFIRGAVPKSIE  386

Query  274  KLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333
            KLE+G+LLVKW   DG   EE FD+VLNATGR+PDV KL LDKAGV+LNPKTGRI VTNE
Sbjct  387  KLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQLNPKTGRIAVTNE  446

Query  334  QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCC  393
            QTSTPN+FAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDY+KVCTAVFTPIEYGCC
Sbjct  447  QTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKVCTAVFTPIEYGCC  506

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHY  453
            GLSEE + +++GEDN+E+YHQ+F PLEW+LS D R +   CY+KVICDKTRD +VVGFHY
Sbjct  507  GLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQD-RVAANTCYVKVICDKTRDKYVVGFHY  565

Query  454  LGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            LGPNAGEVTQA+GLAMK+GFTY+QMV+VVGIHP
Sbjct  566  LGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHP  598

>PITG_18452
Length=856

 Score = 700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/557 (69%), Positives = 439/557 (79%), Gaps = 57/557 (10%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQV--------------PRPNAASKPQANGEV--  44
            ++SPFVW+S  T FVGGCD LL  FRS +              P P++A  P+ +G +  
Sbjct  89   VTSPFVWSS--TIFVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAPETDGSMPD  146

Query  45   ----------------------------------EASKFGQKVLVLDYVKPSPQGTKWGL  70
                                              EA+ FGQKV VLDYVKPSPQGT WGL
Sbjct  147  VAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGL  206

Query  71   GGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFEN----APKFDWSQLASSVSTYIK  126
            GGTCVNVGCIPKKLMHQS+LIGEV+H D+A FGW   +    AP FDW QL ++V  YI+
Sbjct  207  GGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLVTNVDGYIR  266

Query  127  TLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpc  186
             +NFKYKV+LR K VKYENFLG+F+DPHT+EL +PRK SK +TTR VV+AVGGRPR L  
Sbjct  267  GINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVGGRPRELTI  326

Query  187  pggELSITSDDIFWRKTA-PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQ  245
            PGGE +I+SDDIFW KT  PGKTLVVGASYVALECAGFLKG GYDVKVMVRSILLRGFDQ
Sbjct  327  PGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQ  386

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            DMAN+IGEYMEV++GIEFIR+TVP SITKLE+G+LLVKWT  DG + EEAFD+VLNATGR
Sbjct  387  DMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFDSVLNATGR  446

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365
            +PD+ KL LDKAGVKLN KTGRI V +EQTSTPNI+AIGDVIDAPELTPVAIQAGRLL+R
Sbjct  447  DPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSR  506

Query  366  RLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSD  425
            RLYNN T  MDY+KVCTAVFTPIEYGCCGLSEE+SI+RFG+D IEVYH NF PLEW+LS 
Sbjct  507  RLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFVPLEWSLST  566

Query  426  DTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIH  485
            +TR +  +CY+KVICD+ RD FVVGFHYLGPNAGEVTQA+GLAMKLGFTY+QMV  VGIH
Sbjct  567  ETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIH  626

Query  486  PttaetfttlevtKSSG  502
            PTTAE+FTTLEVTKSSG
Sbjct  627  PTTAESFTTLEVTKSSG  643

>HYAP_07095
Length=613

 Score = 684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/567 (65%), Positives = 433/567 (76%), Gaps = 57/567 (10%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRSQV----------------------PRPNAASKP  38
            ++SPFVW SNPT FVGGCD LL  FRS +                      P  + AS  
Sbjct  47   VTSPFVWISNPTTFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASAS  106

Query  39   QANGEV------------------------------EASKFGQKVLVLDYVKPSPQGTKW  68
            + N                                 EA+ FG+KV VLDYVKPSP GT W
Sbjct  107  ELNESRTPPIVVEDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSW  166

Query  69   GLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENA----PKFDWSQLASSVSTY  124
            GLGGTCVNVGCIPKKLMHQS+LIGE++H D A FGW   +     P FDW QL S+VS+Y
Sbjct  167  GLGGTCVNVGCIPKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSY  226

Query  125  IKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprll  184
            IK+++FKYKV+LR K+VKYEN LG+FVDPHT++L +P+K +K +TTR VV+AVGGRPR L
Sbjct  227  IKSISFKYKVELRSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQL  286

Query  185  pcpggELSITSDDIFWRKTA-PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGF  243
             C GGEL+++SDDIFW K   PGKTLVVGASYVALECAGFLKG GY VKVMVRSILLRGF
Sbjct  287  ACLGGELAVSSDDIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGF  346

Query  244  DQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNAT  303
            DQDMA++IGEYME+++GIEFIR+TVP SITKL+ G+LLVKW   DG   EE FDTVLNAT
Sbjct  347  DQDMASKIGEYMEMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNAT  406

Query  304  GRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLL  363
            GR+PDV KL LD+AGVKLN KTGRI V NEQT+TPN++AIGDVIDAPELTPVAIQAGRLL
Sbjct  407  GRDPDVAKLGLDEAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLL  466

Query  364  ARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWAL  423
            +RRLYN  T  MDY+K+CTAVFTPIEYGCCGLSEE+S E +G+D++EVYH+NF PLEW+L
Sbjct  467  SRRLYNEGTVQMDYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSL  526

Query  424  SDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVG  483
            ++ TR +  +CY+KV+CDKTR+ FV+GFHYLGPNAGEVTQA+GLAMKLGFTY+Q+V  VG
Sbjct  527  AEQTRIAAESCYVKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVG  586

Query  484  IHPttaetfttlevtKSSGASAAGGNC  510
            IHPTTAE FTTLE TKSSG S  GG C
Sbjct  587  IHPTTAEAFTTLETTKSSGDSTTGGGC  613

>PHYSO_348901
Length=526

 Score = 682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/471 (78%), Positives = 411/471 (87%), Gaps = 5/471 (1%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA+ FGQKV VLDYVKPSPQGT WGLGGTCVNVGCIPKKLMHQS+LIGE+MH D+A FGW
Sbjct  56   EAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGELMHHDSANFGW  115

Query  105  QFENA----PKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSN  160
               +A      F W QL ++V  YI+ +NFKYKV+LR K VKYENFLG+FVD HT+EL +
Sbjct  116  NIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYVKYENFLGSFVDAHTLELWH  175

Query  161  prkpsktvttrrvvvavggrprllpcpggELSITSDDIFW-RKTAPGKTLVVGASYVALE  219
            PRK +K +TTR VV+AVGGRP+ L CPGGE +I+SDDIFW +K  PGKTLVVGASYVALE
Sbjct  176  PRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALE  235

Query  220  CAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGK  279
            CAGFLKG GYDVKVMVRSILLRGFDQDMAN+IGEYMEV++GIEFIR+TVP SITKLE+G+
Sbjct  236  CAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQ  295

Query  280  LLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPN  339
            LLVKWT  DG + EEAFDTVLNATGR+PDV KL LDKA VKLN KTGRI V NEQTSTPN
Sbjct  296  LLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVKLNEKTGRIWVKNEQTSTPN  355

Query  340  IFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            I+AIGDVIDAPELTPVAIQAGRLL+RRLYNN T  MDY+K+CTAVFTPIEYGCCGLSEE+
Sbjct  356  IYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKICTAVFTPIEYGCCGLSEED  415

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            S ER+GEDNIEVYH+NF PLEW+LS++TR +  +CYLKVICDKTRD FVVGFHYLGPNAG
Sbjct  416  SKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVICDKTRDKFVVGFHYLGPNAG  475

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGNC  510
            EVTQA+GLAMKLGFTY+QMV  VGIHPTTAETFTTLE+TKSSG +  GG C
Sbjct  476  EVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKSSGGTTTGGGC  526

>PHYRA_50855
Length=489

 Score = 679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/446 (78%), Positives = 391/446 (88%), Gaps = 5/446 (1%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA+ FG+KV VLDYVKPSPQGT WGLGGTCVNVGCIPKKLMHQS+LIGEVMH D+A FGW
Sbjct  21   EAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVMHHDSANFGW  80

Query  105  QFEN---APKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNp  161
               +   AP F+W QL S+V  YIK++NFKYKV+LR K VKYENFLG+FVDPHT+EL + 
Sbjct  81   NVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVKYENFLGSFVDPHTLELWHH  140

Query  162  rkpsktvttrrvvvavggrprllpcpggELSITSDDIFW-RKTAPGKTLVVGASYVALEC  220
            RK +K +TTR VV+AVGGRP+ L CPGGE +I+SDDIFW +K  PGKTLVVGASYVALEC
Sbjct  141  RKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALEC  200

Query  221  AGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKL  280
            AGFLKG GY+VKVMVRSILLRGFDQDMAN+IGEYMEV++GIEFIR+TVP SIT LE+G+L
Sbjct  201  AGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITTLENGQL  260

Query  281  LVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNI  340
            LVKWT  DG + EEAFDTVLNATGR+PDV KL LDKAGVKLN K+GRI V NEQTST NI
Sbjct  261  LVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKLNEKSGRIWVKNEQTSTSNI  320

Query  341  FAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEES  400
            +A+GDVIDAPELTPVAIQAGRLL+RRLYNN T  MDYEKVCTAVFTPIEYGCCGLSEE+S
Sbjct  321  YALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVCTAVFTPIEYGCCGLSEEDS  380

Query  401  IERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGE  460
             ERFGEDN+EVYH NF PLEW+LS +TR S  +CY+KVICDKTRD FVVGFHYLGPNAGE
Sbjct  381  KERFGEDNVEVYHTNFVPLEWSLS-ETRTSAESCYVKVICDKTRDKFVVGFHYLGPNAGE  439

Query  461  VTQAIGLAMKLGFTYEQMVSVVGIHP  486
            VTQA+GLAMKLGFTY+QMV  VGIHP
Sbjct  440  VTQAMGLAMKLGFTYDQMVDTVGIHP  465

>PHALS_06481
Length=644

 Score = 674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/522 (67%), Positives = 411/522 (79%), Gaps = 36/522 (7%)

Query  1    MSSPFVWTSNPTAFVGGCDALLDRFRS--QVPRPNAASKPQANGEV--------------  44
            ++SPFVW+SNPT FVGGCD LL  FRS   V RP          E+              
Sbjct  99   VTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQEKPIFDYD  158

Query  45   ---------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSA  89
                           EA+ FGQKV VLDYVKPSPQGT WGLGGTCVNVGCIPKKL+HQS+
Sbjct  159  LVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIPKKLIHQSS  218

Query  90   LIGEVMHKDAALFGWQFEN----APKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYEN  145
            LIGE++  D+A FGW+F+N     P FDW QL ++V  YIKT+NFKYKV LR K VKYEN
Sbjct  219  LIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLRSKNVKYEN  278

Query  146  FLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRK-TA  204
            FLG+FVDPHT++LS+PRK +K +TTR VV+AVG RPR L CPGGE +++SDDIFW K   
Sbjct  279  FLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDDIFWMKEKE  338

Query  205  PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFI  264
            PGKTLV+GASYVALECAGFLKG GY+VKVMVRSILLR FDQ+MA++IGEYMEV++GI+FI
Sbjct  339  PGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYMEVQSGIKFI  398

Query  265  RETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324
            R+TVP SI++LE+ +LLVKW    G   EEAF+TVLNATGR+P+V  L LDKAGVKLN K
Sbjct  399  RKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDKAGVKLNEK  458

Query  325  TGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAV  384
            TGRI+V NEQTST NI+AIGDV+DAPELTPVAIQ+GRLL++RLYNN +  MDY+KVCT V
Sbjct  459  TGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMDYDKVCTTV  518

Query  385  FTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTR  444
            FTPIEYGCCGLSEE S  R+GEDNIE+YH NF PLEW+LS +TR +  +CY+KV+CDK+R
Sbjct  519  FTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYIKVVCDKSR  578

Query  445  DLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            D FV+GFHYLGPNAGEV QA+GLAM+L FTY+QMV+ VGIHP
Sbjct  579  DKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHP  620

>PYAR_13569
Length=494

 Score = 672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/442 (79%), Positives = 392/442 (89%), Gaps = 2/442 (0%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA+K G+KV+VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQSAL+GE+MHKDA  FGW
Sbjct  31   EAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLMHQSALLGELMHKDAPAFGW  90

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkp  164
                A  F W+QL +SV+ YIK +NFKYKV+LRDKKVKYENFLG+FVD HTIEL + +KP
Sbjct  91   T-TGAQSFTWTQLVASVNNYIKGINFKYKVELRDKKVKYENFLGSFVDAHTIELWHHKKP  149

Query  165  sktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFL  224
            +KTVTTR VV+AVGGRPR L CPGGE +I+SDDIFWRKT PGKTLVVGASYVALECAGFL
Sbjct  150  AKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIFWRKTEPGKTLVVGASYVALECAGFL  209

Query  225  KGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKW  284
            KG GYDVK+MVRSILLRGFDQDMANRIG++M+ E+ IEFIR  VP SI K E+GKLLVKW
Sbjct  210  KGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDESRIEFIRGVVPKSIEKQENGKLLVKW  269

Query  285  TLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIG  344
              PDG   EE FDTVLNATGR+PDV KL LDKAGV+LNPK+GRI  TNEQTSTPNIFAIG
Sbjct  270  NSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGVELNPKSGRIAQTNEQTSTPNIFAIG  329

Query  345  DVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERF  404
            DVIDAPELTPVAIQAGRLLARRLYNNETTLMDY+K+CTAVFTPIEYGCCGLSEE++  ++
Sbjct  330  DVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKICTAVFTPIEYGCCGLSEEDAKAKY  389

Query  405  GEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQA  464
            GE+N+E+YHQ+F PLEW+LS++ R + A CY+KVICDKTRD  VVGFHYLGPNAGEVTQA
Sbjct  390  GEENLEIYHQSFMPLEWSLSEE-RVAAATCYVKVICDKTRDKHVVGFHYLGPNAGEVTQA  448

Query  465  IGLAMKLGFTYEQMVSVVGIHP  486
            +GLAMK+GFTY+QMV+VVGIHP
Sbjct  449  MGLAMKVGFTYDQMVNVVGIHP  470

>PYIW_19972
Length=609

 Score = 672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/466 (79%), Positives = 410/466 (88%), Gaps = 2/466 (0%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA+K+G+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQS+LIGE +HKDAA FGW
Sbjct  146  EAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGW  205

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkp  164
                  KFDW+Q+  SV++YIK++NFKYKV+LRDKKVKYEN LG+FVD HT+EL +P+K 
Sbjct  206  SV-GEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  264

Query  165  sktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFL  224
            +KTVTTR VV+AVGGRP+ L C GGEL+I+SDDIFWRK APGKTLV+GASYVALECAGF+
Sbjct  265  TKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFM  324

Query  225  KGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKW  284
            KG GYDVK+MVRSILLRGFDQDMA++IGE+MEVE+ IEFIR  VP SITKLE G+LLVKW
Sbjct  325  KGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKW  384

Query  285  TLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIG  344
               DG   EEAFDTVLNATGR+PDV KL LD  GV+LNPKTGRI VTNEQTS PNIFAIG
Sbjct  385  VSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIG  444

Query  345  DVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERF  404
            DVIDAPELTPVAIQAGR+LARRLYNNET LMDY+KVCTAVFTPIEYGCCGLSEE SIE+F
Sbjct  445  DVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKF  504

Query  405  GEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQA  464
            GED +E+YHQNFTPLEW+LS D R +  +CY+KVICD TR+  VVGFHYLGPNAGEVTQA
Sbjct  505  GEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQA  563

Query  465  IGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGNC  510
            IGLAMKLGFTY+ MV+VVGIHPTTAE FTTLEVTKSSG SAA G C
Sbjct  564  IGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609

>H310_08590
Length=640

 Score = 610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/543 (61%), Positives = 384/543 (71%), Gaps = 41/543 (8%)

Query  2    SSPFVW--TSNPTAFVGGCDALLDRFRSQVPR-PNAASKPQANGEV--------------  44
            SSPF +    +   FVGGCD  L  FR++    P+  +   AN  V              
Sbjct  105  SSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDTSSSDETQYDWD  164

Query  45   ---------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSA  89
                           EASK GQKVLVLDYVKPSP G+ WGLGGTCVNVGCIPKKLMHQS+
Sbjct  165  LVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSS  224

Query  90   LIGEVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGA  149
            +IGE++HKDA  FGW   NA  FDW++L SSV  YI  LNFKY++DLRDKKVKYEN LG 
Sbjct  225  IIGELLHKDAEQFGWTVSNA-SFDWTKLVSSVQDYIHGLNFKYRIDLRDKKVKYENMLGT  283

Query  150  FVDPHTIELSNprkpsktvttrrvvvavggrprllpcpgg--ELSITSDDIFWRKTAPGK  207
            F D HT+ L+N  K             +    R  P      E +I+SDDIF +  APGK
Sbjct  284  FKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDDIFSKAEAPGK  343

Query  208  TLVVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRET  267
            TLVVGASYVALECAGFLKGQG+DV +MVRSILLRGFDQD+A RIGEYME E+GI FI+E+
Sbjct  344  TLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMENESGIAFIKES  403

Query  268  VPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGR  327
            VP+SI KL +G+L V  T  +G      +DTVLNATGR+PDV  L L  AGV LNPK+GR
Sbjct  404  VPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAAGVTLNPKSGR  458

Query  328  ILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTP  387
            I VTNEQTSTP+I+AIGDVIDAPELTPVAIQAG+LLARRL+ N T LMDY K+CTAVFTP
Sbjct  459  IDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDYTKICTAVFTP  518

Query  388  IEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLF  447
            +EYGCCGLSEE++I   G DNI+VYHQNFTPLEW+LS + RP    CY K+I D T+   
Sbjct  519  VEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHE-RPLAKECYAKLIVDTTQQKR  577

Query  448  VVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAG  507
            VVGFHYLGPNAGEVTQAIG+AMKL  TY+  V+ VGIHPTTAE FTTLE+TK SG  A+ 
Sbjct  578  VVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEITKESGEDASA  637

Query  508  GNC  510
              C
Sbjct  638  SGC  640

>H257_08436
Length=642

 Score = 608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/541 (60%), Positives = 387/541 (72%), Gaps = 39/541 (7%)

Query  2    SSPFVW--TSNPTAFVGGCDALLDRFRSQVPRPNAA--------SKPQANGEV-------  44
            SSPF +    +   FVGGCD  L  FR++     +A        +   ++ +V       
Sbjct  109  SSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSDADVKYDWDLV  168

Query  45   -------------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALI  91
                         EASK GQKVLVLDYVKPSP G+ WGLGGTCVNVGCIPKKLMHQS++I
Sbjct  169  VIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSII  228

Query  92   GEVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFV  151
            GE++HKDA  FGW   NA  FDWS+L SSV  YI  LNFKY+VDLRDKKVKYEN LG F 
Sbjct  229  GEILHKDADQFGWSVSNA-TFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKYENMLGTFK  287

Query  152  DPHTIELSNprkpsktvttrrvvvavggrprllpcpgg--ELSITSDDIFWRKTAPGKTL  209
            D HT+ L+N  K             +    R  P      E +++SDDIF +  APGKTL
Sbjct  288  DAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSKPDAPGKTL  347

Query  210  VVGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVP  269
            VVGASYVALECAGFLKGQG+DV +MVRSILLRGFDQD+A RIGEYME E+GI FI+E+VP
Sbjct  348  VVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGIAFIKESVP  407

Query  270  SSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRIL  329
            +SI KLE+G+  V  T       ++ +DT+LNATGR+PDV KL LD AGV LNPK+GRI 
Sbjct  408  TSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGVALNPKSGRIH  462

Query  330  VTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIE  389
            V NEQTSTPNI+A+GDVIDAPELTPVAIQAG+LL+RRL+ N TTLMDY K+CTAVFTP+E
Sbjct  463  VVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKICTAVFTPVE  522

Query  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVV  449
            YGCCGLSEE++I   G +N+EVYHQNFTPLEW+LS D RP    CY K+I D T+   V+
Sbjct  523  YGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHD-RPLAKECYAKLIVDTTQQKRVL  581

Query  450  GFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGN  509
            GFHYLGPNAGEVTQAIG+A+KL  TY+  ++ VGIHPTTAE FTTLE+TK SG  A+   
Sbjct  582  GFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESGVDASASG  641

Query  510  C  510
            C
Sbjct  642  C  642

>SPRG_14103
Length=628

 Score = 599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/540 (63%), Positives = 397/540 (74%), Gaps = 38/540 (7%)

Query  2    SSPFVWTSNP--TAFVGGCDALLDRFRSQVPRPNAASKPQAN------------------  41
            +SPF +  +   T FVGGCD  L  FRS+     A S P  N                  
Sbjct  96   TSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVV  155

Query  42   ---------GEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIG  92
                        EA+K+GQKVLVLDYVKPSPQG+ WGLGGTCVNVGCIPKKLMHQSA++G
Sbjct  156  IGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMG  215

Query  93   EVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVD  152
            E++HKDA  FGW   NA  FDW++L +SV  YI  LNFKY+VDLRDKKVKYENFLG F D
Sbjct  216  ELLHKDAEAFGWAVPNA-TFDWTKLVTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKD  274

Query  153  PHTIELSNprkps--ktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLV  210
             HT+ L+NP K    K VT RR ++AVGGRP+ L CPG +L+I+SDDIF R T PGKTLV
Sbjct  275  AHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLV  334

Query  211  VGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPS  270
            VGASYVALECAGFLK QG+DV VMVRSILLRGFD DMA RIG YME EA I+FI+  VP+
Sbjct  335  VGASYVALECAGFLKAQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPT  394

Query  271  SITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV  330
            SI +L +G+L V  T  +G      +DTVLNATGRNPDV  L L  AGV LNPKTGRI V
Sbjct  395  SIEQLANGQLKVTHTFGEG-----IYDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAV  449

Query  331  TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEY  390
            T+EQTS P+I+A+GDVID PELTPVAIQAGRLLA+RL++N  TLM Y+KVCTAVFTPIEY
Sbjct  450  THEQTSAPHIYAVGDVIDGPELTPVAIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEY  509

Query  391  GCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVG  450
            GCCGLSE+ +IE  G DN+ VYHQ+FTPLEW+LS D R     CY K+I D+T++  VVG
Sbjct  510  GCCGLSEDAAIETIGADNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVG  568

Query  451  FHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGNC  510
            FHYLGPNAGEVTQA+G+AMKL  +Y+  VS VGIHPTTAE FTTLE+TK SG  A+   C
Sbjct  569  FHYLGPNAGEVTQAVGIAMKLNASYDDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/540 (63%), Positives = 397/540 (74%), Gaps = 38/540 (7%)

Query  2    SSPFVWTSNP--TAFVGGCDALLDRFRSQVPRPNAASKPQAN------------------  41
            +SPF +  +   T FVGGCD  L  FRS+     A S P  N                  
Sbjct  96   TSPFCYLEDGAGTKFVGGCDDTLAFFRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVV  155

Query  42   ---------GEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIG  92
                        EA+K+GQKVLVLDYVKPSPQG+ WGLGGTCVNVGCIPKKLMHQSA++G
Sbjct  156  IGGGSGGLAASKEAAKYGQKVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMG  215

Query  93   EVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVD  152
            E++HKDA  FGW   NA  FDW++L +SV  YI  LNFKY+VDLRDKKVKYENFLG F D
Sbjct  216  ELLHKDAEAFGWAVPNA-TFDWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKD  274

Query  153  PHTIELSNprkps--ktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLV  210
             HT+ L+NP K    K VT RR ++AVGGRP+ L CPG +L+I+SDDIF R T PGKTLV
Sbjct  275  AHTLTLTNPAKGKPPKDVTFRRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLV  334

Query  211  VGASYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPS  270
            VGASYVALECAGFLKGQG+DV VMVRSILLRGFD DMA RIG YME EA I FI+  VP+
Sbjct  335  VGASYVALECAGFLKGQGFDVTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPT  394

Query  271  SITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV  330
            SI +L +G+L V  T  +G      +DTVLNATGR PDV  L L  AGV LNPKTGRI V
Sbjct  395  SIEQLPNGQLKVTHTFGEG-----IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAV  449

Query  331  TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEY  390
            T+EQTSTP+I+A+GDVID PELTPVAIQAGRLL++RL++N  TLM Y+KVCTAVFTPIEY
Sbjct  450  THEQTSTPHIYAVGDVIDGPELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEY  509

Query  391  GCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVG  450
            GCCGLSE+ ++E  G DN+ VYHQ+FTPLEW+LS D R     CY K+I D+T++  VVG
Sbjct  510  GCCGLSEDAAVEAIGADNLGVYHQSFTPLEWSLSHD-RALAKECYCKLIVDRTQNDRVVG  568

Query  451  FHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGASAAGGNC  510
            FHYLGPNAGEVTQA+G+A+KL  +YE  VS VGIHPTTAE FTTLE+TK SG  A+   C
Sbjct  569  FHYLGPNAGEVTQAVGIAIKLNASYEDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 228/479 (48%), Positives = 295/479 (62%), Gaps = 24/479 (5%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA++ G KV + D+VKP+  GTKWGLGGTCVNVGC+PKK+MH S ++G  +H DAA  GW
Sbjct  23   EAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIMHYSGILGAGLH-DAAHLGW  81

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI--ELSNpr  162
            Q     + +W  L  +V  ++K LNF Y+V LR  KV+Y N L  F DPHT+  ++ N  
Sbjct  82   QVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQYINALARFEDPHTLSYQVKNGP  141

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              + T     +                E +ITSDD+F   TAPGKTLVVG SY+ALECAG
Sbjct  142  TQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLFSLSTAPGKTLVVGGSYIALECAG  201

Query  223  FLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLE-DGKLL  281
            FL    Y   V VRSILLRGFD+ +A +I + M V  G++F   T+P+SI K E  G+L 
Sbjct  202  FLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VAQGMDFRFNTLPTSIVKDEATGQLH  260

Query  282  VKWTLPDGSNHE---EAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTP  338
            V  +  +   HE   EAFDTVL A GR  D   + L+KAGVK  P  G+    NE T+ P
Sbjct  261  V--SFANSETHETFTEAFDTVLYAVGRTADTFNIGLEKAGVKALPN-GKFETVNEATNVP  317

Query  339  NIFAIGDVIDA-PELTPVAIQAGRLLARRLYN-NETTLMDYEKVCTAVFTPIEYGCCGLS  396
            +I A+GDV+   PELTPVAI+AG  L RRL+  N T  M+Y+ + T VFTP+EYG  GLS
Sbjct  318  HIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYDLIPTTVFTPVEYGTIGLS  377

Query  397  EEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSM-----------ANCYLKVICDKTRD  445
            EEE+I R+G+D+I VY   F  LEW      +              ANC  K++C K+ +
Sbjct  378  EEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQEGDYDTEFPANCLSKLVCQKSAN  437

Query  446  LFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGAS  504
              V+GFH++GPNAGEVTQ   +A+ +G T E   +V+GIHPT AE+F  L VTK SGAS
Sbjct  438  EKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPTDAESFMALTVTKESGAS  496

>SDRG_14408
Length=528

 Score = 387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 223/477 (47%), Positives = 292/477 (61%), Gaps = 20/477 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
            EA++ G KV + D+VKP+  GTKWGLGGTCVNVGC+PKK+MH S ++G  +H DAA  GW
Sbjct  42   EAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIMHYSGILGAGLH-DAAHLGW  100

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI--ELSNpr  162
            Q     + +W  L  +V  ++K LNF Y+V LR  KV+Y N L  F DPHT+  ++ N  
Sbjct  101  QLPEKVEHNWETLVETVQAHVKKLNFSYRVGLRSNKVQYINALARFEDPHTLSYQIKNGP  160

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              + T     +               GE +ITSDD+F   TAPGKTLVVG SY+ALECAG
Sbjct  161  TQTLTAAHILIATGGRPTVPKEIPGVGEYAITSDDLFSLTTAPGKTLVVGGSYIALECAG  220

Query  223  FLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLE-DGKLL  281
            FL    Y   V VRSILLRGFD+ +A +I + M V  G++F   T+P+SI K +  G+L 
Sbjct  221  FLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VAQGMDFRFNTLPTSIVKDDATGQLH  279

Query  282  VKWTLPD-GSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNI  340
            V +   +      E FDTVL A GR  D   + L+K GVK  P  G+    NE T+ P+I
Sbjct  280  VSFANSETNETFTEVFDTVLYAVGRTADTFNIGLEKVGVKALPN-GKFETVNEATNVPHI  338

Query  341  FAIGDVIDA-PELTPVAIQAGRLLARRLYN-NETTLMDYEKVCTAVFTPIEYGCCGLSEE  398
             A+GDV+   PELTPVAI+AG  L RRL+  N T  M+Y+ + T VFTP+EYG  GLSEE
Sbjct  339  HAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYDLIPTTVFTPVEYGTIGLSEE  398

Query  399  ESIERFGEDNIEVYHQNFTPLEWALSDDTRPSM-----------ANCYLKVICDKTRDLF  447
            E+I R+G+D++ VY   F  LEW      +              ANC  K++C K+ +  
Sbjct  399  EAIARYGKDDVVVYPWEFQTLEWGAVHRQKAESAQEGDYDTEFPANCLSKLVCQKSANEK  458

Query  448  VVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPttaetfttlevtKSSGAS  504
            V+GFH++GPNAGEVTQ   +A+ +G T E   +V+GIHPT AE+F  L VTK SGAS
Sbjct  459  VLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPTDAESFMALTVTKESGAS  515

>SDRG_03823
Length=497

 Score = 231 bits (590),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 157/451 (35%), Positives = 237/451 (53%), Gaps = 25/451 (6%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G KVLV++    +      G+GGTCVNVGC+PKK+M  +A+  E++H   A   +
Sbjct  24   RAAAYGAKVLVIERGHANDGA---GMGGTCVNVGCVPKKVMFNAAMHAEMLHSAHA---Y  77

Query  105  QFENAP-----KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
             F+N        FDW+ L      Y+  LN  Y+ +L + K+        FVD HTIE++
Sbjct  78   TFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPLIYGAAKFVDNHTIEVN  137

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
              R  +K +      V        +     E +I+SD  F  +T P K  VVGA Y+A+E
Sbjct  138  GDRYTAKHILIAVGGVPAMPPLPGI-----EHAISSDGFFALETQPRKVAVVGAGYIAVE  192

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  V  R + +LR FD  + + +   ME  AG+ F+RE+  +SI K EDG
Sbjct  193  LAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVRFVRESGITSIEKAEDG  251

Query  279  KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTP  338
             L ++ T+   +     F+TVL A GR P    L L+   + L+P     +   E T+ P
Sbjct  252  TLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALSPDQFIQVDAQENTTVP  311

Query  339  NIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCCGLS  396
            N+ A+GDV     ELTPVAI AGR LA RL+ NE    ++Y ++ T VF+    G  GL+
Sbjct  312  NVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLT  371

Query  397  EEESIERFGEDNIEVYHQNFTPLEWALSD-DTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            E ++IE++G  N++VY   F  + +A+S+ D +   A   +K++C    +  V+G H  G
Sbjct  372  EPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQKTA---MKLMCIGEEET-VIGVHVAG  427

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+A+K+G       ++V IHP
Sbjct  428  LGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  458

>SDRG_03822
Length=494

 Score = 228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/447 (34%), Positives = 232/447 (52%), Gaps = 17/447 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A  +G KVLV++  + +      GLGGTCVNVGC+PKK+M  +AL  E++H  +  A  
Sbjct  21   RAVAYGAKVLVIERGQANDGA---GLGGTCVNVGCVPKKIMFNAALHAEMLHSARAYAFK  77

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G Q      FDW+ + +    Y+K LN  Y   + + KV        FVD HT+E++  R
Sbjct  78   GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLVMGAAKFVDNHTVEVNGDR  137

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +K +      V        +     E +I+SD  F  +T P K  VVGA Y+A+E AG
Sbjct  138  YAAKHILIAVGGVPAMPPLPGI-----EHAISSDGFFALETQPRKVAVVGAGYIAVELAG  192

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  V  R + +LR FD  + + +   ME  AG+ F+RE+  +SI K EDG L 
Sbjct  193  IFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVRFVRESGITSIEKAEDGTLT  251

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIF  341
            ++ T+   +     F+TVL A GR P    L L+   + L+P     +   E T+ PN+ 
Sbjct  252  IQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALSPDQFIQVDAQENTTVPNVH  311

Query  342  AIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            A+GDV     ELTPVAI AGR LA RL+ NE    ++Y ++ T VF+    G  GL+E +
Sbjct  312  AVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQIPTVVFSHPPIGTIGLTEPQ  371

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            ++ ++G  N+  +  +F+ + +A+S +         +K++C    +  VVG H  G  A 
Sbjct  372  AVAQYGAHNVTTHTSSFSNMFYAMSAEK--DKVQTAMKLVCIGVEET-VVGVHVAGLGAD  428

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            E+ Q  G+A+K+G       ++V IHP
Sbjct  429  EMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_15045
Length=494

 Score = 218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 150/447 (34%), Positives = 230/447 (51%), Gaps = 17/447 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A  +G KVLV++  +   +    GLGGTCVNVGC+PKK+M  +AL  E++H  +  A  
Sbjct  21   RAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFNAALHAEMLHSARAYAFK  77

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G        FDW+ + +    Y+  LN  Y   + + KV        FVD HTIE++  R
Sbjct  78   GVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLVMGAAKFVDNHTIEVNGER  137

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +K +      V        +     E +I+SD  F  +T P K  VVGA Y+A+E AG
Sbjct  138  YTAKHILIAVGGVPALPPIPGI-----EHAISSDGFFALETQPRKVAVVGAGYIAVELAG  192

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   +  V  R + +LR FD  + + +   ME  AG++F+RE+  ++I K  DG L 
Sbjct  193  IFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQFVRESGINAIEKAGDGTLT  251

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIF  341
            ++ T+         F+TVL A GR P    L L+   + L+ +    +   E T+ PN++
Sbjct  252  LQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALSTEKFIQVDAQENTTVPNVY  311

Query  342  AIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            AIGDV     ELTPVAI AGR LA RL+ NE    ++Y ++ T VF+    G  GL+E +
Sbjct  312  AIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIPTVVFSHPPIGTIGLTEPQ  371

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            +IE++G  N+  +  +F+ + +A+  +         +K++C    +  VVG H  G  A 
Sbjct  372  AIEQYGAHNVTTHTSSFSNMFYAMCAEK--DKVQTAMKLVCIGVEEA-VVGVHVAGLGAD  428

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            E+ Q  G+A+K+G       ++V IHP
Sbjct  429  EMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>SDRG_11131
Length=494

 Score = 215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 229/447 (51%), Gaps = 17/447 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A  +G KVLV++  +   +    GLGGTCVNVGC+PKK+M  +AL  E++H  +  A  
Sbjct  21   RAVAYGAKVLVVERGR---ENDGAGLGGTCVNVGCVPKKIMFNAALHAEMLHSARAYAFK  77

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G        FDW+ + +    Y+  LN  Y   + + KV        FVD HTIE++  R
Sbjct  78   GVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLVMGAAKFVDNHTIEVNGER  137

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +K +      V        +     E +I+SD  F  +T P K  VVGA Y+A+E AG
Sbjct  138  YTAKHILIAVGGVPALPPIPGI-----EHAISSDGFFALETQPRKVAVVGAGYIAVELAG  192

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   +  V  R + +LR FD  + + +   ME  AG++F+RE+  ++I K  DG L 
Sbjct  193  IFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQFVRESGINAIEKAGDGTLT  251

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIF  341
            ++ T+         F+TVL A GR P    L L+   + L+ +    +   E T+ PN++
Sbjct  252  LQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALSTEKFIQVDAQENTTVPNVY  311

Query  342  AIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            AIGDV     ELTPVAI AGR LA RL+ NE    ++Y ++ T VF+    G  GL+E +
Sbjct  312  AIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIPTVVFSHPPIGTIGLTEAQ  371

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            +I ++G  N+  +  +F+ + +A+  +         +K++C    +  VVG H  G  A 
Sbjct  372  AIAQYGAHNVTTHTSSFSNMFYAMCAEK--DKVQTAMKLVCIGVEEA-VVGVHVAGLGAD  428

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            E+ Q  G+A+K+G       ++V IHP
Sbjct  429  EMIQGFGVAVKMGAYKSDFDNIVAIHP  455

>H310_14447
Length=501

 Score = 214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 145/449 (32%), Positives = 231/449 (51%), Gaps = 20/449 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A ++G KVLV++  + +      G+GGTCVNVGC+PKK+M+ + +  E++H  KD +  
Sbjct  26   RAVEYGAKVLVIERGRVNGGA---GMGGTCVNVGCVPKKIMYNAGVHAEILHSAKDYSFK  82

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
                     FDW+ + +    Y+  L+  Y+  L ++ + +      FVD HT+E++  R
Sbjct  83   DVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHVIGAAVFVDDHTVEVNGQR  142

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +  +      +        +     E +++SD  F   T P K  VVGA Y+A+E AG
Sbjct  143  YTAPHILIAVGGMPQMPNIPGI-----EHAVSSDGFFDLPTQPKKVAVVGAGYIAVELAG  197

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  V  R + +LR FD  + + + + M  +AG+ F+      SI K  DG L 
Sbjct  198  IFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGVAFVTHAHLESIRKEADGSLT  256

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIF  341
            V   + + +N    FD +++A GR P    + LDK  V+L+     ++   E T+   ++
Sbjct  257  VVAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVELSDDGFVVVDAQENTTVDGVY  316

Query  342  AIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            AIGDV     ELTPVAI AGR LA RL+  ET   + Y ++ T VF+    G  GL+E +
Sbjct  317  AIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYHQIPTVVFSHPPIGTIGLTEPD  376

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDT--RPSMANCYLKVICDKTRDLFVVGFHYLGPN  457
            +I ++G DN+ VY   F+ + +AL+  +  +P  A   +K++C    +  V+G H  G  
Sbjct  377  AIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTA---MKLVCIGVEET-VIGAHVAGLG  432

Query  458  AGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            A E+ Q  G+A+KLG       +VV IHP
Sbjct  433  ADEMIQGFGVAIKLGAYKSDFDNVVAIHP  461

>SPRG_05609
Length=496

 Score = 213 bits (543),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 235/454 (52%), Gaps = 31/454 (7%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G KVL+++    +      G+GGTCVNVGC+PKK+M  +AL  E++H   A   +
Sbjct  23   RAAAYGAKVLLIERGHANDGA---GMGGTCVNVGCVPKKIMFNAALHAEMLHSAHA---Y  76

Query  105  QFENAP-----KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
             F+N        FDW+ L      Y+  LN  Y+ +L + ++        FVD HT+E++
Sbjct  77   TFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLVYGAAKFVDNHTVEVN  136

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
              R  +K +      V        +     E +I+SD  F  +T P K  VVGA Y+A+E
Sbjct  137  GDRYTAKHILIAVGGVPAMPPLPGI-----EHAISSDGFFALETQPRKVAVVGAGYIAVE  191

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  +  R + +LR FD  + + +   ME  AG+ F+RE+  +SI K  DG
Sbjct  192  LAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGVHFVRESGITSIEKAVDG  250

Query  279  KLLVKWTLPDGSNHEEAF---DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQT  335
                     DG    ++F   +TVL A GR P    L L+   + L+      +   E T
Sbjct  251  ---YADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDIALSADKFIQVDAQENT  307

Query  336  STPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCC  393
            S PN++A+GDV     ELTPVAI AGR LA RL+ NE    ++Y ++ T VF+    G  
Sbjct  308  SVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINYHQIPTVVFSHPPIGTI  367

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSD-DTRPSMANCYLKVICDKTRDLFVVGFH  452
            GL+E ++I ++G +N++VY  +F  + +A+S+ D +   A   +K+IC    +  VVG H
Sbjct  368  GLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA---MKLICIGEEET-VVGVH  423

Query  453  YLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              G  A E+ Q  G+A+K+G       ++V IHP
Sbjct  424  VAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  457

>CCA23647
Length=496

 Score = 213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 232/454 (51%), Gaps = 24/454 (5%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHK--DAAL--  101
            A+ +G KVL+++  +   +    G GGTCVN GC+PKK+M+ +A   E + +  D ++  
Sbjct  24   AATYGAKVLLIERHR---EYEGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSIRP  80

Query  102  FGWQFENAPKF-----DWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI  156
            F  + + +  F     DW ++      YI+ LN  Y  +L + K+     +   +    +
Sbjct  81   FASKGDTSHSFSFGDFDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIAKDRV  140

Query  157  ELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYV  216
            +++             V                E +I SD  F  +T P K  VVGA Y+
Sbjct  141  QVNQDSFFEGKHILIAVGGTPAMPSIPGI----EHAIDSDGFFKLETQPKKVAVVGAGYI  196

Query  217  ALECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKL  275
            A+E AG       D  +  R   +LR FD  + + + E ME + G+ F+R++    I K 
Sbjct  197  AVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEKIVKS  255

Query  276  EDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQ  334
            ED KL +   + D S     FD ++ A GR+P    L L+  GV+LN +TG I+V   E 
Sbjct  256  EDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELN-ETGHIIVDAQEN  314

Query  335  TSTPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGC  392
            TS P ++A+GDV     ELTPVAI AGR LA RL+NNE    + Y ++ T VF+    G 
Sbjct  315  TSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHPPLGT  374

Query  393  CGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFH  452
             G +E E+I ++GE+N++ Y   F  L +++++D       C +K++C  +++  VVG H
Sbjct  375  IGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTC-MKLVCVGSKET-VVGLH  432

Query  453  YLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              G  A E+ Q  G+AMK+G T     ++V IHP
Sbjct  433  VAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>CCI11048
Length=496

 Score = 213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 230/457 (50%), Gaps = 30/457 (7%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL------------IGE  93
            A+ +G KVL+++  +   +    G GGTCVN GC+PKK+M+ +A             I  
Sbjct  24   AATYGAKVLLIERHR---EYDGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSIRP  80

Query  94   VMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDP  153
               K+ A   + F +   FDW ++ +    YI+ LN  Y  +L + K+     +   +  
Sbjct  81   FTSKECASHSFSFGD---FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIAK  137

Query  154  HTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGA  213
              ++++             V                E +I SD  F  +T P K  VVGA
Sbjct  138  DRVQVNQDSVYEGKHILIAVGGTPAMPSLPGI----EHAIDSDGFFKLETQPKKVAVVGA  193

Query  214  SYVALECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSI  272
             Y+A+E AG       D  V  R   +LR FD  + + + E ME + G+ F+R++    I
Sbjct  194  GYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKD-GVNFVRKSHLEKI  252

Query  273  TKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-T  331
            TK +D KL +   + + +     FD ++ A GR+P    L L++ GV LN +TG I+V  
Sbjct  253  TKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALN-ETGHIIVDA  311

Query  332  NEQTSTPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIE  389
             E TS P ++A+GDV     ELTPVAI AGR LA RL+NNE    + Y ++ T VF+   
Sbjct  312  QENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHPP  371

Query  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVV  449
             G  G +E E+I ++GE+N++ Y   F  L +++++D         +K++C  +++  VV
Sbjct  372  LGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTA-MKLVCVGSKET-VV  429

Query  450  GFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G H  G  A E+ Q  G+AMK+G T     ++V IHP
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHP  466

>H257_17037
Length=498

 Score = 207 bits (528),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 143/449 (32%), Positives = 229/449 (51%), Gaps = 20/449 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A ++G KVLV++  + +      G+GGTCVNVGC+PKK+M+ +    E++H  KD +  
Sbjct  25   RAVEYGAKVLVIERGRANGGA---GMGGTCVNVGCVPKKIMYNAGFHAEILHSAKDYSFK  81

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
                     FDW+ + +    Y+  L   Y+  L ++ + +      FVD HT+E++  R
Sbjct  82   EVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEVNGLR  141

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +  +      V        +     E +I+SD  F   T P K  VVGA Y+A+E AG
Sbjct  142  FTAPHILIAVGGVPQLPTIPGI-----EHAISSDGFFDLPTQPKKVAVVGAGYIAVELAG  196

Query  223  FLKGQGYDVKVMVRS-ILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  V  R   +LR FD  + + + + M  ++G+ F+ ++   SI K  DG L 
Sbjct  197  IFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEADGTLT  255

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIF  341
            +  T+ D       F+ +++A GR P    + LDK  V+L+     ++   E T+ P ++
Sbjct  256  IVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTTVPGVY  315

Query  342  AIGD-VIDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            AIGD  I   ELTPVAI AGR LA RL+ +E    + Y ++ T +F+    G  GL+E E
Sbjct  316  AIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIGLTEPE  375

Query  400  SIERFGEDNIEVYHQNFTPLEWALSD--DTRPSMANCYLKVICDKTRDLFVVGFHYLGPN  457
            +I ++G+ N+  Y  +F+ L ++L    D +P  A   +K++C    +  VVG H  G  
Sbjct  376  AIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTA---MKLVCIGVEET-VVGAHVAGLG  431

Query  458  AGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            A E+ Q  G+A+K+G       ++V IHP
Sbjct  432  ADEMIQGFGVAIKMGAYKSDFDNIVAIHP  460

>PYAP_21882
Length=502

 Score = 207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 215/435 (49%), Gaps = 32/435 (7%)

Query  70   LGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAP--------KFDWSQLASSV  121
            LGGTCVNVGC+PKK+M+ +A +G  +H+D  LF + FE+          +F W +L    
Sbjct  65   LGGTCVNVGCVPKKIMYLAANLGHTLHRD--LFHYGFESTKGEHLAHETQFHWKKLKERR  122

Query  122  STYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrp  181
              Y+  LN  Y  +L + KV        F     +E+      +K V        +    
Sbjct  123  DAYVLRLNGIYGRNLDNSKVDLFRGTATFNAKGNVEVDGKEIAAKNVLIAVGGKPLIPDI  182

Query  182  rllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LL  240
                    E  I SD  F  +  P K  VVGA Y+A+E AG L G G D  +  R   +L
Sbjct  183  PGK-----EHCIDSDGFFELEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVL  237

Query  241  RGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG-KLLVKWTLPDGSNHEEAFDTV  299
            RGFD+ +   + + M  E G+     +  + + K  DG K LV   L DGS H   FD+V
Sbjct  238  RGFDELIRTTLHDAMAKE-GVNLRPHSSVTKVIKAADGTKTLV---LADGSEHS-GFDSV  292

Query  300  LNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTP--NIFAIGDVIDAPELTPVAI  357
            + A GR P  + L L+ AG++ +   G I +   Q +T   NIFA+GDV   P LTPVAI
Sbjct  293  IYAAGRVPLTESLNLEAAGIETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAI  351

Query  358  QAGRLLARRLYNN-ETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNF  416
             AGR LA RL+   +     YE + T VF+    G  GL+E+ +  +FG+D I+VY   F
Sbjct  352  AAGRRLADRLFGGMKDAKASYENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRF  411

Query  417  TPLEWAL-----SDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKL  471
              + + +      D  +       +K++C + +D  VVG H +G  A E+ Q  G+A+K+
Sbjct  412  VNMHYGIINEFGEDGQQKPKPMTAMKLVC-QGKDEKVVGVHIIGMAADEMLQGFGVAVKM  470

Query  472  GFTYEQMVSVVGIHP  486
            G T     S V IHP
Sbjct  471  GATKADFDSCVAIHP  485

>PPTG_09787
Length=493

 Score = 205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 153/451 (34%), Positives = 224/451 (50%), Gaps = 26/451 (6%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQ  105
            A+ FG KVLV   V+   +    GLGGTCVN GC+PKK+M  +A   E ++++     + 
Sbjct  25   AATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNTAAHVEHLNRNK---DYS  78

Query  106  FENAPK------FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
               A K      FDW  + +    YIK LN  Y+ +L + KV +   +   V    IE++
Sbjct  79   INTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKVDHVQGIAKLVAKDKIEVA  138

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
                  K V      V        +     E  I SD  F  +  P K  VVGA Y+A+E
Sbjct  139  GQVYTGKHVLVAPGGVPTIPDLPGM-----EHVIDSDGFFKLEQQPKKVAVVGAGYIAVE  193

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  +  R   +LR FD  + + + E ME +AG++F+R +    + K E+G
Sbjct  194  LAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KAGVKFVRNSRAVRVEKQENG  252

Query  279  KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTST  337
            KL    T+         FDT++ A GR P    L L++ GVKL+ + G I V   E TS 
Sbjct  253  KLTFVVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEIGVKLS-EGGFIEVDAQENTSV  311

Query  338  PNIFAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGL  395
            P ++AIGD  +   ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G  G 
Sbjct  312  PGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGY  371

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +E E+I ++GE+NI+VY   F  L  +++D  R       L  + +K     VVG H  G
Sbjct  372  TEPEAIAKYGEENIKVYTSKFVNLLHSMADPERKGKTAMKLVTVGEKET---VVGVHVAG  428

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+A+K+  T     ++V IHP
Sbjct  429  EGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>H257_09722
Length=518

 Score = 205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 145/454 (32%), Positives = 227/454 (50%), Gaps = 26/454 (6%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A+ +G  VLV++  +   QG   GLGGTCVNVGC+PKK+M+ +A   E++H  K  A  
Sbjct  45   RAASYGANVLVIE--RGREQGGA-GLGGTCVNVGCVPKKVMYNAAFHAEILHSAKAYAFK  101

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G Q      FDW+ + +   +Y+  L+  Y+ +L    +   +   +FVD HTI +    
Sbjct  102  GVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITLVSGRASFVDNHTIAVDGAT  161

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +  +      V        +     E +I+SD  F  +T P K  V+GA Y+A+E AG
Sbjct  162  FTAPHILVAVGGVPQLPSIPGI-----EHAISSDGFFGLETQPKKVAVIGAGYIAVELAG  216

Query  223  FLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   +  V  R   +LR FD  + + + + M   +G++F+  +   SI K  DG L 
Sbjct  217  IFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGVQFVPHSGVQSIRKEPDGTLT  275

Query  282  VKWTLPDGSNHE------EAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQT  335
            ++ TL     H         FD ++ A GR P      ++   +  N K    +   E T
Sbjct  276  IEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-MEHTTIIRNEKGFIEVDGQENT  334

Query  336  STPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCC  393
            S P ++AIGDV +   ELTPVAI AGR LA RL+  E    + Y ++ T VF+    G  
Sbjct  335  SVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPDACLHYHQIPTVVFSHPPIGTV  394

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWA-LSDDTRPSMANCYLKVICDKTRDLFVVGFH  452
            G +E +++ +FG  N++VY  +F  L ++ L+ + +P  A   +K+IC    +  VVG H
Sbjct  395  GYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENKPKTA---MKLICVGKEET-VVGMH  450

Query  453  YLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              G  A E+ Q  G+A+K+G     + ++V IHP
Sbjct  451  VAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHP  484

>SDRG_12187
Length=462

 Score = 202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 224/447 (50%), Gaps = 25/447 (6%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G+KVLV++         +  LGGTCVNVGC+PKK+M+ +A +   M  DA  +G+
Sbjct  22   RAATYGKKVLVVE---------RGRLGGTCVNVGCVPKKVMYAAADLAHSMRHDAPAYGF  72

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkp  164
                    DW+ L      Y+  LN  Y  +L+   V +   L +F     +++      
Sbjct  73   PAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFAQGLCSFGSDGRVQID---AT  129

Query  165  sktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFL  224
                    V+VAVGG+P +   PG E  I+SD  F     P +  VVGA Y+A+E AG L
Sbjct  130  PLDAEATNVLVAVGGQPVMPDIPGIEHCISSDGFFELDERPARVAVVGAGYIAVELAGVL  189

Query  225  KGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK-LEDGKLLV  282
            +G G D  +  R   +LR FD DM   +        GI     +  + + K    G L V
Sbjct  190  RGLGSDTTIFCRQQGVLRSFD-DMLQAVLHDAFQRDGITLQPHSTIARVDKDPTTGSLSV  248

Query  283  KWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFA  342
              T      H   FD VL ATGR P    L L+  G++L+P     +   + TS P +FA
Sbjct  249  TTT---AGEHHSGFDCVLVATGRTPMTKDLGLEHRGIQLSPNGFIPVDAYQATSAPGVFA  305

Query  343  IGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTAVFTPIEYGCCGLSEEESI  401
            +GDV+D   LTPVAI AGR LA RL+        DY  + + VF+    G  GL+E+E+ 
Sbjct  306  LGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADYTNIPSVVFSHPPIGTIGLTEQEAR  365

Query  402  ERFGEDNIEVYHQNFTPLEWALSDDT--RPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            + + +D ++VY   F  + ++L +    +P+ A   +K+IC    +  +VG H +G  A 
Sbjct  366  KVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTA---MKLICVGPSEK-IVGLHVIGRGAD  421

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            E+ Q  G+A+K+G   + + + + IHP
Sbjct  422  EMLQGFGVAIKMGACKKDLDACIAIHP  448

>PHALS_08068
Length=497

 Score = 203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 149/473 (32%), Positives = 235/473 (50%), Gaps = 44/473 (9%)

Query  34   AASKPQANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
            A S   A+    AS  G +V +++  +         LGGTCVNVGC+PKKLM+ +A +  
Sbjct  31   AGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLMYIAADMNH  81

Query  94   VMHKDAALFGWQ-------FENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENF  146
             +H D   +G++         +   F+WS+L +    Y+  LN  Y+ +L + KV     
Sbjct  82   KLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLANSKVDLIRG  141

Query  147  LGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPG  206
               F +   +E+ +    +K +        +            EL I SD  F  +T P 
Sbjct  142  SAKFNERGNVEVDDKEVRAKKILIAVGGRPLIPDIPGK-----ELCIDSDGFFELETLPT  196

Query  207  KTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIR  265
            K  +VGA Y+A+E AG L   G    V  R   +LR FD  +   + E M  + G+    
Sbjct  197  KVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAMAND-GVHLRP  255

Query  266  ETVPSSITKLEDG-KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324
             +  + + +  DG K LV   L +GS H   FD V+ ATGR P    L L+KAG+  +  
Sbjct  256  NSTVARVKEAADGTKTLV---LTNGSEHR-GFDVVICATGRVPLTSTLNLEKAGITTD-D  310

Query  325  TGRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCT  382
             G I V   ++T+  N++A+GDV + P LTPVAI AGR L+ RL+   +   + YE + T
Sbjct  311  NGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAKLSYENIPT  370

Query  383  AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDT---------RPSMAN  433
             +F+    G  GL+EE + +++G++NI+VY   F  + + L ++T         +P  A 
Sbjct  371  VIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVPKEKPKTA-  429

Query  434  CYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              +K++C   ++  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  430  --MKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  479

>HYAP_08763
Length=473

 Score = 202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 145/448 (32%), Positives = 226/448 (50%), Gaps = 20/448 (4%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A+ +G KVLV++  +   Q    GLGGTCVN GC+PKK+M  +A   E ++  KD ++ 
Sbjct  6    RAATYGAKVLVIERGR---QYDGMGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAKDYSIH  62

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
              +F     FDWS++ +    YI  L   Y+ +L + +V +   +  FV  + +++++  
Sbjct  63   TAEFAFG-DFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVAKNKVQVADRV  121

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
               K V      V +      +        I SDD F  +  P K  VVGA Y+A+E AG
Sbjct  122  FTGKHVLIAPGGVPLKPDLPGINHV-----IDSDDFFRLEQQPQKVAVVGAGYIAVEMAG  176

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  +  R   +LR F+  + + + E ME +AG+ F+R      + K  DGKL 
Sbjct  177  IFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVGVEKQLDGKLT  235

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTSTPNI  340
            +   + +       FDT+L A GR P  + L L+  GVKL  + G I V   E TS P +
Sbjct  236  LVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVDAQENTSVPGV  294

Query  341  FAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGLSEE  398
            +AIGD  +   ELTPVAI AGR LA RL+  E    ++Y ++ + +F+    G  G +E 
Sbjct  295  YAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHPPIGTIGYTEP  354

Query  399  ESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNA  458
            E++ ++GE+N++VY   F  L  +++D          L  + ++     VVG H  G  A
Sbjct  355  EAVAKYGEENVKVYTSKFVNLLHSMADPEHKGKTAMKLVTVGEQET---VVGVHVAGEGA  411

Query  459  GEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             E+ Q  G+A+K+  T     ++V IHP
Sbjct  412  DEMIQGFGVAVKMNATKADFDNIVAIHP  439

>PHYCA_504517
Length=493

 Score = 202 bits (514),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 150/451 (33%), Positives = 226/451 (50%), Gaps = 26/451 (6%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKD------A  99
            A+ +G KVLV   V+   +    GLGGTCVN GC+PKK+M  +A   E ++++       
Sbjct  25   AATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNTAAHVEHLNRNKDYSINT  81

Query  100  ALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
            A   +QF +   FDW+ +      YIK LN  Y+ +L +  V +   +   V    I++ 
Sbjct  82   ADKEFQFGD---FDWNNMKIKRDAYIKRLNGIYERNLGNANVDHVQGIAKLVAKDKIQVG  138

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
            +     K V      V        +     E  I SD  F  +  P K  VVGA Y+A+E
Sbjct  139  DKVYTGKHVLVAPGGVPSVPDLPGM-----ENVIDSDGFFKLEQQPKKVAVVGAGYIAVE  193

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  +  R   +LR FD  + + + E ME +AG++F+R    + + K ++G
Sbjct  194  MAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVKFVRNMRAARVEKQDNG  252

Query  279  KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTST  337
            KL    T+         FDT+L A GR P    L L++ GVKL+ + G I V   E TS 
Sbjct  253  KLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVGVKLS-EGGFIEVDAQENTSV  311

Query  338  PNIFAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGL  395
            P ++AIGD  +   ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G  G 
Sbjct  312  PGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGY  371

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +E E++E++GE+N++VY   F  L  +++D  R       L  + +K     VVG H  G
Sbjct  372  TEPEAVEKYGEENVKVYTSKFVNLLHSMADPERKGKTAMKLVTVGEKET---VVGVHVAG  428

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+A+K+  T     ++V IHP
Sbjct  429  EGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PHYSO_254571
Length=489

 Score = 201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 157/473 (33%), Positives = 228/473 (48%), Gaps = 44/473 (9%)

Query  34   AASKPQANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
            A S   A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +  
Sbjct  23   AGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLMFIAADMSH  73

Query  94   VMHKDAALFGWQFENA-------PKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENF  146
             +H D   +G++ E           FDW +L +    Y+  LN  Y+ +L + KV     
Sbjct  74   KLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLANSKVALIRG  133

Query  147  LGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPG  206
               F D   +E+      +K V        +            EL I SD  F  +T P 
Sbjct  134  SAKFNDKGNVEVDGKEILAKNVMIAVGGKPLIPDIPGK-----ELCIDSDGFFELETLPK  188

Query  207  KTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIR  265
            K  VVGA Y+A+E AG L   G D  +  R   +LR FD D+     E    + G+    
Sbjct  189  KVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAMAKDGVHLRP  247

Query  266  ETVPSSITKLEDG-KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324
             +  + + K +DG K LV   L DGS +   +D V+ A GR P    L LDKAGV  + K
Sbjct  248  HSNIARVEKADDGTKTLV---LADGSEY-SGYDVVIYAAGRVPLTSNLQLDKAGVDTD-K  302

Query  325  TGRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCT  382
             G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+   +   + YE + T
Sbjct  303  NGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAKVSYENIPT  362

Query  383  AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDT---------RPSMAN  433
             VF+    G  GL+EE++  ++G+D I+VY   F  + + L ++          +P  A 
Sbjct  363  VVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMDEATGEPKDKPKTA-  421

Query  434  CYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              +K++C   ++  VVG H +G  A E+ Q  G+A+K+G T     + V IHP
Sbjct  422  --MKLVC-AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCVAIHP  471

>SPRG_11769
Length=453

 Score = 201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 147/446 (33%), Positives = 223/446 (50%), Gaps = 32/446 (7%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G+KVLV++         +  LGGTCVNVGC+PKK+M+ +A +   M  DA  +G+
Sbjct  22   RAATYGKKVLVVE---------RGRLGGTCVNVGCVPKKVMYAAADLAHSMRHDAPAYGF  72

Query  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkp  164
                    DW+ L      Y+  LN  Y  +L+   V + + L +F              
Sbjct  73   PAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFAHGLCSF-------------G  119

Query  165  sktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFL  224
            S        +VAVGG+P +   PG E  I+SD  F     P +  VVGA Y+A+E AG L
Sbjct  120  SDGRRGDERLVAVGGQPVMPDIPGIEHCISSDGFFELDERPARVAVVGAGYIAVELAGVL  179

Query  225  KGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVK  283
            +G G D  +  R   +LR FD DM   +        GI     +  + + K++     + 
Sbjct  180  RGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGITLQPHSTVARVDKVDPATGTLS  238

Query  284  WTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAI  343
             T   G  H   FD VL ATGR P    L L+  G++L+P     +   + TS P +FA+
Sbjct  239  LTTTAGDYHT-GFDCVLVATGRTPMTKHLGLEHRGIELSPNGFIPVDAYQATSAPGVFAL  297

Query  344  GDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTAVFTPIEYGCCGLSEEESIE  402
            GDV++   LTPVAI AGR LA RL+        DY  + + VF+    G  GL+E+E+ +
Sbjct  298  GDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTSIPSVVFSHPPIGTIGLTEQEARK  357

Query  403  RFGEDNIEVYHQNFTPLEWALSDDT--RPSMANCYLKVICDKTRDLFVVGFHYLGPNAGE  460
             + ED I+VY   F  + ++L +    +P+ A   +K+IC    +  +VG H +G  A E
Sbjct  358  VYREDEIKVYSSKFVNMHYSLYEHAHEKPTTA---MKLICVGPTEK-IVGLHVIGRGADE  413

Query  461  VTQAIGLAMKLGFTYEQMVSVVGIHP  486
            + Q  G+A+K+G   + + + + IHP
Sbjct  414  MLQGFGVAIKMGACKKDLDACIAIHP  439

>PYAR_17512
Length=533

 Score = 202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/457 (33%), Positives = 227/457 (50%), Gaps = 49/457 (11%)

Query  70   LGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFE---------NAPKFDWSQLASS  120
            LGGTCVNVGC+PKK+M+ +A +G ++H+D  LF + FE         +  +F W++L   
Sbjct  68   LGGTCVNVGCVPKKIMYLAANMGHLLHRD--LFHYGFETKRGGGHLIDETQFHWNKLKER  125

Query  121  VSTYIKTLNFKYKVDLRDKKVKYENFLGAF-------VDPHTIELSNprkpsktvttrrv  173
               Y+  LN  Y+ +L + KV+       F       VD   I   N           + 
Sbjct  126  RDAYVLRLNGIYERNLGNSKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQG  185

Query  174  vvavggrprllpcpg--------------gELSITSDDIFWRKTAPGKTLVVGASYVALE  219
             V V G+                       E  I SD  F  +  P K  VVGA Y+A+E
Sbjct  186  NVEVDGKEISAKNVLIAVGGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVE  245

Query  220  CAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG L G G D  +  R   +LRGFD+ + + + + M+ + G++    ++ + +TK  DG
Sbjct  246  LAGVLHGLGSDTTIFCRKDGVLRGFDELIRSTLHDAMDKD-GLKLRPHSLVAKVTKQADG  304

Query  279  -KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTST  337
             K LV   L DG+ H   FDTV+ A GR P    L L+ AGV+ + + G I +   Q +T
Sbjct  305  TKTLV---LQDGTEHA-GFDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTT  359

Query  338  P--NIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTAVFTPIEYGCCG  394
               NIFA+GDV   P LTPVAI AGR L+ RL+   +   M YE + T VF+    G  G
Sbjct  360  AKKNIFAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVG  419

Query  395  LSEEESIERFGEDNIEVYHQNFTPLEWAL-----SDDTRPSMANCYLKVICDKTRDLFVV  449
            L+E+E+  + G+D ++VY   F  + + +     +D  +       +K++C   ++  VV
Sbjct  420  LTEKEARAKHGDDAVKVYSSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVC-VGKEEKVV  478

Query  450  GFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G H +G  A E+ Q  G+A+K+G T     S V IHP
Sbjct  479  GVHLIGMAADEILQGFGVAVKMGATKADFDSCVAIHP  515

>PYAP_23435
Length=951

 Score = 207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/451 (33%), Positives = 218/451 (48%), Gaps = 24/451 (5%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G KVL+++  +        GLGGTCVN GC+PKK+M  +A   E + ++     +
Sbjct  488  RAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFNAAAHVEHLARNG---DY  541

Query  105  QFENAPK------FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIEL  158
                APK      FDW+ + +    YI  LN  Y+ ++ +  +     +   V  + IE+
Sbjct  542  SINTAPKAFEFGDFDWANMKTKRDAYILRLNGIYERNVGNAGIDLVQGVATLVSSNQIEV  601

Query  159  SNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVAL  218
                   K V      V        +     E +I SD  F  ++ P K  VVGA Y+A+
Sbjct  602  DGKVFTGKHVLVAVGGVPAMPAIPGI-----EHAIDSDGFFKLESQPKKVAVVGAGYIAV  656

Query  219  ECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLED  277
            E AG       +  +  R   +LR FD  + + + E ME + G+ F+R +    I K  D
Sbjct  657  EIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEME-KHGVNFVRRSRIEKIEKQAD  715

Query  278  GKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTST  337
            GKL +   +       E FD VL A GR P    L LDKAGVKLN      +   E TS 
Sbjct  716  GKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGVKLNDGGFIEVDAQENTSV  775

Query  338  PNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TTLMDYEKVCTAVFTPIEYGCCGL  395
            P ++AIGD      ELTPVAI AGR LA RL+ NE    + Y ++ T VF+    G  G 
Sbjct  776  PGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLHYHQIPTVVFSHPPLGTIGY  835

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +E E++ +FG D ++VY   F  L  +++D    +     +K++C    D  VVG H  G
Sbjct  836  TEPEAVAKFGADKVKVYTSKFVNLLHSMADPE--NKGKTAMKLVC-VGDDEVVVGLHVAG  892

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+AMK+  T     ++V IHP
Sbjct  893  EGADEMVQGFGVAMKMNATKADFDNIVAIHP  923

>PHYRA_72037
Length=493

 Score = 200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 217/451 (48%), Gaps = 24/451 (5%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104
             A+ +G KVLV   V+   +    GLGGTCVN GC+PKK+M  +A   E +H++     +
Sbjct  24   RAATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNAAAHVEHLHRNE---DY  77

Query  105  QFENAPK------FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIEL  158
              + A +      FDW+ +      YI  LN  Y+ +L + KV +   +   V    +E+
Sbjct  78   SIKTATRDFAFGDFDWANMKKKRDAYILRLNGIYERNLGNAKVDHVQGIATLVAKDQVEV  137

Query  159  SNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVAL  218
            +      K V      V        +     E    SD  F  +  P K  VVGA Y+A+
Sbjct  138  AGKVYTGKHVLVAPGGVPFVPDLPGM-----EHVTDSDGFFRLEQQPKKVAVVGAGYIAV  192

Query  219  ECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLED  277
            E AG       D  +  R   +LR FD  + + + + ME +AG++F+R T    + K +D
Sbjct  193  ELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-KAGVKFVRNTRAVRVDKQDD  251

Query  278  GKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTST  337
            GKL    T+         FD +L A GR P    L L+K GVKL       +   E TS 
Sbjct  252  GKLTFVVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEKVGVKLADGGFIEVDAQENTSV  311

Query  338  PNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGL  395
            P ++AIGD      ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G  G 
Sbjct  312  PGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGY  371

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +E E++ +FGE+N++VY   F  L  +++D  R       L  + ++     VVG H  G
Sbjct  372  TEPEAVAKFGEENVKVYSSKFVNLLHSMADPERKGKTAMKLVTVGEQET---VVGVHVAG  428

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+A+K+  T     ++V IHP
Sbjct  429  EGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PITG_14083
Length=493

 Score = 200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/451 (33%), Positives = 222/451 (49%), Gaps = 26/451 (6%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQ  105
            A+ +G KVLV   V+   +    GLGGTCVN GC+PKK+M  +A   E ++++     + 
Sbjct  25   AATYGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNAAAHVEHLNRNK---DYS  78

Query  106  FENAPK------FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
               A K      FDW+ + +    YIK LN  Y+ +L + KV +   +   V    IE++
Sbjct  79   INTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDHVQGIAKLVAKDKIEVA  138

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
                  K V               +     E  I SD  F  +  P K  VVGA Y+A+E
Sbjct  139  GQVYTGKHVLVAPGGTPTVPDLPGM-----EHVIDSDGFFKLEQQPKKVAVVGAGYIAVE  193

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  +  R   +LR FD  + + + E ME +AG+ F+R +    + K ++G
Sbjct  194  LAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVNFVRNSRAVRVEKQDNG  252

Query  279  KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTST  337
            KL    T+         FD+++ A GR+P    L L++ GVKL  + G I V   E TS 
Sbjct  253  KLTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL-AEGGFIEVDAQENTSV  311

Query  338  PNIFAIGDV-IDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGL  395
              ++AIGD  +   ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G  G 
Sbjct  312  AGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIGY  371

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +E E+I ++GE+N++VY   F  L  +++D  R       L  + DK     VVG H  G
Sbjct  372  TEPEAIAKYGEENVKVYSSKFVNLIHSMADPERKGKTAMKLVTVGDKET---VVGVHVAG  428

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              A E+ Q  G+A+K+  T     ++V IHP
Sbjct  429  EGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PYIR_17506
Length=509

 Score = 201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 146/432 (34%), Positives = 219/432 (51%), Gaps = 27/432 (6%)

Query  70   LGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAP------KFDWSQLASSVST  123
            LGGTCVNVGC+PKK+M+ +A +   +H+DA  +G++ ++        +F WS+L      
Sbjct  73   LGGTCVNVGCVPKKIMYLAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDA  132

Query  124  YIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprl  183
            YI  LN  Y+ +L + KV       AF     +E+      ++ V        +      
Sbjct  133  YILRLNGIYERNLGNSKVDLIQGTAAFNAQGEVEVDGKVISARNVLIAVGGKPLIPDIPG  192

Query  184  lpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRG  242
                  E  I SD  F  +  P K  VVGA Y+A+E AG L G G D  +  R   +LR 
Sbjct  193  K-----EHCIDSDGFFELEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRT  247

Query  243  FDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNA  302
            FD+ + + + + M  + GI    ++  + I K  DGK  +   L DGS H   FDTV+ A
Sbjct  248  FDELVRDTLHDAM-AKDGIVVRPQSNVARIEKTLDGKKTL--VLADGSEHA-GFDTVIYA  303

Query  303  TGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPN-IFAIGDVIDAPELTPVAIQAGR  361
             GR P    L +  AG++ + K G I V   QT++ N +FA+GDV     LTPVAI AGR
Sbjct  304  AGRIPLTSNLNISAAGIETD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGR  362

Query  362  LLARRLYNN-ETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE  420
             L+ RL+   E   + Y  + T VF+    G  GL+E+E+ E++G+  I+ Y   F  + 
Sbjct  363  RLSDRLFGGMEDAKISYNNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMY  422

Query  421  WALSDD------TRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFT  474
            + L ++      T+P      +K++C   +D  VVG H +G  A E+ Q  G+A+K+G T
Sbjct  423  YGLVNELDAEGNTKPKPMTA-MKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGAT  480

Query  475  YEQMVSVVGIHP  486
                 + V IHP
Sbjct  481  KADFDNCVAIHP  492

>PHYKE_10327
Length=1200

 Score = 208 bits (529),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 169/475 (36%), Positives = 246/475 (52%), Gaps = 48/475 (10%)

Query  34   AASKPQANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
            A S   A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +G 
Sbjct  34   AGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADLGH  84

Query  94   VMHKDAALFGWQFENAP---------KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYE  144
             +H D  L  + FE+A          +FDW++L +    Y+  LN  Y+ +L + KV+  
Sbjct  85   KLHHD--LLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNLANSKVELI  142

Query  145  NFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTA  204
                AF D       N     K V  + V++AVGG+P +   PG EL I SD  F  +  
Sbjct  143  RGSAAFNDN-----GNVVVDGKEVRAKNVLIAVGGKPMIPDIPGKELCIDSDGFFELEML  197

Query  205  PGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEF  263
            P K  VVGA Y+A+E AG L   G D  +  R   +LR FD  +   + + M+ + G+  
Sbjct  198  PKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMKKD-GVHL  256

Query  264  IRETVPSSITKLEDG-KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLN  322
             R +  + + +  DG K LV   L DGS H   +D V+ A GR P    L LDKAG+  +
Sbjct  257  QRHSNIARVNQAADGTKTLV---LADGSEHS-GYDVVIYAAGRVPLTSTLKLDKAGIATD  312

Query  323  PKTGRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE-TTLMDYEKV  380
             K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+       + YE +
Sbjct  313  -KNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMGGAKVSYENI  371

Query  381  CTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWAL---SDDT------RPSM  431
             T VF+    G  GL+EE++ +++G+D+I+VY   F  + + L    D+T      +P  
Sbjct  372  PTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINEMDETTGEPKDKPKT  431

Query  432  ANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            A   +K++C   +D  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  432  A---MKLVC-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCMAIHP  482

>PHYSO_550665
Length=491

 Score = 199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 225/452 (50%), Gaps = 28/452 (6%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQ  105
            A+ +G KVLV   V+   +    GLGGTCVN GC+PKK+M  +A   E + ++     + 
Sbjct  25   AATYGAKVLV---VERGREFEGMGLGGTCVNFGCVPKKVMFNAAAHVEHLARNK---DYS  78

Query  106  FENAPK------FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS  159
               A K      FDW+ + +    YIK LN  Y+ +L + +V +   +   V    +E++
Sbjct  79   INTAAKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAQVDHVQGIAKLVAKDKVEVA  138

Query  160  NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALE  219
                  K V      V        +     E  I SD  F  +  P K  VVGA Y+A+E
Sbjct  139  GKVFTGKHVLVAPGGVPSVPDLPGM-----EHVIDSDGFFKLEQQPKKVAVVGAGYIAVE  193

Query  220  CAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDG  278
             AG       D  +  R   +LR FD  + + + E ME +AG++F+R    + + K  DG
Sbjct  194  MAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVKFVRNMRAARVEKQADG  252

Query  279  KLLVKWTLPDGSNHE-EAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTS  336
            KL    T+ +G  H+   FD +L A GR P    L L++ GVKL+ + G I V   E TS
Sbjct  253  KLTFVVTI-NGEEHKFPDFDAILYAVGREPRTKDLGLEEVGVKLS-EGGFIEVDAQENTS  310

Query  337  TPNIFAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCG  394
             P ++AIGD  I   ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G  G
Sbjct  311  VPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIGTIG  370

Query  395  LSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYL  454
             +E E++ ++GE+N++ Y   F  L  +++D  R       L  + ++     VVG H  
Sbjct  371  YTEPEAVAKYGEENVKCYTSKFVNLLHSMADPERKGKTAMKLVTVGEQET---VVGVHVA  427

Query  455  GPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G  A E+ Q  G+A+K+  T     ++V IHP
Sbjct  428  GEGADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>PHALS_09136
Length=493

 Score = 198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 154/449 (34%), Positives = 221/449 (49%), Gaps = 22/449 (5%)

Query  46   ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAAL--  101
            A+  G KVLV   V+   +    GLGGTCVN GC+PKK+M  +A+  E ++  KD ++  
Sbjct  25   AATCGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNTAVHVEHLNRNKDYSINT  81

Query  102  FGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNp  161
                FE    FDW+ + +    YI+ LN  Y+ +L + +V     +   V    I+++  
Sbjct  82   CAKDFEFG-DFDWANMKTKRDAYIQRLNGIYERNLSNAQVDVIQGIAKIVAKDKIQVAGH  140

Query  162  rkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECA  221
                K V      V              E  I SD  F  +  P K  VVGA Y+A+E A
Sbjct  141  IYTGKHVLVAPGGVPNIPDIPGK-----EHVIDSDGFFKLEQQPKKVAVVGAGYIAVELA  195

Query  222  GFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKL  280
            G       D  +  R   +LR FD  + + + E ME +AG+EF+R    + I K  D KL
Sbjct  196  GIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KAGVEFVRNMSATRIEKSNDDKL  254

Query  281  LVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTSTPN  339
                T+         FDT+L A GR P    L L++ GVKL    G I V   E T+ P 
Sbjct  255  TFVVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIGVKL-ADGGYIEVDAQENTTVPG  313

Query  340  IFAIGDV-IDAPELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGLSE  397
            ++AIGDV +   ELTPVAI AGR LA RL+  E    ++Y ++ T +F+    G  G +E
Sbjct  314  VYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPTVIFSHPPIGTIGYTE  373

Query  398  EESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPN  457
             E+I RFG++NI++Y   F  L  A++D  R       L  + ++     VVG H  G  
Sbjct  374  PEAIARFGKENIKIYTSKFVNLLHAMADPERKGKTAMKLVTVGEEET---VVGVHVAGEG  430

Query  458  AGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            A E+ Q  G+A+K+  T     ++V IHP
Sbjct  431  ADEMIQGFGVAVKMNATKADFDNIVAIHP  459

>H310_11259
Length=519

 Score = 196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 146/452 (32%), Positives = 223/452 (49%), Gaps = 22/452 (5%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A+ +G KVLV   V+        GLGGTCVNVGC+PKK+M+ +A + E+MH  K     
Sbjct  46   RAASYGAKVLV---VERGRTLGGAGLGGTCVNVGCVPKKVMYNAAFLAEIMHSAKTYTFK  102

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G Q      FDW  + S    Y+  L+  Y+ +L    +   + + AFVD HTI +   +
Sbjct  103  GVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISLVSGVAAFVDNHTIAVDGAK  162

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
              +  +               +     EL+I+SD  F  +T P K  VVGA Y+A+E AG
Sbjct  163  FTAPHILVAVGGTPQLPSIPGI-----ELAISSDGFFALETQPRKVAVVGAGYIAVELAG  217

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  +  R   +LR FD  + + + + M   AG+ F+ ++   SI K  +G L 
Sbjct  218  IFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGVAFVTQSGVDSIHKEANGTLT  276

Query  282  VKWTLP--DGSNHEEAF---DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTS  336
            ++ T+   +GS   + F   D V+ A GR P       D+  +  + K    +   E T+
Sbjct  277  IQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDRTDIVFDRKGFIQVDGQENTT  336

Query  337  TPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCG  394
             P ++AIGD      ELTPVAI AGR LA RL+  E    ++Y ++ T VF+    G  G
Sbjct  337  VPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDACINYHQIPTVVFSHPPIGTIG  396

Query  395  LSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYL  454
             +E ++I ++G  N++VY  +F  L + L       M +  +KV+C    +  VVG H  
Sbjct  397  YTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPK--DMPSTAMKVVCVGKEET-VVGMHVA  453

Query  455  GPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G  A E+ Q  G+A+K+G     + +V+ IHP
Sbjct  454  GMGADEMIQGFGVAVKMGAYKSDLDNVIAIHP  485

>PHYCA_7619
Length=462

 Score = 191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 148/467 (32%), Positives = 221/467 (47%), Gaps = 44/467 (9%)

Query  40   ANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDA  99
            A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +   +H D 
Sbjct  2    ASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHDF  52

Query  100  ALFGWQFE-------NAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVD  152
              +G++ E           FDW +L +    Y+  LN  Y+ +L + KV        F  
Sbjct  53   LHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFNQ  112

Query  153  PHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVG  212
               +E+      +  V        +            EL I SD  F  +T P K  VVG
Sbjct  113  NGNVEVDGKEILADNVMIAVGGKPLIPDIPGK-----ELCIDSDGFFELETLPKKVAVVG  167

Query  213  ASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSS  271
            A Y+A+E AG L   G +  +  R   +LR FD  +   + + ME + G+        S+
Sbjct  168  AGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKD-GVHLCPH---SN  223

Query  272  ITKLEDGKLLVK-WTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV  330
            + ++E      +   L DGS H   ++ V+ A GR P    L LDKAGV  +   G I V
Sbjct  224  VVRVEQAADNTRTLVLADGSEHS-GYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQV  281

Query  331  TN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTAVFTPI  388
               +QTS  N+FA+GD    P LTPVAI AGR L+ RL+   +   + YE + T VF+  
Sbjct  282  DEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSHP  341

Query  389  EYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDT---------RPSMANCYLKVI  439
              G  GL+E ++  ++G+D I+VY   F  + + L ++          +P  A   +K++
Sbjct  342  PIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTA---MKLV  398

Query  440  CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            C   +D  VVG H +G  A E+ Q  G+A+K+G T       + IHP
Sbjct  399  C-AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHP  444

>PYIW_25301
Length=512

 Score = 192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 142/431 (33%), Positives = 214/431 (50%), Gaps = 25/431 (6%)

Query  70   LGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAPK------FDWSQLASSVST  123
            LGGTCVNVGC+PKK+M+ +A +  ++H+DA  +G++ ++  +      F W +L      
Sbjct  74   LGGTCVNVGCVPKKIMYLAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDA  133

Query  124  YIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprl  183
            YI  LN  Y+ +L + KV        F     +E+      +K +        +      
Sbjct  134  YILRLNDIYERNLGNSKVDLLTGTAVFNAHGNVEMDGKEIQAKNILIAVGGKPLIPDIPG  193

Query  184  lpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRG  242
                  EL I SD  F  +  P K  VVGA Y+A+E AG L G G +  +  R   +LR 
Sbjct  194  K-----ELCIDSDGFFELEQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRT  248

Query  243  FDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNA  302
            FD+ + + + + M  + GI    ++  + + +  DGK  +   L +GS H   FDTV+ A
Sbjct  249  FDELVRDTLHDAMAKD-GIVVRPQSNVARVEQTADGKKTL--FLQNGSEHA-GFDTVIYA  304

Query  303  TGRNPDVDKLALDKAGVKLNPKTGRILVTNEQT-STPNIFAIGDVIDAPELTPVAIQAGR  361
             GR P   +L L  AG+  + K G I V   QT S  N+FA+GDV     LTPVAI AGR
Sbjct  305  AGRVPLTSELNLSAAGIATD-KHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGR  363

Query  362  LLARRLYNNET-TLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE  420
             L+ RL+       + Y+ + T VF+    G  GL+E E+ E+ G+  I+ Y   F  + 
Sbjct  364  RLSDRLFGGMADAKISYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMY  423

Query  421  WALSDDTRPSMAN-----CYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTY  475
            + L +D     A        +K++C   +D  VVG H +G  A E+ Q  G+A+K+G T 
Sbjct  424  YGLVNDVDADGAAKPKPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATK  482

Query  476  EQMVSVVGIHP  486
                + V IHP
Sbjct  483  ADFDNCVAIHP  493

>PHYKE_6836
Length=493

 Score = 189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 147/455 (32%), Positives = 224/455 (49%), Gaps = 32/455 (7%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKW---GLGGTCVNVGCIPKKLMHQSALIGEVMHKD---  98
             A+ +G KVLV++      +G K+   GLGGTCVN GC+PKK+M  +A+  E + ++   
Sbjct  24   RAATYGAKVLVVE------RGRKYDGMGLGGTCVNYGCVPKKVMFNTAMHVEHLARNRDY  77

Query  99   ---AALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHT  155
                A   +QF +   FDWS + +    YI  LN  Y+ +L++++V +   +   V    
Sbjct  78   SINTAQRDFQFGD---FDWSNMKTKRDAYILRLNGIYERNLQNQQVDHVQGIAKIVAKDK  134

Query  156  IELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASY  215
            I++       K +      V              E  I SD  F  +  P K  VVGA Y
Sbjct  135  IQVDGQVFTGKNLLVAPGGVPTIPDFPGN-----EHVIDSDGFFKLEQQPKKVAVVGAGY  189

Query  216  VALECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK  274
            +A+E AG       D  +  R   +LR FD  + + + E ME +AG++F+R +    + K
Sbjct  190  IAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVKFVRNSRAVRVEK  248

Query  275  LEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV-TNE  333
              DGKL    T+         FDT+L A GR P    L L++  VKL+ + G I V   E
Sbjct  249  QTDGKLTFVVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKLS-QDGFIEVDAQE  307

Query  334  QTSTPNIFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-TLMDYEKVCTAVFTPIEYG  391
             TS   ++AIGD      ELTPVAI AGR L+ RL+  E    ++Y ++ T +F+    G
Sbjct  308  NTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYHQIPTVIFSHPPIG  367

Query  392  CCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGF  451
             CG +E E++E+FG++NI+ Y   F  L  +++D  R       L  + ++   + V   
Sbjct  368  TCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMADPERKGKTAMKLVCVGEEEVVVGVH--  425

Query  452  HYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
               G  A E+ Q  G+AMK+  T     ++V IHP
Sbjct  426  -VAGEGADEMIQGFGVAMKMNATKADFDNIVAIHP  459

>PPTG_18033
Length=500

 Score = 189 bits (480),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 147/469 (31%), Positives = 223/469 (48%), Gaps = 36/469 (8%)

Query  34   AASKPQANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
            A S   A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +  
Sbjct  34   AGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSH  84

Query  94   VMHKDAALFGWQFE-------NAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENF  146
             +  D   +G++ E           FDW +L +    Y+  LN  Y+ +L + KV+    
Sbjct  85   KLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLANSKVELIRG  144

Query  147  LGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPG  206
               F +   +E+      +K V        +            EL I SD  F  +  P 
Sbjct  145  SAKFNENGNVEVDGKELLAKNVLIAVGGKPLIPDIPGK-----ELCIDSDGFFELEILPK  199

Query  207  KTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIR  265
            K  VVGA Y+A+E AG L   G D  +  R   +LR FD D+     E   V+ G+    
Sbjct  200  KVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFD-DIVRTTLEDAMVKDGVHLRP  258

Query  266  ETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKT  325
             +  + + +  DG   V   L DGS +   +D V+ A GR P    L LDKAGV  + + 
Sbjct  259  HSNVARVEQAADGTKTV--VLTDGSEYN-GYDVVMYAAGRVPLTSNLQLDKAGVTTD-EH  314

Query  326  GRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTA  383
            G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+     + + YE + T 
Sbjct  315  GFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNSKVSYENIPTV  374

Query  384  VFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMA------NCYLK  437
            VF+    G  GL+E+++  ++G+D ++VY   F  + + L ++   S           +K
Sbjct  375  VFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMK  434

Query  438  VICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            ++C   ++  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  435  LVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  482

>PHYRA_71927
Length=485

 Score = 189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 149/473 (32%), Positives = 227/473 (48%), Gaps = 44/473 (9%)

Query  34   AASKPQANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93
            A S   A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +  
Sbjct  19   AGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSH  69

Query  94   VMHKDAALFGWQFE-------NAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENF  146
             +  D   +G++ E           FDW +L +    Y+  LN  Y+ +L + KV+  + 
Sbjct  70   KLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLANSKVELIHG  129

Query  147  LGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPG  206
               F +   +E+      +K V        +            EL I SD  F  +  P 
Sbjct  130  SAKFNEKGNVEVDGKELLAKNVLVAVGGKPLIPDIPGK-----ELCIDSDGFFELEMLPK  184

Query  207  KTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIR  265
            K  VVGA Y+A+E AG L   G D  +  R   +LR FD  +   + + M  + G+    
Sbjct  185  KVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM-AKDGVHLRP  243

Query  266  ETVPSSITKLEDG-KLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324
             +  + + ++ DG K LV   L DGS H   +D V+ A GR P    L LD A +  + K
Sbjct  244  HSNVTRVEQVADGTKTLV---LADGSEHS-GYDVVIYAAGRVPLTSNLQLDNADIATD-K  298

Query  325  TGRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCT  382
             G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+   +   + YE + T
Sbjct  299  HGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMKDAKVSYENIPT  358

Query  383  AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDT---------RPSMAN  433
             VF+    G  GL+EE++  ++G+DN +VY   F  + + L ++          +P  A 
Sbjct  359  VVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVDEATGEPKDKPKTA-  417

Query  434  CYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              +K++C   ++  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  418  --MKLVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  467

>PITG_13427
Length=463

 Score = 187 bits (476),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 147/465 (32%), Positives = 222/465 (48%), Gaps = 39/465 (8%)

Query  40   ANGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDA  99
            A+    AS  G +V V++  +         LGGTCVNVGC+PKKLM  +A +   +  D 
Sbjct  2    ASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHDL  52

Query  100  ALFGWQFE-------NAPKFDWSQLASSVSTYIKTLNFKY-KVDLRDKKVKYENFLGAFV  151
              +G++ E           FDW +L +    Y+  LN  Y + +L + KV+    L  F 
Sbjct  53   LHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATFN  112

Query  152  DPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVV  211
            +   +E+      +K V        +            EL I SD  F  +T P K  VV
Sbjct  113  EKGNVEVGGKELLAKNVLIAVGGKPLIPDLPGK-----ELCIDSDGFFELETLPKKVAVV  167

Query  212  GASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVEAGIEFIRETVPS  270
            GA Y+A+E AG L   G D  +  R   +LR FD  +   + + M  E     +     S
Sbjct  168  GAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAMAKEG----VHLRPHS  223

Query  271  SITKLEDGKLLVK-WTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRIL  329
            ++ ++E G    K   L DGS +   +D V+ A GR P    L LDKAG+  + + G I 
Sbjct  224  NVARVELGADGTKTLVLTDGSKY-SGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGFIP  281

Query  330  VTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMDYEKVCTAVFTP  387
            V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+       + YE + T VF+ 
Sbjct  282  VNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFSH  341

Query  388  IEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMA------NCYLKVICD  441
               G  GL+EE++  ++G+D I+VY   F  + + L ++   S           +K++C 
Sbjct  342  PPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC-  400

Query  442  KTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              ++  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  401  AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  445

>HYAP_04843
Length=430

 Score = 171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 201/419 (48%), Gaps = 30/419 (7%)

Query  80   IPKKLMHQSALIGEVMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDK  139
            +  KL H     G          G Q      FDW++L +    Y++ LN  Y+ +L   
Sbjct  1    MSHKLQHDVVHYGFEKEGTGGSLGAQMH----FDWTKLKTRRDAYVRRLNGIYERNLASS  56

Query  140  KVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIF  199
            KV++      F     +E+      +K V        +            EL I SD  F
Sbjct  57   KVEFIQGSARFNKQGNVEVDGKEVLAKNVMIAVGGKPMIPDIPGK-----ELCIDSDGFF  111

Query  200  WRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LLRGFDQDMANRIGEYMEVE  258
               T P K  V+GA Y+A+E AG L   G +  +  R   +LR FD  +   + + M ++
Sbjct  112  ELDTLPKKVAVIGAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAID  171

Query  259  AGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAG  318
             G+     +  + + +  DG   +   L DGS H   FD V+ A GR P  DKL LD AG
Sbjct  172  -GLHLRPNSNVARVEQAADGTNTL--VLTDGSAHC-GFDIVIYAAGRVPLTDKLDLDNAG  227

Query  319  VKLNPKTGRILVTN-EQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETTLMD  376
            V  N K G I+V   ++TS   +FA+GDV   P LTPVA+ AGR L+ RL+ N +   + 
Sbjct  228  VATN-KHGYIVVNEFQETSNSKVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVS  286

Query  377  YEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDT---------  427
            YE + T VF+    G  GL+E+++  ++G+D+I+VY  +F  + + L ++          
Sbjct  287  YENIPTVVFSHPPIGTIGLTEKQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKE  346

Query  428  RPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +P  A   +K++C   ++  VVG H +G  A E+ Q  G+A+K+G T     + + IHP
Sbjct  347  KPKTA---IKLVCAGKKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHP  401

>PYVX_21517
Length=482

 Score = 169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 136/444 (31%), Positives = 207/444 (47%), Gaps = 69/444 (16%)

Query  70   LGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAP--------KFDWSQLASSV  121
            LGGTCVNVGC+PKK+M+  A +   +H+DA  +G++   +P         FDW +L    
Sbjct  62   LGGTCVNVGCVPKKIMYTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRR  121

Query  122  STYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggrp  181
              Y+  LN  Y+ +L + KV+       F     IE+ +  +         V        
Sbjct  122  DAYVLRLNGIYERNLANSKVELLTGTARFNVDGKIEV-DGVEVRAKKVLLAVGGKPLIPD  180

Query  182  rllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVRSI-LL  240
              +   G EL I SD  F  +  P K  VVGA Y+A+E AG L   G D  +  R   +L
Sbjct  181  IPVAATGKELCIDSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVL  240

Query  241  RGFDQDMANRIGEYMEVEAGIEFIRETVP-------------SSITKLE---DG-KLLVK  283
            R FD   +    +++  ++  E +R T+              S+I ++E   DG K LV 
Sbjct  241  RSFDWWNS----QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLV-  295

Query  284  WTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTN-EQTSTPNIFA  342
              L DGS H   F++V+ A GR P    L LD AGV  + + G I V   +QT+ P+I A
Sbjct  296  --LADGSTHT-GFESVIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILA  351

Query  343  IGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIE  402
            +GD      LTP++                    YE V T VF+    G  GL+E+++  
Sbjct  352  VGDACGTIALTPIS--------------------YENVPTVVFSHPPIGTVGLTEKQARA  391

Query  403  RFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVT  462
            +FG++ I++Y   F  + + + ++           ++C    D  +VG H +G  A E+ 
Sbjct  392  KFGDEQIKIYKSTFVNMYYGVVNE-----------LVCAGP-DEKIVGLHVIGMGADEML  439

Query  463  QAIGLAMKLGFTYEQMVSVVGIHP  486
            Q  G+A+K+G T   + S V IHP
Sbjct  440  QGFGVAVKMGATKADLDSCVAIHP  463

>PYIR_23431
Length=468

 Score = 162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 138/452 (31%), Positives = 202/452 (45%), Gaps = 51/452 (11%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKW---GLGGTCVNVGCIPKKLMHQSALIGEVMHKDAAL  101
             A+ +G KVLV++      +G K+   GLGGTCVN GC+PKK+M  ++   E ++++A  
Sbjct  24   RAATYGAKVLVVE------RGRKYDGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADY  77

Query  102  F-----GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI  156
                    +FE    FDW+ + +    YI  LN  Y+ +L +  V     +   V  + I
Sbjct  78   SITTNGSKKFEFG-DFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQI  136

Query  157  ELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYV  216
            E++      K +               +     E  I SD  F  +  P K  VVGA Y+
Sbjct  137  EVNGVVYTGKHILVAVGGKPSLPNIPGI-----EHVIDSDGFFRLEAQPKKVAVVGAGYI  191

Query  217  ALECAGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKL  275
            A+E AG       D  +  R   +LR FD  + + I E  E +AGI F+R +    I K 
Sbjct  192  AIELAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQ  250

Query  276  EDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQT  335
             DG L +   +         FDT+L A GR P    L L++ GVKL      ++   E T
Sbjct  251  ADGTLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENT  310

Query  336  STPNIFAIGD-VIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCG  394
            S P I+AIGD  I   ELTP+                          T VF+    G  G
Sbjct  311  SVPGIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTIG  345

Query  395  LSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYL  454
             +E ++IE+FG +N++VY   F  L +A++D   P         +     D  VVG H  
Sbjct  346  YTEPQAIEKFGAENVKVYTSKFVNLLYAMAD---PDHKGKTAMKLVTVGEDEVVVGVHVA  402

Query  455  GPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G  A E+ Q  G+A+K+  T     ++V IHP
Sbjct  403  GEGADEMIQGFGVAVKMNATKADFDNIVAIHP  434

>PYAR_17714
Length=444

 Score = 149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 131/447 (29%), Positives = 200/447 (45%), Gaps = 59/447 (13%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALF--  102
             A+  G KVL+++  + +      GLGGTCVN GC+PKK+M  +A   E + ++A     
Sbjct  24   RAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWNAASHVEHLARNADYSIR  80

Query  103  -GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNp  161
             G +F+    FDW+ +A+    YI  LN  Y+ ++ + K+     + +      + +   
Sbjct  81   SGAEFQYG-DFDWANMAAKRDAYILRLNGIYERNIGNAKIDLIEGIASLTAKDAVTVDGK  139

Query  162  rkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECA  221
                        V  V   P++      E +I SDD F  KT P K  VVGA Y+A+E A
Sbjct  140  TXXXXGKHILVAVGGVPAMPQIPGI---EHAIDSDDFFKLKTQPKKVAVVGAGYIAVEIA  196

Query  222  GFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKL  280
            G       +  +  R   +LR FD  + + +   M+ + G+ F+R +   +I K  DGKL
Sbjct  197  GVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHGVHFVRRSRIHAIVKQPDGKL  255

Query  281  LVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTN-EQTSTPN  339
             V+ T+         FD VL A GR P    L L+  GVKL+   G I V   E TS   
Sbjct  256  SVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKLS-DAGFIEVDKFENTSVDG  314

Query  340  IFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEE  399
            ++AIGD                           T   YE                L+  E
Sbjct  315  VYAIGD--------------------------ATTTGYE----------------LTPPE  332

Query  400  SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAG  459
            ++E+FG D+++VY   F  L +A++D    S     +K++C    +  VVG H  G  A 
Sbjct  333  AVEKFGADHVKVYTSTFVNLLYAMADPDHKS--KTAMKLVCVGENEQ-VVGVHVAGEGAD  389

Query  460  EVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            E+ Q  G+A+K+  T     ++V IHP
Sbjct  390  EMIQGFGVAIKMNATKSDFDNIVAIHP  416

>PYVX_16175
Length=446

 Score = 140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 193/449 (43%), Gaps = 63/449 (14%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHK----DAA  100
             A+  G KVL+++  + +      GLGGTCVN GC+PKK+M  +A   E +++       
Sbjct  24   RAASHGAKVLLVERGRANDGA---GLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSVT  80

Query  101  LFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSN  160
              G +      FDW  + +    YI  LN  Y+ +L + K+     +   V  + +E+  
Sbjct  81   TLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLEVDG  140

Query  161  prkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALEC  220
                 K +      V        +     E +I SD  F  +  P K  VVGA Y+A+E 
Sbjct  141  KVYTGKNLLLAPGGVPTLPPIPGI-----EHAIDSDGFFKLEQQPRKVAVVGAGYIAVEI  195

Query  221  AGFLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGK  279
            AG       +  +  R   +LR FD  + + +   ME + G++F+R +  + I KLEDGK
Sbjct  196  AGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLEDGK  254

Query  280  LLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPN  339
            L +   +   +     FDTVL A GR P    L L+  GV L+ K    +   E TS   
Sbjct  255  LQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDKGFIKVDAQENTSAAG  314

Query  340  IFAIGDVIDAP-ELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEE  398
            ++AIGD      ELTP                                            
Sbjct  315  VYAIGDATTTGWELTP-------------------------------------------P  331

Query  399  ESIERFGEDNIEVYHQNFTPLEWALSD-DTRPSMANCYLKVICDKTRDLFVVGFHYLGPN  457
            +++ ++G +N++VY   F  L  A++D D +   A   + V   +T    VVG H  G  
Sbjct  332  DAVAKYGAENVKVYTSTFVNLVHAMADPDHKGKTAMKLVTVGAQET----VVGVHVAGEG  387

Query  458  AGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            A E+ Q  G+A+KLG T     ++V IHP
Sbjct  388  ADEMIQGFGVAVKLGATKADFDNIVAIHP  416

>PYAP_22645
Length=1565

 Score = 107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 121/452 (27%), Positives = 202/452 (45%), Gaps = 31/452 (7%)

Query  44    VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
             ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + +     H D + +
Sbjct  1116  IKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALLHATHMYHAAQH-DFSKY  1166

Query  103   GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS---  159
             G +  +  K ++  +  S    +KTL    +   +  KV Y    G  V  + + ++   
Sbjct  1167  GIEVSDV-KMNFDGMMKSKEKAVKTLTGGIEGLFKKNKVTYVKGFGKIVSANEVSVALND  1225

Query  160   --NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVA  217
               N    +K +            P  +    G++ + S      K  P   +V+G   + 
Sbjct  1226  AGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI-VDSTGALELKKVPEHLVVIGGGVIG  1284

Query  218   LECAGFLKGQGYDVKVMVRSILLR-GFDQDMANRIGEYMEVEAGIEFIRET-VPSSITKL  275
             LE     K  G  V V+  +  +  G DQ++     + ++ + G++F   T V +S    
Sbjct  1285  LELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKLLK-KQGLQFEFSTKVTASEVNG  1343

Query  276   EDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-Q  334
             +   L V+      S+  EA DTVL ATGR P    L L++ G++ + K GRI V N  +
Sbjct  1344  DKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKGLGLEQMGIQTD-KLGRIQVDNHFR  1401

Query  335   TSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCG  394
             T  PNIFAIGDVI  P L   A + G      +      + +Y+ +   ++T  E    G
Sbjct  1402  TQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGLHGHV-NYDAIPGVIYTYPEVASVG  1460

Query  395   LSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYL  454
              +EE+      E+ +  Y+    P+  A S     + ++ ++KVI DKT D  ++G H +
Sbjct  1461  KTEEQ----LKEEGV-AYNVGKFPM-MANSRARAVAESDGFVKVIADKTTDR-ILGIHII  1513

Query  455   GPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
               NAGE+     L M+ G   E +      HP
Sbjct  1514  ASNAGEMISEGVLGMEYGAASEDIGRTCHAHP  1545

>PYIW_25190
Length=206

 Score = 99.0 bits (245),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 91/177 (51%), Gaps = 5/177 (3%)

Query  312  LALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGD-VIDAPELTPVAIQAGRLLARRLYNN  370
            L L+  GVKLN     ++   E TS   I+AIGD  I   ELTPVAI AGR LA RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  371  ET-TLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRP  429
            E   L+ Y ++ T VF+    G  G +E ++IE+FG  N++ Y   F  L  A++D   P
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMAD---P  118

Query  430  SMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
                     +     D  VVG H  G  A E+ Q  G+AMK+  T     ++V IHP
Sbjct  119  DHKGKTAMKLVTVGEDEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHP  175

>CCA22989
Length=494

 Score = 103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 111/453 (25%), Positives = 198/453 (44%), Gaps = 31/453 (7%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K + ++        ++  LGGTC+NVGCIP K L+H S +     H D    
Sbjct  43   IKAAQLGMKTVCIE--------SRGTLGGTCLNVGCIPSKALLHSSHMFHTAQH-DFKAI  93

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G +  +  + ++ ++  +    +K L    +   +  KV Y    G  V    + +S   
Sbjct  94   GIEASDL-RLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGHGTIVGKDQVSVSYSD  152

Query  163  kpsktvttrrvvvavggrprllpcpggELS------ITSDDIFWRKTAPGKTLVVGASYV  216
            +     T +   + +     + P P   +       + S      K+ P + +VVGA  +
Sbjct  153  ESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRIVDSTGALVLKSTPKEMVVVGAGVI  212

Query  217  ALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKL  275
             LE     +  G +V V+   + +  G D ++     + ++ + G +F   T  +S TK+
Sbjct  213  GLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKTLQ-KQGFKFKFATKVTS-TKV  270

Query  276  EDGKLLVKWTLPDGSNHEEA-FDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-  333
             + ++ +      G N      D VL ATGR P    L L+  G++ + K GRI V N  
Sbjct  271  NEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNLGLENLGIQTD-KLGRIPVDNHF  329

Query  334  QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCC  393
            +T  PNI+AIGDVI  P L   A + G + A  +   +   ++Y  +   ++T  E  C 
Sbjct  330  RTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKQGHVNYNAIPGVIYTFPEVACV  388

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHY  453
            G +EE+  E     N+  +         A+ +       + ++KV+  K  D  ++G H 
Sbjct  389  GRTEEQLKEEGVSYNVGKFPMIANSRARAVGE------TDGFVKVLAQKDNDR-ILGIHL  441

Query  454  LGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +  NAGE+     L ++ G + E +      HP
Sbjct  442  MTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHP  474

>PYIR_20273
Length=505

 Score = 102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 121/458 (26%), Positives = 191/458 (42%), Gaps = 37/458 (8%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L     H D A +
Sbjct  50   IKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALLHSTHLYHSAQH-DFAKY  100

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS---  159
            G +       ++ ++  S    +KTL    +   +  KV Y    G  V  + + ++   
Sbjct  101  GIEVSEV-SMNFGKMMKSKEKAVKTLTGGIEQLFKKNKVTYIKGHGKIVAKNEVAVALND  159

Query  160  --NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVA  217
              N    +K +            P  +    G++ + S      K  P   +VVGA  + 
Sbjct  160  SGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKI-VDSTGALELKKVPEHLVVVGAGVIG  218

Query  218  LECAGFLKGQGYDVKVMVRSILLR---GFDQDMANRIGEYMEVEA-GIEFIRETVPSSIT  273
            LE     K  G   KV V   L R   G D ++     + ++ +  G EF  +   S + 
Sbjct  219  LELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFTKLLKKQGLGFEFSTKVTASEVN  276

Query  274  ----KLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRIL  329
                 L             G+      D VL ATGR P  + L L+  G++ + K GRI 
Sbjct  277  GEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRPYTNGLGLENMGIQTD-KFGRIS  335

Query  330  VTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPI  388
            V +  +T  PNIFAIGDVI  P L   A + G   A  +      + +Y  +   ++T  
Sbjct  336  VDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAETIAGKHGHV-NYNAIPGVIYTFP  394

Query  389  EYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFV  448
            E    G +EE+      E+ +  Y+    P+  A S       A+  +KVI DK  D  +
Sbjct  395  EVASVGKTEEQ----LKEEGV-TYNVGKFPM-LANSRARAVGEADGLVKVIADKATDK-I  447

Query  449  VGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +G H +  NAGE+     L M+ G + E +      HP
Sbjct  448  LGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHP  485

>PYAR_20075
Length=469

 Score = 102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 117/457 (26%), Positives = 189/457 (41%), Gaps = 68/457 (15%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L     H D   +
Sbjct  47   IKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALLHSTHLFHTAQH-DFKKY  97

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G +  +  + D+  +  S    +KTL    +   +  KV Y    G  V  + + ++   
Sbjct  98   GIEVSDV-QMDFGGMMKSKEKAVKTLTAGIESLFKKNKVTYIKGFGKIVAANEVAVA---  153

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
                                L    G E  + S      K AP   +V+G   + LE   
Sbjct  154  --------------------LNDNNGNETIVDSTGALALKKAPEHLVVIGGGVIGLELGS  193

Query  223  FLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEF------------IRETVPS  270
              K  G  V V+           + A+R+   +++E G EF             +  V +
Sbjct  194  VYKRLGSKVTVV-----------EYADRVCPGLDLELGKEFAKLLKKQGLDLQFKTKVTA  242

Query  271  SITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV  330
            S    +   L V+      +   EA DTVL ATGR P  + L L++ G++ + K GRI V
Sbjct  243  SQVNGDKVTLTVEPAAGGEATTIEA-DTVLVATGRRPFTNGLGLEQMGIQTD-KMGRIQV  300

Query  331  TNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIE  389
                +T  P+I+AIGDVI  P L   A + G      +      + +Y  +   ++T  E
Sbjct  301  DEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAGLHGHV-NYNAIPGVIYTHPE  359

Query  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVV  449
                G +EE+      E+ I  Y+    P+  A S        + ++KV+ DKT D  ++
Sbjct  360  VASVGKTEEQ----LKEEGI-AYNVGKFPM-MANSRARAVGEGDGFVKVLADKTTDK-IL  412

Query  450  GFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            G H +  NAGE+     L ++ G   E +      HP
Sbjct  413  GIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHP  449

>CCI10477
Length=494

 Score = 100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 112/453 (25%), Positives = 199/453 (44%), Gaps = 31/453 (7%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H S L     H D    
Sbjct  43   IKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALLHSSHLFHTAQH-DFKSI  93

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G +  +  + ++ ++  +    +K L    +   +  KV Y    G  V  + + ++   
Sbjct  94   GIEVSDL-RLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGHGKIVAKNQVSVALSD  152

Query  163  kpsktvttrrvvvavggrprllpcpggELS------ITSDDIFWRKTAPGKTLVVGASYV  216
            +     T     + +     + P P   +       + S      K+ P + +VVGA  +
Sbjct  153  ESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKIVDSTGALVLKSIPKEMVVVGAGVI  212

Query  217  ALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKL  275
             LE     +  G +V V+   + +  G D ++     + ++ + G++F   T  +S TK+
Sbjct  213  GLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQ-KQGLKFKFATRVTS-TKV  270

Query  276  EDGKLLVKWTLPDGSNHEEA-FDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-  333
                + +      G N      D VL ATGR P  + L L+  G++ + K GRI V +  
Sbjct  271  NGDNVTITMEDAKGGNETSMECDVVLVATGRRPFTNGLGLESMGIQTD-KMGRIQVDDHF  329

Query  334  QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCC  393
            +T+ P+I+AIGDVI  P L   A + G + A  +   +   ++Y  +   ++T  E  C 
Sbjct  330  RTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKHGHVNYNAIPGVIYTHPEVACV  388

Query  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHY  453
            G +EE+      E+ I  Y+    P+  A S        + ++KV+  K  D  ++G H 
Sbjct  389  GKTEEQ----LKEEGIS-YNVGKFPM-IANSRARAVGETDGFVKVLAQKDNDR-ILGIHI  441

Query  454  LGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +  NAGE+     L ++ G   E +      HP
Sbjct  442  MTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHP  474

>SPRG_19943
Length=343

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 137/290 (47%), Gaps = 18/290 (6%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMH--KDAALF  102
             A  +G KVLV++    +      GLGGTCVNVGC+PKK+M  +AL  E++H  +  A  
Sbjct  38   RAVAYGAKVLVIERGHANDGA---GLGGTCVNVGCVPKKIMFNAALHAEMLHSARAYAFK  94

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G Q      FDW+ + +    Y+K LN  Y   + + KV        FVD HT+E++   
Sbjct  95   GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDLVMGAAKFVDNHTVEVNG--  152

Query  163  kpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAG  222
                  T + +++AVGG P + P PG E +I+SD  F  +T P K  VVGA Y+A+E AG
Sbjct  153  ---DRYTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALETQPRKVAVVGAGYIAVELAG  209

Query  223  FLKGQGYDVKVMVR-SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLL  281
                   D  +  R + +LR FD  + + +   ME  AG E ++  +      +E+  + 
Sbjct  210  IFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEME-HAGKEKVQTAMKLVCIGVEETVVG  268

Query  282  VKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVT  331
            V           + F   +       D D +      V ++P     LVT
Sbjct  269  VHVAGLGADEMIQGFGVAVKMGAYKSDFDNI------VAIHPTASEELVT  312

 Score = 35.0 bits (79),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 1/51 (2%)

Query  436  LKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +K++C    +  VVG H  G  A E+ Q  G+A+K+G       ++V IHP
Sbjct  255  MKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  304

>PYVX_21248
Length=502

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 126/454 (28%), Positives = 211/454 (46%), Gaps = 34/454 (7%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L     H D A +
Sbjct  52   IKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALLHSTHLYHSAQH-DFAKY  102

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS-Np  161
            G + E   K +   +  +    + TL    +   +  KV Y    G  V  + + ++ N 
Sbjct  103  GVEVEGV-KANLGGMMKAKEKAVTTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALND  161

Query  162  rkpsktvttrrvvvavggrprllpcpggELS----ITSDDIFWRKTAPGKTLVVGASYVA  217
             K ++TVT + +++A G  P  LP    + S    + S         P   +VVGA  + 
Sbjct  162  DKGNQTVTAKNIMIATGSEPAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIG  221

Query  218  LECAGFLKGQGYDVKVMVRSILLR---GFDQDMANRIGEYMEVEAGIEFIRET-VPSSIT  273
            LE     K  G   KV V   L R   G D +++    + ++ + G+EF   T V +S  
Sbjct  222  LELGSVYKRLGS--KVTVVEFLDRACPGLDLEVSKEFTKLLK-KQGLEFQFSTKVTASEV  278

Query  274  KLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333
            K ++  L V+ +   GS      DTVL ATGR P  + L L++ G++ + K GR+ V + 
Sbjct  279  KGDNVTLTVEPS-AGGSAASIECDTVLVATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSH  336

Query  334  -QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGC  392
             +T  PNI+A GDVI    L   A + G   A  + + +   ++Y+ +   ++T  E   
Sbjct  337  FRTQIPNIYAFGDVIKGAMLAHKAEEEGVACA-EIISGKHGHVNYDAIPGVIYTTPEVAS  395

Query  393  CGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFH  452
             G +EEE      ++    Y+    P+  A S     + A+ ++K++ DK  D  ++G H
Sbjct  396  VGKTEEEL-----KNEGVTYNVGKFPM-MANSRARTIAEADGFVKILADKATDR-ILGVH  448

Query  453  YLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             +  NAGE+     L ++ G + E +      HP
Sbjct  449  IIAGNAGEMVAEGVLGLEYGASSEDIARTCHAHP  482

>PHYKE_9680
Length=498

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 118/456 (26%), Positives = 193/456 (42%), Gaps = 38/456 (8%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H D   +
Sbjct  48   IKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSY  98

Query  103  GWQFENAP--KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS-  159
            G    +AP  K ++ Q+  +    +KTL    ++  +  KV Y    G       + ++ 
Sbjct  99   GI---DAPGVKANFPQMMKAKEKAVKTLTGGIEMLFKKNKVTYIKGFGKVSAQGEVSVAL  155

Query  160  --NprkpsktvttrrvvvavggrprllpcpggELS--ITSDDIFWRKTAPGKTLVVGASY  215
              N    +       +       P        E    I S      K  P   +VVGA  
Sbjct  156  TDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTGALVLKRVPEHLVVVGAGV  215

Query  216  VALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK  274
            + LE     K  G  V V+  +     G D++      + ++ + G++F      + +T 
Sbjct  216  IGLELGSVYKRLGSKVTVVEFQDAACPGMDKECVKEFTKLLK-KQGLDF---KFGTKVTA  271

Query  275  LEDGKLLVKWTLPDGSNHEEA---FDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVT  331
             E    +VK T       +EA    DTVL ATGR      L L++ G++ + K GR+ V 
Sbjct  272  SEVNGDVVKLTTEAAKGGDEASIECDTVLVATGRRAYTAGLGLEQMGIQTD-KLGRVEVD  330

Query  332  NE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEY  390
            +  +T  P IFAIGDVI    L   A + G      +      + +Y  +   ++T  E+
Sbjct  331  DAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEF  389

Query  391  GCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVG  450
               G +EEE       + IE Y+    P+  A S     + A+  +KV+ DK  D   +G
Sbjct  390  ASVGKTEEE----LKAEGIE-YNVGKFPM-MANSRARTVAEADGLVKVLSDKKTDKM-LG  442

Query  451  FHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             H +  NAGE+     +A++ G + E +      HP
Sbjct  443  VHIIASNAGEMIAEGVIALEYGASSEDIARTCHAHP  478

>PHYSO_556052
Length=500

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 119/458 (26%), Positives = 190/458 (41%), Gaps = 42/458 (9%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H D   +
Sbjct  50   IKAAQLGLKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSY  100

Query  103  GWQFENAP--KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS-  159
            G    +AP  K ++ Q+  +    +KTL    +   +  KV Y    G       + ++ 
Sbjct  101  GI---DAPEVKANFPQMMKAKEKAVKTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVAL  157

Query  160  --NprkpsktvttrrvvvavggrprllpcpggELS--ITSDDIFWRKTAPGKTLVVGASY  215
              N    +       +       P        E    I S      K  P   +VVGA  
Sbjct  158  NDNKGNETVKAKNIIIATGSEVTPLPPVPVDNEAGKIIDSTGALSLKRVPEHLVVVGAGV  217

Query  216  VALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK  274
            + LE     K  G  V V+  +     G D++      + ++ + G+EF      + +T 
Sbjct  218  IGLELGSVYKRLGSKVTVVEFQDAACPGMDKESVKEFTKLLK-KQGLEF---QFGTKVTA  273

Query  275  LEDGKLLVKWTLP-----DGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRIL  329
             E    +VK T       D S  E   DTVL ATGR      L L++ G++ + K GRI 
Sbjct  274  SEVNGDVVKLTTEPSKGGDASTIE--CDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIE  330

Query  330  VTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPI  388
            V +  +T  P IFAIGDVI    L   A + G      +      + +Y  +   ++T  
Sbjct  331  VDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGVACVENIAGKHGHV-NYGAIPGVIYTFP  389

Query  389  EYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFV  448
            E+   G +EEE       + IE Y+    P+  A S     + ++  +KV+ DK  D   
Sbjct  390  EFASVGKTEEE----LKAEGIE-YNVGKFPM-MANSRARTVAESDGLVKVLADKKTDKL-  442

Query  449  VGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +G H +  NAGE+     + ++ G   E +      HP
Sbjct  443  LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAHP  480

>PITG_15359
Length=496

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 123/459 (27%), Positives = 194/459 (42%), Gaps = 44/459 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H D   +
Sbjct  46   IKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSY  96

Query  103  GWQFENAP--KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS-  159
            G    +AP  K ++ Q+  S    +KTL    +   +  KV Y    G       I ++ 
Sbjct  97   GI---DAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKVTYIKGHGKISAQGEISVAL  153

Query  160  -----NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGAS  214
                 N    +K +            P  +    G++ I S      K  P   +VVGA 
Sbjct  154  NDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGALELKRVPEHLVVVGAG  212

Query  215  YVALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSIT  273
             + LE     K  G  V V+        G D++      + ++ + G++F   T    +T
Sbjct  213  VIGLELGSVYKRLGAKVTVVEFLDAACPGSDKEAVKEFTKLLKKQ-GLDFQFNT---KVT  268

Query  274  KLEDGKLLVKWTLP-----DGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRI  328
              E    +VK T       D S+ E   DTVL ATGR      L L++ G++ + K GRI
Sbjct  269  ASEVNGDVVKLTTEPSKGGDASSIE--CDTVLVATGRRAFTSGLGLEQMGIQTD-KLGRI  325

Query  329  LVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTP  387
             V +  +T  P IFAIGDVI    L   A + G      +      + +Y  +   ++T 
Sbjct  326  EVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTF  384

Query  388  IEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLF  447
             E+   G +EEE       + IE Y+    P+  A S     + A+  +KV+ DK  D  
Sbjct  385  PEFASVGKTEEE----LKAEGIE-YNVGKFPM-MANSRARTIAEADGLVKVLADKKTDKL  438

Query  448  VVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             +G H +  NAGE+     + ++ G   E +      HP
Sbjct  439  -LGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHP  476

>PYU1_G014259
Length=244

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 95/176 (54%), Gaps = 11/176 (6%)

Query  67   KWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGWQFENAPK------FDWSQLASS  120
            K  LGGTCVNVGC+PKK+M+ +A +  ++H+DA  +G++ ++  +      F W++L   
Sbjct  66   KARLGGTCVNVGCVPKKIMYLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKER  125

Query  121  VSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprkpsktvttrrvvvavggr  180
               Y+  LN  Y+ +L + KV       AF     +E+       K V  + +++AVGG+
Sbjct  126  RDAYVLRLNGIYERNLANSKVDLLQGTAAFNAQGNVEVDG-----KEVKAKNILIAVGGK  180

Query  181  prllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVMVR  236
            P +   PG E  I SD  F  +  P K  VVGA Y+A+E AG L G G D  +  R
Sbjct  181  PLIPDIPGKEHCIDSDGFFELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PYIW_24688
Length=259

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 111/250 (44%), Gaps = 42/250 (17%)

Query  45   EASKFGQKVLVLDYVKPSPQGTKWG---LGGTCVNVGCIPKKLMHQSALIGEVMHKDAAL  101
             A+ FG KVLV++      +G K+G   LGGTCV+ GC+PKK+M  +A   E +++ AA 
Sbjct  24   RAATFGAKVLVVE------RGRKYGGAGLGGTCVHYGCVPKKIMFNAATHVEHLNR-AAD  76

Query  102  FGWQFENAPK-----FDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI  156
            +      A K     FDW+ + +    YI  LN  Y+ +L + +V     +   V  + +
Sbjct  77   YSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVDLVEGVAKLVAKNQV  136

Query  157  ELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYV  216
            E+       K +                      +    D  F  +  P K  VVGA Y+
Sbjct  137  EVDGVVYTGKHILVA-------------------VGGKPDGFFKLEAQPKKVAVVGAGYI  177

Query  217  ALECAGFLKGQGYDVKVMVR-SILLRGFD---QDMANRIGEYMEVEAGIEFIRETVPSSI  272
            A+E AG       D  +  R   +LR FD   +D+ N  GE    +AGI F+R +    I
Sbjct  178  AIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE----KAGINFVRNSRIERI  233

Query  273  TKLEDGKLLV  282
             K  DG L +
Sbjct  234  EKQADGSLTI  243

>HYAP_12621
Length=501

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 116/461 (25%), Positives = 195/461 (42%), Gaps = 48/461 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H+    F
Sbjct  51   IKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHE----F  98

Query  103  GWQFENAPKF--DWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS-  159
                 +AP    ++ Q+  +    ++TL    +      KV Y   +G       + ++ 
Sbjct  99   KSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGVGKLAAKGQVSVTL  158

Query  160  -----NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGAS  214
                 N    +K +            P  +    G++ + S         P   +VVGA 
Sbjct  159  ADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGALALTRVPEHLVVVGAG  217

Query  215  YVALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEV--EAGIEFIRETVPSS  271
             + LE     K  G  V V+        G D+     + E++++  + G+EF      + 
Sbjct  218  VIGLELGSVYKRLGAKVTVVEYLDSACSGMDK---GAVKEFLKLLKKQGLEF---QFGTK  271

Query  272  ITKLE-DGKLLVKWTLP----DGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTG  326
            +T  E +G ++   T P    DGS  +   DTVL ATGR      L L++ G++ + K G
Sbjct  272  VTASEVNGDVVTLTTEPANGGDGSTIK--CDTVLVATGRRAFTAGLGLEQMGIQTD-KQG  328

Query  327  RILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVF  385
            RI V +  QT  P +FAIGDVI    L   A + G      +      + +Y  +   ++
Sbjct  329  RIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKHGHV-NYGAIPNVIY  387

Query  386  TPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRD  445
            T  E+   G +EEE       + +E Y+    P+  A S     + A+  +KV+ DK  D
Sbjct  388  TFPEFASVGKTEEE----LKAEGVE-YNVGKFPM-MANSRARTVAEADGMVKVLADKKTD  441

Query  446  LFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
               +G H +  NAGE+     + ++ G   E +      HP
Sbjct  442  KL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  481

>PHYRA_72215
Length=499

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 113/435 (26%), Positives = 183/435 (42%), Gaps = 32/435 (7%)

Query  66   TKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALFGWQFENAPKF--DWSQLASSVS  122
            ++  LGGTC+NVGCIP K L+H + L+    H D   +G    +AP    ++ Q+  +  
Sbjct  63   SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSYGI---DAPGVTANFPQMMKAKE  118

Query  123  TYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS------Nprkpsktvttrrvvva  176
              + TL    +   +  KV Y    G       + ++      N    +K +        
Sbjct  119  KAVTTLTGGIESLFKKNKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEV  178

Query  177  vggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVM-V  235
                P  +    G++ I S         P   +VVGA  + LE     K  G  V V+  
Sbjct  179  TPLPPVPVDNAAGKI-IDSTGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEF  237

Query  236  RSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEA  295
            +     G D++      + ++ + G++F      + +T  E    +VK T         A
Sbjct  238  QDAACPGMDKEAVKEFTKLLKKQ-GLDF---KFGTKVTASEVNGDVVKLTTEAAKGGNAA  293

Query  296  F---DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPE  351
                DTVL ATGR      L L++ G++ + K GRI V +  +T  P IFAIGDVI    
Sbjct  294  TIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAM  352

Query  352  LTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEV  411
            L   A + G      +      + +Y  +   ++T  E+   G +EEE       + IE 
Sbjct  353  LAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-  406

Query  412  YHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKL  471
            Y+    P+  A S     + A+  +KV+ DK  D  ++G H +  NAGE+     +A++ 
Sbjct  407  YNVGKFPM-MANSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEY  464

Query  472  GFTYEQMVSVVGIHP  486
            G + E +      HP
Sbjct  465  GASSEDIARTCHAHP  479

>PHYCA_123621
Length=495

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 122/466 (26%), Positives = 194/466 (42%), Gaps = 58/466 (12%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H D   +
Sbjct  45   IKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSY  95

Query  103  GWQFENAP--KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLG----------AF  150
            G    +AP  K ++ Q+  +    + TL    +   +  KV Y    G          A 
Sbjct  96   GI---DAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIKGFGKVSAQGEVSVAL  152

Query  151  VDP---HTIELSNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGK  207
             D     T++  N    + +  T    V V      +    G LS+T          P  
Sbjct  153  NDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKIIDSTGALSLTR--------VPEH  204

Query  208  TLVVGASYVALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRE  266
             +VVGA  + LE     K  G  V V+        G D+       + ++ + G++F   
Sbjct  205  LVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKLLK-KQGLDF---  260

Query  267  TVPSSITKLEDGKLLVKWTLP-----DGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKL  321
               + +T  E    +VK T       D S+ E   DTVL ATGR      L L++ G++ 
Sbjct  261  KFSTKVTASEVNGDVVKLTTEPSKGGDASSIE--CDTVLVATGRRAFTAGLGLEQMGIQT  318

Query  322  NPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKV  380
            + K GRI V +  +T  P IFAIGDVI    L   A + G      +      + +Y  +
Sbjct  319  D-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAI  376

Query  381  CTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVIC  440
               ++T  E+   G +EEE       + +E Y+    P+  A S     + A+  +KV+ 
Sbjct  377  PGVIYTFPEFASVGKTEEE----LKAEGVE-YNVGKFPM-MANSRARTVAEADGLVKVLA  430

Query  441  DKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            DK  D   +G H +  NAGE+     + ++ G   E +      HP
Sbjct  431  DKKTDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHP  475

>PHALS_09942
Length=496

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 118/463 (25%), Positives = 192/463 (41%), Gaps = 52/463 (11%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H      
Sbjct  46   IKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH------  91

Query  103  GWQFEN----APKF--DWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI  156
              +F+N    AP+   ++ Q+  +    +KTL    +   +  KV Y    G       +
Sbjct  92   --EFKNYGIDAPEVTANFPQMMKAKDKAVKTLTSGIESLFKKNKVTYIKGSGKISAQGEV  149

Query  157  ELS------NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLV  210
             ++      N    +K +            P  +    G++ + S      K  P   +V
Sbjct  150  SVALHDHKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-VDSTGALELKRIPDHLVV  208

Query  211  VGASYVALECAGFLKGQGYDVKVMVRSIL---LRGFDQDMANRIGEYMEVEAGIEFIRET  267
            VGA  + LE     K  G   KV V   L     G D+       + ++ + G+EF    
Sbjct  209  VGAGVIGLELGSVYKRLG--AKVTVVEYLDDACTGMDKGSVKDFIKLLK-KQGLEF---K  262

Query  268  VPSSITKLEDGKLLVKWTLPDGSNHEEAF---DTVLNATGRNPDVDKLALDKAGVKLNPK  324
              + +T  E    +VK T       + A    DTVL ATGR      L L++ G++ + K
Sbjct  263  FGTKVTASEINGDVVKLTTEPSQGGDAASIECDTVLVATGRRAFTAGLGLEQMGIQTD-K  321

Query  325  TGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTA  383
             GRI V    +T  P IFAIGDVI    L   A + G +    +   +   ++Y  +   
Sbjct  322  FGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEEG-IACAEIIAGKHGHVNYGAIPGV  380

Query  384  VFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKT  443
            ++T  E+   G +EEE       + IE Y+    P+  A S       ++  +KV+ DK 
Sbjct  381  IYTFPEFASVGKTEEE----LKAEGIE-YNVGKFPM-MANSRARTVGESDGMVKVLADKK  434

Query  444  RDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             D   +G H +  NAGE+     + ++ G   E +      HP
Sbjct  435  TDKL-LGVHIIASNAGEMISEGVIGIEYGAASEDVARTSHAHP  476

>SPRG_09825
Length=492

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 113/465 (24%), Positives = 190/465 (41%), Gaps = 56/465 (12%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            ++A++ G K   ++        ++  LGGTC+NVGCIP K +  +         D    G
Sbjct  42   IKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALLSATHKYHAAQHDFKNVG  93

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELS----  159
             + +   + D+++L +S    +K L    +   +  KV Y    G  V  + + ++    
Sbjct  94   IEVDGL-RIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYIKGFGKIVAKNQVSVALNEG  152

Query  160  -NprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTAPGKTLVVGASYVAL  218
             N    +K +            P  +    G++ I S      K  P   +V+G   + L
Sbjct  153  GNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALSLKRIPEHLVVIGGGVIGL  211

Query  219  ECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEF------------IRE  266
            E        G  + V+           + A++I   M+ E G EF            + +
Sbjct  212  EMGSVYGRLGAKITVV-----------EYADKICPTMDFETGREFQKLLKKQGMNFQLGQ  260

Query  267  TVPSSITKLEDGKLLVKWTLPDGSNHEEAF---DTVLNATGRNPDVDKLALDKAGVKLNP  323
             V +S  K+E  K  V  T+   +  E      DTVL ATGR P    L L++ G++ + 
Sbjct  261  KVTAS--KVEGDK--VTLTVEPAAGGEATTIECDTVLVATGRRPFTKGLGLEEMGIQTD-  315

Query  324  KTGRILV--TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVC  381
            K GRI V  +N +T+  NIFAIGD I+   L   A + G      +      + +Y  + 
Sbjct  316  KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAGGHGHV-NYNAIP  374

Query  382  TAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICD  441
              V+T  E    G +EEE        N+  Y+    P+  A S        + ++K++  
Sbjct  375  GVVYTFPEVASVGKTEEE----LKAANV-AYNVGKFPM-MANSRARTVGETDGFVKILAA  428

Query  442  KTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            K  D  ++G H +  NAGE+     L ++ G + E +      HP
Sbjct  429  KDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHP  472

>SDRG_06945
Length=492

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 111/464 (24%), Positives = 189/464 (41%), Gaps = 54/464 (12%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            ++A++ G K   ++        ++  LGGTC+NVGCIP K +  +         D    G
Sbjct  42   IKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALLSATHKYHAAQHDFKNVG  93

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPH--TIELSNp  161
             + +   + D+++L +S    +K L    +   +  K+ Y    G  V  +  ++ L++ 
Sbjct  94   IEVDGL-RIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYIKGFGKIVAKNQVSVALNDG  152

Query  162  rkpsktvttrrvvvavggrprllpcpggELS--ITSDDIFWRKTAPGKTLVVGASYVALE  219
               + +     +       P        E    I S      K  P   +V+G   + LE
Sbjct  153  GNKTVSTKNILIATGSEVTPLPPVPVDNEAGKIIDSTGALSLKRIPEHLVVIGGGVIGLE  212

Query  220  CAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEF------------IRET  267
                    G  + V+           + A++I   M+ E G EF            + + 
Sbjct  213  MGSVYGRLGAKITVV-----------EYADKICPTMDFETGREFQKLLKKQGMNFQLGQK  261

Query  268  VPSSITKLEDGKLLVKWTLPDGSNHEEAF---DTVLNATGRNPDVDKLALDKAGVKLNPK  324
            V +S  K+E  K  V  T+   +  E      DTVL ATGR P    L L++ G++ + K
Sbjct  262  VTAS--KVEGDK--VTLTVEPAAGGEATTIECDTVLVATGRRPFTKGLGLEEMGIQTD-K  316

Query  325  TGRILV--TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCT  382
             GRI V  +N +T+  NIFAIGD I+   L   A + G      +      + +Y  +  
Sbjct  317  FGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAGGHGHV-NYNAIPG  375

Query  383  AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDK  442
             V+T  E    G +EEE ++  G      Y+    P+  A S        + ++K++  K
Sbjct  376  VVYTFPEVASVGKTEEE-LKAAG----VAYNVGKFPM-MANSRARTVGETDGFVKILAAK  429

Query  443  TRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
              D  ++G H +  NAGE+     L ++ G + E +      HP
Sbjct  430  DDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHP  472

>CCI50816
Length=807

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 108/458 (24%), Positives = 194/458 (42%), Gaps = 41/458 (9%)

Query  36   SKPQA-NGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEV  94
            S P A N  ++A+K G+ V ++D         K  +GG CV+ G IP K   + A++   
Sbjct  37   SGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE-AVLHLS  87

Query  95   MHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPH  154
             ++    +G  + +        +   V+  I++     +V  +  +V Y +    F D H
Sbjct  88   GYRHHGFYGKSY-SMKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVDYISGHARFEDDH  146

Query  155  TIELSNprkpsktvttrrvvvavggrprllpcpgg-------ELSITSDDIF-WR-KTAP  205
             + +     P+    T+R+  +                    ++   SD I  W  +  P
Sbjct  147  QVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILSWNIRQLP  206

Query  206  GKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQDMANRIGEYMEVEAGIEF  263
               +VVGA  + +E A  L   +G+ V V+  R  +L   D ++ + +   M        
Sbjct  207  RSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMRNHGARFL  266

Query  264  IRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNP  323
            + ET+  S+ K   G L+    L  G   +   D +L   GR  + D L L+ AG+  NP
Sbjct  267  LGETI-ESVDKSSRGVLV---GLKSGK--KVHGDALLYVVGRQANTDGLNLEAAGLSRNP  320

Query  324  KTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN----NETTLMDYEK  379
            +    + T  QT  P+IFA+GD I AP L   +++ GRL +  ++N    N+ ++    K
Sbjct  321  RGLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDDSIPSQLK  380

Query  380  VCT---AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYL  436
                   ++T  E    G +E++   +  + N E+    ++ L          + A+  L
Sbjct  381  TGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELAKG---QMSGASADGML  435

Query  437  KVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFT  474
            K++ D    L + G H +G  A E+     +A+ +G T
Sbjct  436  KILFD-PHSLKLFGVHAIGEGATEIIHIGQVAIAMGAT  472

>CCA16670
Length=520

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 113/465 (24%), Positives = 192/465 (41%), Gaps = 55/465 (12%)

Query  36   SKPQA-NGEVEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEV  94
            S P A N  ++A+K G+ V ++D         K  +GG CV+ G IP K   ++     V
Sbjct  37   SGPSASNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFREA-----V  83

Query  95   MHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLN--FKYKVDL-----RDKKVKYENFL  147
            +H    L G++        +S    ++   +  +N   + +VD      +  ++ Y +  
Sbjct  84   LH----LSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDFLRTQFKSARIDYISGH  139

Query  148  GAFVDPHTIELSNprkpsktvttrrvvvavggrprllpcpgg-------ELSITSDDIF-  199
              F D H + +     P+   TT+R+  +                    ++   SD I  
Sbjct  140  ARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILS  199

Query  200  WR-KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYME  256
            W  +  P   +VVGA  + +E A  L   +G+ V V+  R  +L   D ++ + +   M 
Sbjct  200  WNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMR  259

Query  257  VEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDK  316
               G  F+   +  S+ K   G   V   L  G       D +L   GR  + D L L+ 
Sbjct  260  -NHGARFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDGLNLEA  313

Query  317  AGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN-NETTLM  375
            AG+  NP+    + T  QT  P+IFA+GD I AP L   +++ GRL +  ++N NE    
Sbjct  314  AGLSRNPRGLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEANDD  373

Query  376  DYEKVCT------AVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRP  429
                  T       ++T  E    G +E+E      + N E+    ++ L          
Sbjct  374  SIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSL--KMNYEIGVAKYSELA---KGQMSG  428

Query  430  SMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFT  474
            + A+  LK++ D    L + G H +G  A E+     +A+ +G T
Sbjct  429  ASADGMLKILFDPI-SLKLYGVHAIGEGATEIIHIGQVAIAMGAT  472

>PHYRA_73883
Length=551

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 145/314 (46%), Gaps = 32/314 (10%)

Query  195  SDDIFWRK--TAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K  T P + +VVGA  V +E A  +    G DV V+  R  +L   D++++  
Sbjct  223  SDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADKEVSEG  282

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+ E    S+ K ++G++ V       S      D +L   GR  +V+
Sbjct  283  LC-YSMAQTGTRFLTEETIKSVEKADNGEIFVHLE----SGKTVVGDGLLYTVGRQGNVE  337

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRL-------  362
             L L+  G+  + K GRI V N  QT+ P+I+A GD+I  P L   +++ GRL       
Sbjct  338  GLNLEAVGLAPD-KRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  396

Query  363  ---LARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPL  419
               L  ++ +++  + D ++V T + +  E    G+     I   G++  ++  +  TP 
Sbjct  397  SKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKEQ-TPY  454

Query  420  EWALS---DDTRPSMAN---CYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG  472
            E  ++   +  R  M      +LK+I C  T  L ++G H +G  A E+     + M  G
Sbjct  455  EVGMARYEELARGQMLGGVPGFLKIIFCPDT--LKILGVHAIGEGATEIIHIGQVVMSTG  512

Query  473  FTYEQMVSVVGIHP  486
               E   + V  +P
Sbjct  513  GNLEYFRNAVFNYP  526

>PYIW_19795
Length=519

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 104/457 (23%), Positives = 183/457 (40%), Gaps = 57/457 (12%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            +E++K G++V V+D         K  +GG CV+ G IP K   ++     V+H    L G
Sbjct  53   IESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFREA-----VLH----LSG  95

Query  104  WQFENAPKFDWSQLASSVSTYI----KTLNFKY---KVDLRDKKVKYENFLGAFVDPHTI  156
            ++        +S    ++   +    + +N +    K  L+  +V+Y   L  F   H I
Sbjct  96   YRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGLARFEGDHEI  155

Query  157  ELSNprkpsktvttrrvvvavggrprllpcp-------------ggELSITSDDIFWR--  201
             +      ++                                   G++   SD I     
Sbjct  156  SIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKVIFDSDQILSGDI  215

Query  202  KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEA  259
            +  P   +VVGA  + +E A  L    G+ V V+  R  +L   D ++ + +   M  + 
Sbjct  216  RELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEIISNLTYEMRSKG  275

Query  260  GIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGV  319
                + ET+   + K EDG      T+   S      D +L   GR    D L L+   +
Sbjct  276  ARFLLGETI-KQVEKTEDG-----VTVHFNSGKTATADALLYTVGRQASTDGLNLEAVNL  329

Query  320  KLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE----TTLM  375
              NP+    + T+ QT+  +I+A GD I AP L   +++ GRL A  +++ E    T+ +
Sbjct  330  ARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQEEQLVTSQL  389

Query  376  DYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCY  435
            +       ++T  E    G +E++  +     N E+    ++ L          S A   
Sbjct  390  ENGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYEIGIAKYSELA---KGQMSGSTAGGM  444

Query  436  LKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG  472
            LK++ D T  L ++G H +G  A E+     +AM +G
Sbjct  445  LKILFDPT-TLKLLGVHAIGEGATEIIHIGQVAMAMG  480

>PYAR_16840
Length=536

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 106/474 (22%), Positives = 187/474 (39%), Gaps = 66/474 (14%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            VE+++ G++V V+D        T+ G+GG CV+ G IP K   + A++    ++    +G
Sbjct  53   VESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYG  103

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprk  163
              + +        +   V   + +     K  L+  ++ Y   L  F + H I + +   
Sbjct  104  KSY-SMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARIDYLPGLARFENEHEISIQSDIT  162

Query  164  psktvttrrvvvavggrprllpcpgg---------ELSITSDDIF--WRKTAPGKTLVVG  212
                  +    V                       ++ + SD I     +  P   +VVG
Sbjct  163  AGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDSDQILSGALRELPRSLIVVG  222

Query  213  ASYVALECAGFLKG-QGYDVKVM-----VRSILLRGFDQDMANR----------------  250
            A  + +E A  L    G+ V V+     VR++L     +DM+ R                
Sbjct  223  AGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SRDMSLRPQGICPFLWQILSFCD  279

Query  251  --IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPD  308
              I   ++ E  ++  R  +  +I K+E     VK  L  G     + D +L   GR   
Sbjct  280  DEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLTSGK--VTSGDALLYTVGRQAS  337

Query  309  VDKLALDKAGVKLNPKTGRILVTNE--QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARR  366
             D L L+  G+  N +   +L  N+  QT  P+I+A+GD I AP L   +++ GRL A  
Sbjct  338  TDGLNLEAVGLGRNKRG--LLTVNKAYQTEKPHIYAVGDCIGAPSLASTSMEQGRLAACH  395

Query  367  LYNNE---TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWAL  423
            ++      T+ ++       ++T  E    G +E++      + N E+    ++     L
Sbjct  396  MWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE--KVNYEIGLAKYSE----L  449

Query  424  SDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            +       A   LK++ D    L V G H +G  A E+     + +AM    TY
Sbjct  450  AKGQMSGGAFGMLKILFDPD-TLRVHGVHAIGEGATEIIHIGQVAIAMGCSLTY  502

>PPTG_13000
Length=387

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 84/301 (28%), Positives = 128/301 (43%), Gaps = 22/301 (7%)

Query  193  ITSDDIFWRKTAPGKTLVVGASYVALECAGFLKGQGYDVKVM-VRSILLRGFDQDMANRI  251
            I S      K  P   +VVGA  + LE     K  G  V V+        G D++     
Sbjct  82   IDSTGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGMDKEAVKEF  141

Query  252  GEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLP-----DGSNHEEAFDTVLNATGRN  306
             + ++ + G++F      + +T  E    +VK T       D S  E   DTVL ATGR 
Sbjct  142  TKLLK-KQGLDF---KFGTKVTSSEVNGDVVKLTTEPSKGGDASTIE--CDTVLVATGRR  195

Query  307  PDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365
                 L L++ G++ + K GRI V +  +T  P IFAIGDVI    L   A + G     
Sbjct  196  AFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVE  254

Query  366  RLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSD  425
             +      + +Y  V   ++T  E+   G +EEE       + IE Y+    P+  A S 
Sbjct  255  NIAGKHGHV-NYGAVPGVIYTFPEFASVGKTEEE----LKAEGIE-YNVGKFPM-MANSR  307

Query  426  DTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIH  485
                + ++  +KV+ DK  D   +G H +  NAGE+     + ++ G   E +      H
Sbjct  308  ARTVAESDGLVKVLADKKTDKL-LGVHIIASNAGEMIAEGVIGIEYGAASEDLARTCHAH  366

Query  486  P  486
            P
Sbjct  367  P  367

>PHYSO_489418
Length=471

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 140/313 (45%), Gaps = 30/313 (10%)

Query  195  SDDIFWRK--TAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K  T P + +VVGA  V +E A  +    G DV V+  R  +L   D++++  
Sbjct  145  SDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKEVSEA  204

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+      S+ K   G++ V       S      D +L   GR  +V+
Sbjct  205  LC-YSMAQTGTRFLVGETIKSVEKTPKGEVFVHLE----SGKTVVGDGLLYTVGRQGNVE  259

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L+  G+ +  K GRI V N  QT+ P+I+A GD+I  P L   +++ GRL +  +  
Sbjct  260  GLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  318

Query  370  ----NETTLMDYEKV--CTAVFTPIEYGCC---GLSEEESIERFGEDNIEVYHQNFTPLE  420
                N   L D +K+     V T +  G     G+     I   G++  ++  +   P E
Sbjct  319  SKPLNNKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VPYE  377

Query  421  WALS---DDTRPSMAN---CYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGF  473
              ++   +  R  M      +LK+I C +T  L ++G H +G  A E+     + M  G 
Sbjct  378  VGMARYEELARGQMLGGLPGFLKIIFCPET--LKILGVHAIGEGATEIIHIGQVVMSTGG  435

Query  474  TYEQMVSVVGIHP  486
            T E   + V  +P
Sbjct  436  TLEYFRNAVFNYP  448

>PYU1_G011605
Length=524

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 103/459 (22%), Positives = 186/459 (41%), Gaps = 52/459 (11%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            +E++K G++V ++D         K  +GG CV+ G IP K   + A++    ++    +G
Sbjct  57   IESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYG  107

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTI-------  156
              + +        +   V   + +     K  L+  +V+Y      F + H I       
Sbjct  108  KSY-SMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGFARFENDHEISIVRDPE  166

Query  157  --------ELSNprkpsktvttrrvvvavggrprllpcpggEL----SITSDDIFWRKTA  204
                    E++N     +                 +P  G  +     I S DI   +  
Sbjct  167  TGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIFDSDQILSGDI---RDL  223

Query  205  PGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIE  262
            P   +VVGA  + +E A  L    G+ V V+  R  +L   D ++ + +   M  +    
Sbjct  224  PRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIISNLTYEMRSKGARF  283

Query  263  FIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLN  322
             + ET+ + + K  +G      T+   S    + D +L   GR    D L L+   +  N
Sbjct  284  LLGETI-NRVEKTGNG-----VTVYLNSGKVTSADAMLYTVGRQASTDGLNLEAVNLSRN  337

Query  323  PKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE----TTLMDYE  378
            P+    +  + QT  P+I+A+GD I AP L   +++ GRL A  +++ E    T+ ++  
Sbjct  338  PRGLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHMWDQEEQLVTSQLENG  397

Query  379  KVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKV  438
                 ++T  E    G +E++ + + G  N E+    ++ L          S A   LK+
Sbjct  398  NYPYGIYTIPEISMVGKTEQQ-LTKEGV-NFEIGIAKYSELA---KGQMSGSTAGGMLKI  452

Query  439  ICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            + D T  L + G H +G  A E+     + +AM    TY
Sbjct  453  LFDPT-TLKLFGVHAIGEGATEIIHIGQVAIAMGCSVTY  490

>PHYCA_504445
Length=548

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 82/318 (26%), Positives = 139/318 (44%), Gaps = 40/318 (13%)

Query  195  SDDIFWRK--TAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K  T P + ++VGA  V +E A  +    G DV V+  R  +L   D++++  
Sbjct  223  SDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKEVSEA  282

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+      S+ K   G++ V       S      D +L   GR  +V+
Sbjct  283  LC-YSMAQTGTRFLTGETIKSVEKTAKGEVFVHLE----SGKTVVGDGLLYTVGRQGNVE  337

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L+  G++ + K GRI V N  QT+ P+I+A GD+I  P L   +++ GRL +  +  
Sbjct  338  GLNLEAVGLEPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  396

Query  370  NET----------TLMDYEKVCT----------AVFTPIEYGCCGLSEEESIERFGEDNI  409
            ++T           + D ++V T           ++T  E    G +E++  +   +   
Sbjct  397  SKTLNTKELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKE--QVPY  454

Query  410  EVYHQNFTPLEWALSDDTRPSMANCYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLA  468
            EV    +  L         P     +LK+I C +T  L ++G H +G  A E+     + 
Sbjct  455  EVGKARYEELARGQMLGGVPG----FLKIIFCPET--LKILGVHAIGEGATEIIHIGQVV  508

Query  469  MKLGFTYEQMVSVVGIHP  486
            M  G   E   + V  +P
Sbjct  509  MSTGGDLEYFRNAVFNYP  526

>PPTG_00938
Length=550

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 140/314 (45%), Gaps = 32/314 (10%)

Query  195  SDDIFWRK--TAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD++ W K  + P + ++VGA  V +E A  +    G DV V+  R  +L   D+ ++  
Sbjct  225  SDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEA  284

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+      S+ K   G++ V       S      D +L   GR  +V+
Sbjct  285  LC-YSMTQTGTRFLTGETIKSVEKSPKGEVFVHLE----SGKTVVGDGLLYTVGRQGNVE  339

Query  311  KLALDKAGVKLNP-KTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLY  368
             L L+  G  L+P K GRI V N  QT+ P+I+A GD+I  P L   +++ GRL +  + 
Sbjct  340  GLNLEAVG--LSPDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMR  397

Query  369  N----NETTLMDYEKV--CTAVFTPIEYGCC---GLSEEESIERFGEDNIEVYHQNFTPL  419
                 N+  L D +K+     V T +  G     G+     I   G++  ++  +   P 
Sbjct  398  TSKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VPY  456

Query  420  EWALS---DDTRPSMAN---CYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG  472
            E  ++   +  R  M      +LK+I C  T  +F  G H +G  A E+     + M  G
Sbjct  457  EVGVARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTG  514

Query  473  FTYEQMVSVVGIHP  486
             T E   + V  +P
Sbjct  515  GTLEYFRNAVFNYP  528

>SDRG_14446
Length=495

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 113/449 (25%), Positives = 192/449 (43%), Gaps = 46/449 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL-IGEVMHKDAALF  102
            +E+ K G+ V V+D         K G+GG CV+ G IP K   +S L +    H+     
Sbjct  45   IESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFRESVLHLSGFRHQGFYGK  96

Query  103  GWQFENAPKFD-WSQLASSVSTYIKTLNFKYK---VDLRDKKVKYENFLGAFVDPHTIEL  158
             +  +N    D   ++ + VS  +  +  + K   VDL     ++EN      +  ++E 
Sbjct  97   SYARDNITLNDILGRVNTVVSKEMDVIQAQLKAARVDLVPGLARFEN-----ENEVSVEG  151

Query  159  SNprkpsktvttrrvvvavggrprllpcpggELSITSDDIFWRKTA--PGKTLVVGASYV  216
             + +          V          L    G++ + SD I    T   P   +VVGA  +
Sbjct  152  DDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILNHGTTKLPKSWIVVGAGVI  211

Query  217  ALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK  274
             +E A  L    G +V V+  R+ +L   D ++ + +   M    G  F+   +  SI  
Sbjct  212  GMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLKMEMR-HKGARFL---LGESIKS  267

Query  275  LEDGKLLVKWTLPDGSNHEEAF-DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333
            +E  K  VK     G   +  F + +L   GR  + D L L+  G+  N + G I V  +
Sbjct  268  VEHFKNGVKVEFNSG---KAMFAEALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQ  323

Query  334  -QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE---TTLMDYEKVCTAVFTPIE  389
             QTS P+I+A GD I AP L   +++ GRL A  +++++   T+ ++       ++T  E
Sbjct  324  YQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPE  383

Query  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPL-EWALSDDTRPSMANCYLKVICDKTRDLFV  448
                G +E++  +     N  V    F+ L +  +S D         LK++ D    L +
Sbjct  384  ISMVGKTEQQLTKEGA--NYAVGLAKFSELAKGQMSGDIEG-----ILKLLFDPV-SLQL  435

Query  449  VGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            +G H +G  A E+     + +AM    TY
Sbjct  436  LGVHAIGHGATEIIHIGQVAMAMNCKLTY  464

>PYVX_20512
Length=528

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 106/464 (23%), Positives = 185/464 (40%), Gaps = 57/464 (12%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            +E++K G++V ++D         +  +GG CV+ G IP K   + A++    ++    +G
Sbjct  54   MESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYG  104

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprk  163
              + +        +   V   + +     K  L+  +V Y     +F  PH  ELS    
Sbjct  105  KSY-SMKNITIDDILYRVQRVVASEVDVIKAQLKAARVDYIAGTASFESPH--ELSISMD  161

Query  164  psktvttrrvvvavggrprllpcpggELSIT--------------------SDDIFWRKT  203
             + +      V+              +  I                     SD I   + 
Sbjct  162  STDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLVPVDGKVVFDSDQILSGQI  221

Query  204  A--PGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEA  259
               P   +VVGA  + +E A  +    G+ V V+  R  +L   D ++ + +   M  + 
Sbjct  222  HQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILSFCDTEIISNLMYEMRSKG  281

Query  260  GIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGV  319
                + ET+  SI K E G   VK     G       D +L   GR    D L L+  G+
Sbjct  282  ARFLLGETI-KSIEKSERG---VKVFFNSGK--VATADALLYTVGRQASTDGLNLEAVGL  335

Query  320  KLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE-----TTL  374
              NP+    +  N QT   +I+A GD I AP L   +++ GRL A  +++++     T+ 
Sbjct  336  SRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAACHMWDDQAQLQSTSQ  395

Query  375  MDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANC  434
            +D       ++T  E    G +E++ + + G  N EV    ++ L          ++A  
Sbjct  396  LDNGNYPYGIYTIPEISMVGKTEQQ-LTKEGV-NYEVGIAKYSELA---KGQMTGAIAGG  450

Query  435  YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
             LK++ C  + +LF  G H +G  A E+     + +AM    TY
Sbjct  451  MLKILFCPDSLELF--GVHAIGEGATEIIHIGQVAIAMGCSLTY  492

>H257_01186
Length=496

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 104/448 (23%), Positives = 187/448 (42%), Gaps = 42/448 (9%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL-IGEVMHKDAALF  102
            +E++K G+ V ++D  +         +GG CV+ G IP K   ++ L +    H     +
Sbjct  45   LESAKMGKSVAIIDKSEE--------IGGVCVHTGTIPSKTFREAVLHLSGFNHH--GFY  94

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNpr  162
            G  +    +   S +   V+  + +     +  L+   V+       F + + + + N  
Sbjct  95   GKSYSR-ERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGKARFENANEVSVENGT  153

Query  163  kpsktvttrrvvvavggrprllpcpgg----ELSITSDDIF--WRKTAPGKTLVVGASYV  216
               + +  R     +         P      E+ + SD I    +   P   +VVGA  +
Sbjct  154  VHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGILEASKGELPKSWIVVGAGVI  213

Query  217  ALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITK  274
             +E A  L    G  V V+  R  +L   D ++ + +   M  +     + ET+  S+T+
Sbjct  214  GMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALKMEMRHKGARFLLGETI-QSVTR  272

Query  275  LEDGKLLVKWTLPDG-SNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333
            +  G   V+     G S+  EA    L   GR  + D L L+  G+  N K G + V  +
Sbjct  273  VAKG---VRVDFASGKSSFAEAL---LYCVGRQANTDALNLEGVGLAKN-KRGLLTVNKQ  325

Query  334  -QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE---TTLMDYEKVCTAVFTPIE  389
             QTS P+I+A GD I AP L   +++ GRL A  ++++E   T+ +D       ++T  E
Sbjct  326  YQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQPTSQLDSGNYPYGIYTIPE  385

Query  390  YGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVV  449
                G +E++ + + G  N  V    ++ L   +    +       LK++ D      V+
Sbjct  386  ISMVGKTEQQ-LTKEGR-NYAVGMAKYSELAKGMMAGGQKGA----LKILFDPDTQ-SVL  438

Query  450  GFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            G H +G  A E+     + +AM    TY
Sbjct  439  GVHAIGQGATEIIHIGQVAMAMNCKITY  466

>PYIR_14132
Length=513

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 140/318 (44%), Gaps = 41/318 (13%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM--VRSILLRGFDQDMAN  249
            SD + W   K+ P + +VVGA  + +E A  +    G +V ++   + IL      DMA+
Sbjct  189  SDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEIL------DMAD  242

Query  250  R-IGE---YMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            R + E   Y   + G  F  E    S+ K ++G+++V       S      D +L   GR
Sbjct  243  REVSEALCYSMRQTGARFFVEETIKSVEKADNGEVIVHLN----SGKTLVGDGLLYTLGR  298

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLA  364
              + + L L   G++ + K G I V ++ QT  P+I+A GD I  P L   +++ GRL +
Sbjct  299  QGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLAS  357

Query  365  RRLYN---------NETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQN  415
              +           +ET   D + + T + +  E    G+     I   G++  ++  QN
Sbjct  358  VHMRTSKPTNKKGESETESTDPQYMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQN  416

Query  416  FTPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLA  468
              P E  ++     +          +LK+I C KT  L V+G H +G  A E+     + 
Sbjct  417  I-PYEVGVARYEELAKGQMLGGVPGFLKIIFCPKT--LQVLGVHAIGEGATEIIHIGQVV  473

Query  469  MKLGFTYEQMVSVVGIHP  486
            M  G T E   + V  +P
Sbjct  474  MSTGGTIEYFRNAVFNYP  491

>PYAP_19148
Length=535

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 75/313 (24%), Positives = 136/313 (43%), Gaps = 32/313 (10%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQDMANR  250
            SD I W      P + +VVGA  + +E A  +    G +V V+  R  +L   D+++A  
Sbjct  200  SDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEA  259

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            + +Y   + G  F  +   +++ K  +G+++VK      S      D +L   GR  + D
Sbjct  260  L-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLN----SGKTIVGDGLLYTVGRQGNTD  314

Query  311  KLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLA------  364
             L L   G++ + +    +  N +TS P+I+A GD I  P L   +++ GRL +      
Sbjct  315  GLNLAAVGLEADKRGLLKVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRLASVHMRSE  374

Query  365  ----RRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLE  420
                ++  +NE +   Y++          +G   + E   I   G+   ++  +N  P E
Sbjct  375  KPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE---ISMVGKSEQQLTRENI-PYE  430

Query  421  WALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGF  473
              ++     +          +LK++ C K+  L V+G H +G  A E+     + M  G 
Sbjct  431  VGVARYEELAKGQMLGGVPGFLKIVFCPKS--LQVLGVHAIGEGATEIIHIGQVVMSTGG  488

Query  474  TYEQMVSVVGIHP  486
            T E   + V  +P
Sbjct  489  TIEYFRNAVFNYP  501

>PITG_01778
Length=470

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 83/313 (27%), Positives = 137/313 (44%), Gaps = 30/313 (10%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W   K+ P + ++VGA  V +E A  +    G DV V+  R  +L   D+ ++  
Sbjct  145  SDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADKQVSEA  204

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+      S+ K   G++         S      D +L   GR  +V+
Sbjct  205  LC-YSMAQTGTRFLTGETIKSVEKSPKGEVFAHLE----SGKTVVGDGLLYTVGRQGNVE  259

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L+  G+  + K GRI V N  QT+ P+I+A GD+I  P L   +++ GRL +  +  
Sbjct  260  GLNLEAVGLAPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  318

Query  370  ----NETTLMDYEKV--CTAVFTPIEYGCC---GLSEEESIERFGEDNIEVYHQNFTPLE  420
                N+  L D +K+     V T +  G     G+     I   G++  ++  +   P E
Sbjct  319  SKPLNDLELSDDKKMDDPDRVRTRMRSGEVFPFGIYTVPEISMVGKNEQQLTKEQ-VPYE  377

Query  421  WALS---DDTRPSMAN---CYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGF  473
              ++   +  R  M      +LK+I C  T  +F  G H +G  A E+     + M  G 
Sbjct  378  VGVARYEELARGQMLGGVPGFLKIIFCPDTLKIF--GVHAIGEGATEIIHIGQVVMSTGG  435

Query  474  TYEQMVSVVGIHP  486
            T E   + V  +P
Sbjct  436  TLEYFRNAVFNYP  448

>PHYKE_9807
Length=557

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 81/316 (26%), Positives = 132/316 (42%), Gaps = 33/316 (10%)

Query  195  SDDIFWRKT--APGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K    P + ++VG   V +E A  +    G DV V+  R  +L   D++++  
Sbjct  229  SDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADKEVSEA  288

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+       + K   G++LV+      S      D +L   GR  +V+
Sbjct  289  LC-YSMAQTGTRFLVGETIKKVEKNSKGEVLVRLD----SGKTVVGDGLLYTVGRQGNVE  343

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L+  G+  + K GRI V N  QT  P+I+A GD+I  P L   +++ GRL +  +  
Sbjct  344  GLHLESVGIHPD-KRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  402

Query  370  N------------ETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFT  417
                         +  LMD            E    G+     I   G++  ++  Q   
Sbjct  403  ASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVPEISMVGKNEQQLT-QEQV  461

Query  418  PLEWALS---DDTRPSMAN---CYLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMK  470
            P E  ++   +  R  M      +LK+I C  T  L ++G H +G  A E+     + M 
Sbjct  462  PYEVGMARYEELARGQMLGGVPGFLKIIFCPNT--LQILGVHAIGEGATEIIHIGQVVMS  519

Query  471  LGFTYEQMVSVVGIHP  486
             G T E   + V  +P
Sbjct  520  TGGTLEYFRNAVMNYP  535

>PHYSO_562795
Length=415

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 80/297 (27%), Positives = 129/297 (43%), Gaps = 29/297 (10%)

Query  193  ITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQDMA  248
            I SD I  R     P   +V+GA  + +E A  +    G+ V V+  R  +L   D+++ 
Sbjct  101  IDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREII  160

Query  249  NRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPD  308
            + +   M+       + ETV     K+E  +  VK     G     + D +L   GR   
Sbjct  161  SNLTYEMQSNGARFLLGETVK----KVETTENRVKVFFDSGK--VLSADALLYTVGRQAS  214

Query  309  VDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLY  368
             D L L+  G+  N +    +  N QT  P+I+A GD I AP L   +++ GRL +  ++
Sbjct  215  TDGLNLEAVGLSRNHRGLINVNQNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMW  274

Query  369  NNE-----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGED--NIEVYHQNFTPLEW  421
            N +     T+ +D       ++T  E    G +E++      +D  N EV    ++ L  
Sbjct  275  NPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTEQQ----LTKDCVNYEVGIAKYSELAK  330

Query  422  ALSDDTRPSMANCYLKVICD-KTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG--FTY  475
                    +MA   LK++ D  T  LF  G H +G  A E+     +AM +G   TY
Sbjct  331  G---QMMGAMAGGTLKILFDPDTLKLF--GVHAIGEGATEIIHIGQVAMAMGCSLTY  382

>PITG_18935
Length=480

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 88/191 (46%), Gaps = 10/191 (5%)

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPV  355
            DTVL ATGR      L L++ G++ + K GRI V +  +T  P IFAIGDVI    L   
Sbjct  279  DTVLVATGRRAFTSGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHK  337

Query  356  AIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQN  415
            A + G      +      + +Y  +   ++T  E+   G +EEE       + IE Y+  
Sbjct  338  AEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGKTEEE----LKAEGIE-YNVG  391

Query  416  FTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTY  475
              P+  A S     + A+  +KV+ DK  D   +G H +  NAGE+     + ++ G   
Sbjct  392  KFPM-MANSRARTIAEADGLVKVLADKKTDKL-LGVHIIAGNAGEMIAEGVIGIEYGAAS  449

Query  476  EQMVSVVGIHP  486
            E +      HP
Sbjct  450  EDLARTCHAHP  460

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 15/103 (15%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H D   +
Sbjct  46   IKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQH-DFKSY  96

Query  103  GWQFENAP--KFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKY  143
            G    +AP  K ++ Q+  S    +KTL    ++  +  KV Y
Sbjct  97   GI---DAPEVKANFPQMMKSKEKAVKTLTGGIELLFKKNKVTY  136

>SDRG_05060
Length=559

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 138/324 (43%), Gaps = 43/324 (13%)

Query  190  ELSITSDDIFW--RKTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            EL   SD + W      P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  225  ELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADK  284

Query  246  DMANRI-------GEYMEVEAGIEFIRETVPSS--ITKLEDGKLLVKWTLPDGSNHEEAF  296
            ++++ +       G     E  I+F+ + +     +  L+ GK++V              
Sbjct  285  EVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG-------------  331

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVA  356
            D +L   GR  +V  L L+  G++ N +    +  N QTS P+I+A GD I  P L  V+
Sbjct  332  DALLYTQGRQGNVTGLDLEAVGLEANNRGYLEVNNNFQTSVPHIYAAGDCIGYPALASVS  391

Query  357  IQAGRLLARRLYNNETT---LMDYEKVCTAVF-TPIEYGCC---GLSEEESIERFGEDNI  409
            ++ GRL +  +  +E T     D +   T+ F T +  G     G+     I   G+   
Sbjct  392  MEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSEQ  451

Query  410  EVYHQNFTPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVT  462
            ++  +N  P E  ++     +          +LK+I C  T  L ++G H +G  A E+ 
Sbjct  452  QLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPST--LKLLGVHAIGEGATEII  508

Query  463  QAIGLAMKLGFTYEQMVSVVGIHP  486
                + M  G T E   + V  +P
Sbjct  509  HIGQVVMSTGGTLEYFRNAVFNYP  532

>SPRG_12054
Length=558

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 138/324 (43%), Gaps = 43/324 (13%)

Query  190  ELSITSDDIFW--RKTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            EL   SD + W      P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  224  ELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEILEMADK  283

Query  246  DMANRI-------GEYMEVEAGIEFIRETVPSS--ITKLEDGKLLVKWTLPDGSNHEEAF  296
            ++++ +       G     E  I+F+ + +     +  L+ GK++V              
Sbjct  284  EVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG-------------  330

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVA  356
            D +L   GR  +V  L L+  G++ N +    +  N QTS P+I+A GD I  P L  V+
Sbjct  331  DALLYTQGRQGNVTGLDLEAVGLEANNRGYLEVNNNFQTSVPHIYAAGDCIGYPALASVS  390

Query  357  IQAGRLLARRLYNNETT---LMDYEKVCTAVF-TPIEYGCC---GLSEEESIERFGEDNI  409
            ++ GRL +  +  +E T     D +   T+ F T +  G     G+     I   G+   
Sbjct  391  MEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISMVGKSEQ  450

Query  410  EVYHQNFTPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVT  462
            ++  +N  P E  ++     +          +LK+I C  T  L ++G H +G  A E+ 
Sbjct  451  QLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPST--LKLLGVHAIGEGATEII  507

Query  463  QAIGLAMKLGFTYEQMVSVVGIHP  486
                + M  G T E   + V  +P
Sbjct  508  HIGQVVMSTGGTLEYFRNAVFNYP  531

>PYU1_G005699
Length=550

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 134/317 (42%), Gaps = 42/317 (13%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W   KT P + +VVGA  + +E A  +    G +V ++  R  +L   D++++  
Sbjct  228  SDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMADREVSEA  287

Query  251  IGEYMEVEAGIEFIRETVPSS-------ITKLEDGKLLVKWTLPDGSNHEEAFDTVLNAT  303
            +   M       F+ ET+ S        I  L  GK LV              D +L   
Sbjct  288  LCYSMRQTGARFFVEETIKSVEKVNGEVIVHLNSGKTLVG-------------DGLLYTL  334

Query  304  GRNPDVDKLALDKAGVKLNPKTGRILV-TNEQTSTPNIFAIGDVIDAPELTPVAIQAGRL  362
            GR  + D L L   G++ + K G I V  N QT+ P+I+A GD I  P L   +++ GRL
Sbjct  335  GRQGNTDGLNLPAVGLEAD-KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTSMEQGRL  393

Query  363  LARRLYNNETTLMDYEKVCTA---VFTPIEYGCC---GLSEEESIERFGEDNIEVYHQNF  416
             +  +   + T    +   T    + T +  G     G+     I   G++  ++  +N 
Sbjct  394  ASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQLTKEN-  452

Query  417  TPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAM  469
             P E  L+     +          +LK+I C KT  L ++G H +G  A E+     + M
Sbjct  453  VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPKT--LQLLGVHAIGEGATEIIHIGQVVM  510

Query  470  KLGFTYEQMVSVVGIHP  486
              G T E   + V  +P
Sbjct  511  STGGTIEYFRNAVFNYP  527

>PHYRA_47253
Length=481

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 127/299 (42%), Gaps = 27/299 (9%)

Query  190  ELSITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQ  245
            ++ I SD I  R     P   +VVGA  + +E A  +    G+ V V+  R  +L   D+
Sbjct  169  QVVIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDR  228

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            ++ + +   M+       + ET    I K+E     VK     G     + D +L   GR
Sbjct  229  EIISNLTYEMQSNGARFLLGET----IKKVETADNRVKVFFDSGK--VLSADALLYTVGR  282

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365
                D L L+  G+  N +    +  N QT  P+I+A GD I AP L   +++ GRL + 
Sbjct  283  QASTDGLNLEAVGLSRNHRGLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASC  342

Query  366  RLYNNE-----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGED--NIEVYHQNFTP  418
             ++  +     T+ ++       ++T  E    G +E++      +D  N E+    ++ 
Sbjct  343  HMWKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQQ----LTKDCVNYEIGVAKYSE  398

Query  419  LEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            L          +MA   LK++ D    L V G H +G  A E+     + +AM    TY
Sbjct  399  LAKG---QMMGAMAGGTLKILFDPD-TLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTY  453

>PHALS_12028
Length=579

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 89/182 (49%), Gaps = 11/182 (6%)

Query  195  SDDIFWRK--TAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K  + P + +VVGA  + +E A  +    G DV V+  R  +L   D +++  
Sbjct  213  SDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEILNMADNEVSEA  272

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +   M  + G  F+   V  S+ K   G++ V       S      D +L   GR  +V+
Sbjct  273  LCFSM-AQTGTRFLTGEVIKSVEKSAMGEVFVHLE----SGKTVVGDGLLYTVGRQGNVE  327

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L+  G+ +  K G+I V N  QT+ P+I+A GD+I  P L   +++ GRL +  +  
Sbjct  328  GLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLASVHMRT  386

Query  370  NE  371
            ++
Sbjct  387  SQ  388

>PYIW_20257
Length=503

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 140/318 (44%), Gaps = 41/318 (13%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM--VRSILLRGFDQDMAN  249
            SD + W   K+ P + +VVGA  + +E A  +    G +V ++   R IL      DMA+
Sbjct  179  SDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREIL------DMAD  232

Query  250  R-IGE---YMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            R + E   Y   + G  F  E    S+ K ++G+++V       S      D +L   GR
Sbjct  233  REVSEALCYSMRQTGARFFVEETIKSVEKADNGEVIVHLN----SGKTLVGDGLLYTLGR  288

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLA  364
              + + L L+  G+K + K G I V ++ QT+ P+I+A GD I  P L   +++ GRL +
Sbjct  289  QGNTEGLNLEAIGLKAD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLAS  347

Query  365  RRLY---------NNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQN  415
              +          ++ET   D   + T + +  E    G+     I   G++  ++  Q 
Sbjct  348  VHMRTAKPTNKKGDSETESTDPAFMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQC  406

Query  416  FTPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLA  468
              P E  ++     +          +LK+I C  T  L V+G H +G  A E+     + 
Sbjct  407  I-PYEVGVARYEELAKGQMLGGVPGFLKIIFCPTT--LQVLGVHAIGEGATEIIHIGQVV  463

Query  469  MKLGFTYEQMVSVVGIHP  486
            M  G T E   + V  +P
Sbjct  464  MSTGGTIEYFRNAVFNYP  481

>H310_07641
Length=548

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 79/320 (25%), Positives = 129/320 (40%), Gaps = 36/320 (11%)

Query  190  ELSITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
             L   SD + W      P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  217  RLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEILDMADK  276

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            ++++ +  YM  + G  F+ E     +   +D +++V  T    S      D +L   GR
Sbjct  277  EVSDALCYYMR-QRGSRFLTEESILKVETKDDSEVVVHLT----SGKVIMGDALLYTQGR  331

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLA  364
              +V  L L+  G+  N K G + V N  QT+ P+I+A GD I  P L   +++ GRL +
Sbjct  332  QGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALASTSMEQGRLAS  390

Query  365  RRLYNNE------------------TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGE  406
              +  +E                  T +   E     ++T  E    G SE++      +
Sbjct  391  VHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSEQQ----LSK  446

Query  407  DNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIG  466
            +NI  Y       E          M      + C  T  L ++G H +G  A E+     
Sbjct  447  ENIP-YEVGIARYEELAKGQMLGGMPGFLKLIFCPTT--LKLLGVHAIGEGATEIIHIGQ  503

Query  467  LAMKLGFTYEQMVSVVGIHP  486
            + M  G T E   + V  +P
Sbjct  504  VVMSTGGTMEYFRNAVFNYP  523

>PHALS_10055
Length=516

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 100/453 (22%), Positives = 176/453 (39%), Gaps = 46/453 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            +E++K G++V ++D         K  LGG CV+ G IP K   + A++    ++    +G
Sbjct  48   IESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYG  98

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprk  163
              + +        +   V   + +     +  L+  +V        F + H I +     
Sbjct  99   KSY-SMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFARFENEHEISILRDVD  157

Query  164  psktvttrrvvvavggrprllpcpgg---------------ELSITSDDIFWR--KTAPG  206
                       V    R +                      ++ I SD I  R     P 
Sbjct  158  TQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHLLPR  217

Query  207  KTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFI  264
              +V+GA  + +E A  +    G+ V V+  R  +L   D ++ + +   M+       +
Sbjct  218  SLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCDLEIISNLTYEMQSNGARFLL  277

Query  265  RETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPK  324
             ETV     K+E  K  VK     G     + D +L   GR    D L L+  G+  N +
Sbjct  278  GETVK----KVETTKNQVKVFFNSGK--VLSADALLYTVGRQAATDGLNLEAVGLSRNHR  331

Query  325  TGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN-NE----TTLMDYEK  379
                +  N QT  P+I+A GD I AP L   +++ GRL +  ++  NE    T+ ++   
Sbjct  332  GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLASCHMWKPNEELAATSQLESGN  391

Query  380  VCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVI  439
                ++T  E    G +E++  +     N E+    ++ L          +MA   LK++
Sbjct  392  YPYGIYTIPEISMVGQTEQQLTKNC--INYEIGIAKYSELA---KGQMMGAMAGGTLKIL  446

Query  440  CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG  472
             D    L ++G H +G  A E      +AM +G
Sbjct  447  FDP-ETLSLLGVHAIGEGATETIHIGQVAMAMG  478

>PITG_19065
Length=416

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 127/296 (43%), Gaps = 27/296 (9%)

Query  193  ITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQDMA  248
            I SD I  R     P   +V+GA  + +E A  +    G+ V V+  R  +L   D+++ 
Sbjct  102  IDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDREII  161

Query  249  NRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPD  308
            + +   M+       + ETV     K+E     VK     G     + D +L   GR   
Sbjct  162  SNLTYEMQSNGARFLLGETVK----KVETTDKRVKVFFNSGK--ALSADALLYTVGRQAA  215

Query  309  VDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLY  368
             D L L+  G+  N +    +  N QT  P+I+A GD I AP L   +++ GRL +  ++
Sbjct  216  TDGLNLEAVGLSRNHRGLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMW  275

Query  369  NNE-----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGED--NIEVYHQNFTPLEW  421
            N +     T+ ++       ++T  E    G +E++      +D  N E+    ++ L  
Sbjct  276  NPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQ----LTKDCVNYEIGIAKYSELAK  331

Query  422  ALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG--FTY  475
                    +MA   LK++ D    L V G H +G  A E+     +AM +G   TY
Sbjct  332  G---QMMGAMAGGTLKILFDPD-TLKVFGVHAIGEGATEIIHIGQVAMAMGCSLTY  383

>PPTG_09121
Length=520

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 79/297 (27%), Positives = 127/297 (43%), Gaps = 29/297 (10%)

Query  193  ITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMA  248
            I SD I  R     P   +V+GA  + +E A  +    G+ V V+  R  +L   D ++ 
Sbjct  206  IDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDSEII  265

Query  249  NRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPD  308
            + +   M+       + ETV     K+E     VK     G     + D +L   GR   
Sbjct  266  SNLTYEMQSNGARFLLGETVK----KVETTDKRVKVFFNSGK--VLSADALLYTVGRQAA  319

Query  309  VDKLALDKAGVKLNPKTGRILVT-NEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRL  367
             D L L+  G+  N + G I V  N QT  P+I+A GD I AP L   +++ GRL +  +
Sbjct  320  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  378

Query  368  YNNE-----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGED--NIEVYHQNFTPLE  420
            +N +     T+ ++       ++T  E    G +E++      +D  N E+    ++ L 
Sbjct  379  WNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQ----LTKDCVNYEIGIAKYSELA  434

Query  421  WALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
                     +MA   LK++ D    L V G H +G  A E+     + +AM    TY
Sbjct  435  KG---QMMGAMAGGTLKILFDPD-TLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTY  487

 Score = 32.0 bits (71),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 8/47 (17%)

Query  44  VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL  90
           +E++K G++V ++D         K  LGG CV+ G IP K   ++ L
Sbjct  48  LESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFREAVL  86

>PYAP_19280
Length=512

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 101/456 (22%), Positives = 184/456 (40%), Gaps = 47/456 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFG  103
            VE+++ G++V V+D      +G+   +GG CV+ G IP K   + A++    ++    +G
Sbjct  46   VESARHGKRVAVVD------KGSS--VGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYG  96

Query  104  WQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNprk  163
              + +        +   V   + +     K  L+  +V Y      F + H I +     
Sbjct  97   KSY-SMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYIPGFARFENDHEISIVREPT  155

Query  164  psktvttrrvvvavggrprllpcp-------------ggELSITSDDIFWR--KTAPGKT  208
             +         +A   +                     G++   SD I     +  P   
Sbjct  156  ETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKVVFDSDQILSGDIRELPRSL  215

Query  209  LVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANRIGEYMEVEAGIEFIRE  266
            +VVGA  + +E A  L    G+ V V+  R  +L   D ++ + +   M V+ G  F+  
Sbjct  216  IVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEVVSMLQHEMRVK-GARFL--  272

Query  267  TVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTG  326
             +  SI K+E     VK  L  G     + D +L   GR  + D L ++  G+  N +  
Sbjct  273  -LGESIQKVEKTAKGVKVLLNSGK--VTSADALLYTVGRQANTDGLNIEAVGLSRNQRGL  329

Query  327  RILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNE----TTLMDYEKVCT  382
              +  + QT   +I+A+GD I AP L   +++ GRL A  +++      T+ ++      
Sbjct  330  LNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDGNCDIATSQLENGNYPY  389

Query  383  AVFTPIEYGCCGLSEEE-SIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICD  441
             ++T  E    G +E++ + E+    N E+    ++ L             N  LK++ D
Sbjct  390  GIYTIPEISMVGKTEQQLTAEKV---NYEIGIAKYSELAKG---QMGGGSHNGILKILFD  443

Query  442  KTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
                L + G H +G  A E+     + +AM    TY
Sbjct  444  PD-TLKLHGVHAIGEGATEIIHIGQVAIAMGCSLTY  478

>H257_16541
Length=494

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 90/192 (47%), Gaps = 11/192 (6%)

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV--TNEQTSTPNIFAIGDVIDAPELTP  354
            D VL ATGR P    L L++ G++ + K GRI V  +N QT+   IFAIGDVI+   L  
Sbjct  292  DCVLVATGRRPFTAGLGLEEMGIQTD-KFGRIKVNLSNFQTNVDGIFAIGDVIEGAMLAH  350

Query  355  VAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQ  414
             A + G  +   +      + +Y+ +   ++T  E    G +EEE        N+  Y+ 
Sbjct  351  KAEEEGIAVVETIAGKHGHV-NYDAIPGVIYTFPEVASVGKTEEE----LKTANV-AYNV  404

Query  415  NFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFT  474
               P+  A S        + ++KV+  K  D  ++G H +  NAGE+     L ++ G +
Sbjct  405  GKFPM-MANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGAS  462

Query  475  YEQMVSVVGIHP  486
             E +      HP
Sbjct  463  AEDIGRTCHAHP  474

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (47%), Gaps = 11/109 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L     H   ++ 
Sbjct  44   IKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALLHGTHLYHSAQHNFKSV-  94

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFV  151
            G + +N    D+ QL  S    +K L    +   +  KV Y    G  V
Sbjct  95   GIKVDNVS-IDFDQLMKSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVV  142

>SPRG_04114
Length=376

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 80/298 (27%), Positives = 135/298 (45%), Gaps = 28/298 (9%)

Query  190  ELSITSDDIFWRKTA--PGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            ++ + SD I    T   P   +VVGA  + +E A  L    G +V V+  R+ +L   D 
Sbjct  64   KIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDD  123

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAF-DTVLNATG  304
            ++ + +   M    G  F+   +  SI  +E  K  VK     G   +  F + +L   G
Sbjct  124  EIVSSLKMEMR-HKGARFL---LGESIKSVEHFKNGVKVEFNSG---KAMFAEALLYCVG  176

Query  305  RNPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLL  363
            R  + D L L+  G+  N + G I V  + QTS P+I+A GD I AP L   +++ GRL 
Sbjct  177  RQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLA  235

Query  364  ARRLYNNE---TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPL-  419
            A  +++++   T+ ++       ++T  E    G +E++  +     N  V    F+ L 
Sbjct  236  ACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQQLTKEGA--NYAVGLAKFSELA  293

Query  420  EWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
            +  +S D         LK++ D    L ++G H +G  A E+     + +AM    TY
Sbjct  294  KGQMSGDIEG-----ILKLLFDPV-SLQLLGVHAIGHGATEIIHIGQVAMAMNCKITY  345

>H310_00561
Length=497

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/298 (26%), Positives = 132/298 (44%), Gaps = 28/298 (9%)

Query  190  ELSITSDDIF--WRKTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            E+ + SD I    +   P   +VVGA  + +E A  L    G  V V+  R  +L   D 
Sbjct  186  EVILDSDGILDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDD  245

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAF-DTVLNATG  304
            ++ + +   M  +     + ET+ S        K + K    D ++ + +F + +L   G
Sbjct  246  EIVSALKMEMRHKGARFLLGETIQSV-------KRVRKGVRVDFASGKSSFAEALLYCVG  298

Query  305  RNPDVDKLALDKAGVKLNPKTGRILVTNEQ--TSTPNIFAIGDVIDAPELTPVAIQAGRL  362
            R  + D L L+  G+  N +   +L  NEQ  T+ P+IFA GD I AP L   +++ GRL
Sbjct  299  RQANTDTLNLEGVGLSKNKRG--LLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRL  356

Query  363  LARRLYNNE---TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPL  419
             A  ++ +E   T+ +D       ++T  E    G +E++ + + G  N  V    ++ L
Sbjct  357  AACAMWRHEDQPTSQLDSGNYPYGIYTIPEISMVGKTEQQ-LTKEGR-NYAVGVAKYSEL  414

Query  420  EWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
               +    +       LK++ D      V+G H +G  A E+     + +AM    TY
Sbjct  415  AKGMMAGGQKGA----LKLLFDPDSH-SVLGVHAIGQGATEIIHIGQVAMAMNCKLTY  467

>PHYCA_555180
Length=521

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 74/300 (25%), Positives = 126/300 (42%), Gaps = 36/300 (12%)

Query  193  ITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMA  248
            I SD I  R     P   +V+GA  + +E A  +    G+ V V+  R  +L   D+++ 
Sbjct  208  IDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREII  267

Query  249  NRIGEYMEVEAGIEFIRETVPS-SITK-----LEDGKLLVKWTLPDGSNHEEAFDTVLNA  302
            + +   M+       + ETV    +T       + GK+L             + D +L  
Sbjct  268  SNLTYEMQSNGARFLLGETVKKVEVTDRVKVFFDSGKVL-------------SADALLYT  314

Query  303  TGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRL  362
             GR    D L L+  G+  N +    +  N QT  P+I+A GD I AP L   +++ GRL
Sbjct  315  VGRQAATDGLNLEAVGLSRNHRGLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRL  374

Query  363  LARRLYNNE-----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFT  417
             +  ++N +     T+ ++       ++T  E    G +E++  +     N E+    ++
Sbjct  375  ASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKAC--INYEIGVAKYS  432

Query  418  PLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  475
             L          +MA   LK++ D    L V G H +G  A E+     + +AM    TY
Sbjct  433  ELAKG---QMMGAMAGGTLKILFDPD-TLKVFGVHAIGEGATEIIHIGQVAMAMDCSLTY  488

>HYAP_04149
Length=564

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 141/323 (44%), Gaps = 41/323 (13%)

Query  195  SDDIFWRKT--APGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W K    P + +VVGA  V +E A  +    G DV V+  R  +L   D++++  
Sbjct  230  SDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEMADKEVSEA  289

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +  Y   + G  F+ + V  S+ K   G++ V       S      D +L   GR  +V+
Sbjct  290  LC-YSMAQTGTRFLVDEVIKSVEKSAKGEVGVHLE----SGKTVVGDGLLYTVGRQGNVE  344

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFA---------IGDVIDAPELTPVAIQAG  360
             L L+  G+  + K GRI+V N  QT+ P+++A          GD+I  P L   +++ G
Sbjct  345  GLNLEAVGLAPD-KRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPALASTSMEQG  403

Query  361  RL------LARRLYNNETT----LMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIE  410
            RL       ++  Y  E +    + D ++V T + +  E    G+     I   G++  +
Sbjct  404  RLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQ  462

Query  411  VYHQNFTPLEWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQ  463
            +  +   P E  ++     +          +LK+I C KT  L ++G H +G  A E+  
Sbjct  463  LTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKT--LKLLGVHAIGEGATEIIH  519

Query  464  AIGLAMKLGFTYEQMVSVVGIHP  486
               + M    T E   + V  +P
Sbjct  520  IGQVVMSTDGTLEYFRNAVFNYP  542

>PYAR_16664
Length=577

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 82/172 (48%), Gaps = 9/172 (5%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVMV-RSILLRGFDQDMANR  250
            SD I W      P + +VVGA  + +E A  +    G +V V+  R  +L   D+++A  
Sbjct  267  SDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEA  326

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            + +Y   ++G  F  +    S+ K  +G+++VK      S      D +L   GR    D
Sbjct  327  L-KYAMRQSGTRFYTDETIKSVEKAANGEVIVKLN----SGKTIIGDGLLYTVGRQGSTD  381

Query  311  KLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRL  362
             L L   G++ + +    +  N +TS P+I+A GD I  P L   +++ GRL
Sbjct  382  GLNLAAVGLETDKRGLLQVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRL  433

>H310_02523
Length=494

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 89/192 (46%), Gaps = 11/192 (6%)

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILV--TNEQTSTPNIFAIGDVIDAPELTP  354
            D VL ATGR P    L L+  G++ + + GRI V  +N QT+   I+AIGDVI+   L  
Sbjct  292  DCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYAIGDVIEGAMLAH  350

Query  355  VAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQ  414
             A + G  +   +      + +Y+ +   ++T  E    G +EEE        N+  Y+ 
Sbjct  351  KAEEEGIAVVETIAGKHGHV-NYDAIPGVIYTFPEVASVGKTEEE----LKAANV-AYNV  404

Query  415  NFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFT  474
               P+  A S        + ++KV+  K  D  ++G H +  NAGE+     L ++ G +
Sbjct  405  GKFPM-MANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLGIEYGAS  462

Query  475  YEQMVSVVGIHP  486
             E +      HP
Sbjct  463  AEDIGRTCHAHP  474

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 52/109 (48%), Gaps = 11/109 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++      +GT   LGGTC+NVGCIP K L+H + L     H D    
Sbjct  44   IKAAQLGLKTACVE-----ARGT---LGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSV  94

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFV  151
            G + +N    D++QL  S    +K L    +   +  KV Y    G  V
Sbjct  95   GIKVDNVS-IDFNQLMKSKEKTVKILTGGIEGLFKKNKVDYVKGFGKIV  142

>H257_07450
Length=567

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 72/305 (24%), Positives = 119/305 (39%), Gaps = 34/305 (11%)

Query  190  ELSITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
             L   SD + W      P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  215  RLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEILDMADK  274

Query  246  DMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGR  305
            ++++ +  YM  + G  F+ E     +   ++ ++LV  T    S      D +L   GR
Sbjct  275  EVSDALCYYMR-KRGSRFLTEESIVKVETKDNSEVLVYLT----SGKVIVGDALLYTQGR  329

Query  306  NPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLAR  365
              +V  L L+  G+  N +    +  N QT  P+I+A GD I  P L   +++ GRL + 
Sbjct  330  QGNVAGLDLEAVGLAANKRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTSMEQGRLASV  389

Query  366  RLYNNE------------------TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGED  407
             +  +E                  T +   E     ++T  E    G SE++       +
Sbjct  390  HMRTSEPTNKLRPDAEAHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSEQQ----LSRE  445

Query  408  NIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGL  467
            NI  Y       E          M      + C  T  L ++G H +G  A E+     +
Sbjct  446  NIP-YEVGIARYEELAKGQMMGGMPGFLKLIFCPTT--LKLLGVHAIGEGATEIIHIGQV  502

Query  468  AMKLG  472
             M  G
Sbjct  503  VMSTG  507

>PYVX_23499
Length=519

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 78/314 (25%), Positives = 131/314 (42%), Gaps = 31/314 (10%)

Query  195  SDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            SD + W   K AP + +VVGA  + +E A  +    G +V V+  R  +L   D++++  
Sbjct  193  SDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEILDMADKEVSES  252

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +   M  + G  F  E     + K E+G+++        S      D +L   GR  + D
Sbjct  253  LCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLN----SGKVIVGDGLLYTLGRQGNTD  307

Query  311  KLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYN  369
             L L   G++ + K G + V ++ QT  P+I+A GD I  P L   +++ GRL +  +  
Sbjct  308  GLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSMEQGRLASVHMRT  366

Query  370  NETTLMDYEKVCTAV----------FTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPL  419
               T    E+    +              E    G+     I   G++  ++  +N  P 
Sbjct  367  ESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVGKNEQQLTKEN-VPY  425

Query  420  EWALSDDTRPSMANC------YLKVI-CDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLG  472
            E  L+     +          +LK+I C  T  L V+G H +G  A E+     + M  G
Sbjct  426  EVGLARYEELAKGQMLGGVPGFLKIIFCPDT--LKVLGVHAIGEGATEIIHIGQVVMSTG  483

Query  473  FTYEQMVSVVGIHP  486
             T E   + V  +P
Sbjct  484  GTIEYFRNAVFNYP  497

>PHYKE_2864
Length=486

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 84/188 (45%), Gaps = 17/188 (9%)

Query  297  DTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVA  356
            D +L   GR    D L L+  G+  N +    +  N QT  P+I+A GD I AP L   +
Sbjct  274  DALLYTVGRQASTDGLNLEAVGLSRNHRGLINVNKNYQTDQPHIYAAGDCIGAPALASTS  333

Query  357  IQAGRLLARRLYNNETTLMDYEKVCT-----AVFTPIEYGCCGLSEEESIERFGED--NI  409
            ++ GRL +  ++N +  L    ++ +      ++T  E    G +E++      +D  N 
Sbjct  334  MEQGRLASCHMWNPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQQ----LTKDCVNY  389

Query  410  EVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAM  469
            E+    ++ L          +MA   LK++ D    L V G H +G  A E+     +AM
Sbjct  390  EIGIAKYSELA---KGQMMGAMAGGTLKILFDPD-TLKVFGVHAIGEGATEIIHIGQVAM  445

Query  470  KLG--FTY  475
             +G   TY
Sbjct  446  AMGCSLTY  453

 Score = 32.7 bits (73),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 8/47 (17%)

Query  44  VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL  90
           +E++K G++V ++D         K  LGG CV+ G IP K   ++ L
Sbjct  50  LESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFREAVL  88

>PYIR_21896
Length=518

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 128/304 (42%), Gaps = 39/304 (13%)

Query  193  ITSDDIFWRKTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQDMANR  250
            I S DI   +  P   +VVGA  + +E A  +    G+ V V+  RS +L   D ++ + 
Sbjct  191  ILSGDI---RELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISN  247

Query  251  IGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVD  310
            +   M  +     + ET+   + K E G      T+   S    + D +L   GR    D
Sbjct  248  LTYEMRSKGARFLLGETI-KHVEKTESG-----VTVHFNSGKITSADALLYTVGRQAATD  301

Query  311  KLALDKAGVKLNPKTGRILVTNEQTSTPNI------------------FAIGDVIDAPEL  352
             L L+   +  NP+    +  + QT+ P++                  +A GD I AP L
Sbjct  302  GLNLEAVDLSRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSL  361

Query  353  TPVAIQAGRLLARRLYNNE----TTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDN  408
               +++ GRL A  +++ E    T+ ++       ++T  E    G +E++ + + G  N
Sbjct  362  ASTSMEQGRLAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQQ-LTKEGL-N  419

Query  409  IEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLA  468
             E+    ++ L          S A   LK++ D T  L + G H +G  A E+     +A
Sbjct  420  FEIGIAKYSELAKG---QMSGSTAGGMLKILFDPT-TLKLFGVHAIGEGATEIIHIGQVA  475

Query  469  MKLG  472
            M +G
Sbjct  476  MAMG  479

>CCA14030
Length=560

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 81/186 (44%), Gaps = 27/186 (15%)

Query  190  ELSITSDDIFWR--KTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            ++   SD I W   K+ P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  228  QMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEMADR  287

Query  246  DMANRIGEYMEVEAGIEFIRETVP--------SSITKLEDGKLLVKWTLPDGSNHEEAFD  297
            ++   +   M       ++ ET+           IT L  GK +V              D
Sbjct  288  EVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG-------------D  334

Query  298  TVLNATGRNPDVDKLALDKAGVKLNPKTGRILVT-NEQTSTPNIFAIGDVIDAPELTPVA  356
             +L   GR  + + L L   G++ + K G I V  N QTS P+I+A GD    P L   +
Sbjct  335  GLLYTVGRQGNTEGLDLSAIGLETD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALASTS  393

Query  357  IQAGRL  362
            ++ GRL
Sbjct  394  MEQGRL  399

>PPTG_24712
Length=67

 Score = 45.8 bits (107),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 3/44 (7%)

Query  46  ASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSA  89
           A+ FG KVLV   V+   +    GLGGTCVN GC+PKK+M  +A
Sbjct  25  AATFGAKVLV---VERGREFDGMGLGGTCVNFGCVPKKVMFNTA  65

>CCI39993
Length=550

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 80/186 (43%), Gaps = 27/186 (15%)

Query  190  ELSITSDDIFW--RKTAPGKTLVVGASYVALECAGFLKG-QGYDVKVM-VRSILLRGFDQ  245
            ++   SD I W   K+ P + +VVGA  + +E A  +    G  V V+  R  +L   D+
Sbjct  218  QMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEMADR  277

Query  246  DMANRIGEYMEVEAGIEFIRETVP--------SSITKLEDGKLLVKWTLPDGSNHEEAFD  297
            ++   +   M       ++ ET+           I  L  GK +V              D
Sbjct  278  EVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNSGKTIVG-------------D  324

Query  298  TVLNATGRNPDVDKLALDKAGVKLNPKTGRILVT-NEQTSTPNIFAIGDVIDAPELTPVA  356
             +L   GR  + + L L   G++ + K G I V  N QTS P+I+A GD    P L   +
Sbjct  325  GLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALASTS  383

Query  357  IQAGRL  362
            ++ GRL
Sbjct  384  MEQGRL  389

>PITG_19802
Length=185

 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/151 (28%), Positives = 66/151 (44%), Gaps = 8/151 (5%)

Query  336  STPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGL  395
            S P IFAIGDVI    L   A + G      +      + +Y  +   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKHGHV-NYGAIPGVIYTFPEFASVGK  81

Query  396  SEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLG  455
            +EEE       + IE Y+    P+  A S     + A+  +KV+ DK  D  ++G H + 
Sbjct  82   TEEE----LKAEGIE-YNVGKFPM-MANSRARTIAEADGLVKVLADKKTDK-LLGVHIIA  134

Query  456  PNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             NAGE+     + ++ G   E +      HP
Sbjct  135  GNAGEMIAEGVIGIEYGAASEDLARTCHAHP  165

>PYU1_G001737
Length=133

 Score = 38.9 bits (89),  Expect = 0.014, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 19/28 (68%), Gaps = 1/28 (4%)

Query  2    SSPFVWTSNPTAFVGGCDALLDRFRSQV  29
            SSPFVW SN   FVGGCDALL   R  +
Sbjct  106  SSPFVW-SNAGEFVGGCDALLATIRGSI  132

>HYAP_08069
Length=255

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 51/108 (47%), Gaps = 11/108 (10%)

Query  44   VEASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKK-LMHQSALIGEVMHKDAALF  102
            ++A++ G K   ++        ++  LGGTC+NVGCIP K L+H + L+    H+  + +
Sbjct  51   IKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALLHSTHLLHTAQHEFKS-Y  101

Query  103  GWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAF  150
            G    N    ++ Q+  +    ++TL    +      KV Y   +G  
Sbjct  102  GIDAPNVTA-NFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGVGKL  148

>SPRG_04231
Length=90

 Score = 35.4 bits (80),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  444  RDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
            +D  VVG H  G  A E+ Q  G+A+K+G       ++V IHP
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHP  51

>PHYCA_524942
Length=1028

 Score = 37.4 bits (85),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 79/171 (46%), Gaps = 19/171 (11%)

Query  212  GASYVALECAGFLKGQGYDVKVMVRSI------LLRGFDQDMANRIGEYMEVEAGIEFIR  265
            G     +E AG  K   +D+ V VR I      + R  D D A  +   +  + GI+ + 
Sbjct  148  GEKQAKIEAAGAAKAV-HDLNVSVRIINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLY  206

Query  266  E-TVPSSITKLEDGKLLVKWTLPDGSNHEEAFD---TVLNATGRNPDVDKLALDKAGVKL  321
            E +    I   E+G   V++T      + E FD    ++ ATG  P  D+LA   +G++L
Sbjct  207  EKSTQEIIGSQENGVEAVQFT------NGERFDDICMIIFATGIKPR-DELA-HSSGLEL  258

Query  322  NPKTGRILVTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNET  372
              + G ++    + S P+++A+G+ I   +LT   +  G  +A  L  N T
Sbjct  259  GNRGGILINDFLECSVPDVYALGECISHRDLTYGLVAPGYEMADVLAKNFT  309

>PYIW_27568
Length=128

 Score = 33.1 bits (74),  Expect = 1.3, Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 47/112 (42%), Gaps = 7/112 (6%)

Query  375  MDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANC  434
            ++Y  +   ++T  E    G +EE+  E     N+  +         A+ +      A+ 
Sbjct  4    VNYNAIPGVIYTFPEVASVGKTEEQLKEEGVAYNVGKFPMMANSRARAVGE------ADG  57

Query  435  YLKVICDKTRDLFVVGFHYLGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHP  486
             +KVI DK  D  ++G H +  NAGE+     L M+ G   E +      HP
Sbjct  58   LVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHP  108

>PYIW_16666
Length=1078

 Score = 34.7 bits (78),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 73/149 (49%), Gaps = 13/149 (9%)

Query  229  YDVKVMVR------SILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLV  282
            +D+KV VR       ++ R  D   A  +   +  + GI+ +      SI    D +  V
Sbjct  208  HDLKVSVRIVNRGSRLMSRQLDDAGAKVLHNEITSKFGIQVLYHKSTKSIHGENDVQG-V  266

Query  283  KWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTN-EQTSTPNIF  341
            ++T  DGS+ ++ F  V  ATG  P  D LAL  +G+K+  + G I V++  +TS   ++
Sbjct  267  EFT--DGSSLDDVFMIVF-ATGIKPR-DDLAL-ASGLKVVTRGGGIQVSDFLETSANAVY  321

Query  342  AIGDVIDAPELTPVAIQAGRLLARRLYNN  370
            AIG+ +   ++T   +  G  +A  L  N
Sbjct  322  AIGECVSHRDVTYGLVAPGYEMADSLAKN  350

>PHYSO_317690
Length=1057

 Score = 34.7 bits (78),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 18/154 (12%)

Query  229  YDVKVMVRSI------LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSIT-KLEDGKLL  281
            +D+KV VR I      + R  D D A  +   +  + GI+ + +     I    E+G   
Sbjct  192  HDLKVAVRVINRGTQLMSRQLDADGAKVLHNEIVNKFGIDVLYDKSTQEILGSEENGVEA  251

Query  282  VKWTLPDGSNHEEAFDTV---LNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTP  338
            V++T      + E FD V   + ATG  P  D+LA   +G++L  + G ++    + S P
Sbjct  252  VQFT------NGERFDDVCMIIFATGIKPR-DELA-HSSGLELAKRGGILINDYLECSAP  303

Query  339  NIFAIGDVIDAPELTPVAIQAGRLLARRLYNNET  372
            +++A+G+ I     T   +  G  +A  L  N T
Sbjct  304  SVYALGECISHRNFTYGLVAPGYEMADTLAKNFT  337

>PYU1_G000378
Length=1070

 Score = 34.3 bits (77),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 77/157 (49%), Gaps = 10/157 (6%)

Query  229  YDVKVMVRSILLRG---FDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKWT  285
            +D+++ VR I+ RG     + + +   + +  E   +F  E +    TK   G  +V+  
Sbjct  176  HDLQLSVR-IVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLYHKTTKYIHGTTVVEGV  234

Query  286  -LPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE-QTSTPNIFAI  343
               DG ++++ F  V  ATG  P  D L  D +G+ +  + G ILV +  +TS  +++AI
Sbjct  235  DFTDGESYDDVFMIVF-ATGIKPR-DDLGRD-SGLDVAQRGGGILVNDLLETSHKDVYAI  291

Query  344  GDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKV  380
            G+ +   ++T   +  G  +A  L  N T   D EKV
Sbjct  292  GECVSHRDVTYGLVAPGYEMADNLAKNFTANGD-EKV  327

>PHYKE_6590
Length=1054

 Score = 33.5 bits (75),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 72/153 (47%), Gaps = 20/153 (13%)

Query  229  YDVKVMVRSI------LLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSI--TKLEDGKL  280
            +D+ V VR I      + R  D+D A  +   +  + GI+ + E     I  TK E+G  
Sbjct  189  HDLHVSVRIINRGTRLMSRQLDEDGAKVLHNEIVNKFGIDVLYEKSTQGILGTK-ENGVE  247

Query  281  LVKWTLPDGSNHEEAFDTV---LNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTST  337
             V++T      + E FD V   + ATG  P  D+LA   +G++L  + G ++    + ST
Sbjct  248  GVEFT------NGETFDDVCMIIFATGIKPR-DELA-HSSGLELAKRGGILINDYLECST  299

Query  338  PNIFAIGDVIDAPELTPVAIQAGRLLARRLYNN  370
             N++A+G+ I     T   +  G  +A  L  N
Sbjct  300  SNVYALGECISHRNATYGLVAPGYEMADTLAKN  332

>PHYSO_326053
Length=223

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (46%), Gaps = 10/72 (14%)

Query  350  PE-LTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDN  408
            PE L P  ++ GR+       N+  L+ Y   C  +   IEY C    +E  + R G D 
Sbjct  136  PEKLDPALVRPGRV-------NKKLLLGYMG-CAQIQQMIEYYCVAKLDESQVRRLG-DA  186

Query  409  IEVYHQNFTPLE  420
             E+  Q FTP E
Sbjct  187  FELSPQAFTPAE  198

>PHYSO_539927
Length=561

 Score = 33.1 bits (74),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (46%), Gaps = 10/72 (14%)

Query  350  PE-LTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERFGEDN  408
            PE L P  ++ GR+       N+  L+ Y   C  +   IEY C    +E  + R G D 
Sbjct  474  PEKLDPALVRPGRV-------NKKLLLGYMG-CAQIQQMIEYYCVAKLDESQVRRLG-DA  524

Query  409  IEVYHQNFTPLE  420
             E+  Q FTP E
Sbjct  525  FELSPQAFTPAE  536

>HYAP_13613
Length=423

 Score = 32.7 bits (73),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 45/92 (49%), Gaps = 15/92 (16%)

Query  6   VWTSNPTAFVGGCDALLDRFRSQVPRPNA------ASKPQANG-EVEASKFGQKVLVLDY  58
           +WT+  +A++    A L   +SQ+   ++       S P A    ++++K G++V ++D 
Sbjct  4   LWTATTSAWLRRRGARLTSTQSQLSPVSSYDLVVIGSGPSATQCALDSAKQGKRVAIVD-  62

Query  59  VKPSPQGTKWGLGGTCVNVGCIPKKLMHQSAL  90
                   K  LGG CV+ G IP K   ++ L
Sbjct  63  -------KKTRLGGVCVHTGTIPSKTFREAVL  87

Lambda      K        H        a         alpha
   0.318    0.135    0.408    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 37917344790

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40