Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_158691033133115230.0
PPTG_16671102092152758e-28
PHYSO_554653102202072644e-26
PITG_00012101852022553e-25
PHYCA_104436101811872535e-25
PHYRA_78819102002062442e-23
PPTG_07275203391841842273e-21
HYAP_01509102081912232e-20
PHYCA_97367203391911871774e-14
PYU1_G00322681968206691316e-08
PYIW_19157819682621061178e-06
PHALS_10836102041941086e-05
PYAP_2039999801135701041e-04
PYAR_1946299801116741021e-04
PHYSO_29655611136761004e-04
PHYKE_57191113072940.002
PYIR_144998196818681930.005
PHYRA_788181113468880.012
PITG_000131113571800.16
PPTG_166701113869780.25
PYVX_158671118774790.31
PYU1_G0032271113876731.2
PYAP_20623126971595761.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_15869

Length=331
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_15869                                                            591        0.0  
PPTG_16671                                                            110        8e-28
PHYSO_554653                                                          106        4e-26
PITG_00012                                                            102        3e-25
PHYCA_104436                                                          102        5e-25
PHYRA_78819                                                           98.6       2e-23
PPTG_07275                                                            92.0       3e-21
HYAP_01509                                                            90.5       2e-20
PHYCA_97367                                                           72.8       4e-14
PYU1_G003226                                                          55.1       6e-08
PYIW_19157                                                            49.7       8e-06
PHALS_10836                                                           46.2       6e-05
PYAP_20399                                                            44.7       1e-04
PYAR_19462                                                            43.9       1e-04
PHYSO_296556                                                          43.1       4e-04
PHYKE_5719                                                            40.8       0.002
PYIR_14499                                                            40.4       0.005
PHYRA_78818                                                           38.5       0.012
PITG_00013                                                            35.4       0.16 
PPTG_16670                                                            34.7       0.25 
PYVX_15867                                                            35.0       0.31 
PYU1_G003227                                                          32.7       1.2  
PYAP_20623                                                            33.9       1.4  

>PYVX_15869
Length=331

 Score = 591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/331 (100%), Positives = 331/331 (100%), Gaps = 0/331 (0%)

Query  1    MRTEPERSAPVRPSCRSTAARRLALRPIVQESARREGVQQLSVAAALNLGEAARHSPPTG  60
            MRTEPERSAPVRPSCRSTAARRLALRPIVQESARREGVQQLSVAAALNLGEAARHSPPTG
Sbjct  1    MRTEPERSAPVRPSCRSTAARRLALRPIVQESARREGVQQLSVAAALNLGEAARHSPPTG  60

Query  61   GEYYRPHSLVERRSPSDYKHRRALLGRAMRFGHAHDHDGDAPRMAGDGrssrssasavsr  120
            GEYYRPHSLVERRSPSDYKHRRALLGRAMRFGHAHDHDGDAPRMAGDGRSSRSSASAVSR
Sbjct  61   GEYYRPHSLVERRSPSDYKHRRALLGRAMRFGHAHDHDGDAPRMAGDGRSSRSSASAVSR  120

Query  121  hrMVELAPGPEPAGQRKRGVLSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTV  180
            HRMVELAPGPEPAGQRKRGVLSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTV
Sbjct  121  HRMVELAPGPEPAGQRKRGVLSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTV  180

Query  181  LPQHFPRMDRDLKYDFTAGPIsssaasksssparstrsktssDSFLSYDDPYDQPTQFLF  240
            LPQHFPRMDRDLKYDFTAGPISSSAASKSSSPARSTRSKTSSDSFLSYDDPYDQPTQFLF
Sbjct  181  LPQHFPRMDRDLKYDFTAGPISSSAASKSSSPARSTRSKTSSDSFLSYDDPYDQPTQFLF  240

Query  241  YCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNA  300
            YCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNA
Sbjct  241  YCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNA  300

Query  301  PTSPAAAPLYSPHLFRITEREYDPYFMRYSR  331
            PTSPAAAPLYSPHLFRITEREYDPYFMRYSR
Sbjct  301  PTSPAAAPLYSPHLFRITEREYDPYFMRYSR  331

>PPTG_16671
Length=209

 Score = 110 bits (275),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 112/215 (52%), Gaps = 32/215 (15%)

Query  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200
            LS ++ S   F+  PF DC + CD+  P      SPGV   PQ F R + D+KY+ T   
Sbjct  3    LSDFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEHDVKYNITPSR  62

Query  201  Isssaasksssparstrsktss--------------DSFLSYDDPYDQPTQFLFYCGSDP  246
              SS    +SS   +   ++ +               S  SY++  ++  QFLFY GSDP
Sbjct  63   PPSSLPPFASSQVGTREHQSKTLSSSGSRSGSNSDSPSNYSYEEEDERQVQFLFYGGSDP  122

Query  247  LTPTSAQLAARNGLKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAP-  301
             TPTSA     NG ++D IS Y    +P A  E        SPRI+H++P FFSPR+ P 
Sbjct  123  PTPTSAGGLYSNGYRSDMISNYVEPMSPAASIE--------SPRINHEMPCFFSPRDTPL  174

Query  302  TSPAAAPLYSPHLFRITE-----REYDPYFMRYSR  331
             SP +AP+YSPHLF+I+E     R    Y MRYSR
Sbjct  175  QSPMSAPIYSPHLFKISEQRTSRRSTGYYSMRYSR  209

>PHYSO_554653
Length=220

 Score = 106 bits (264),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 108/207 (52%), Gaps = 30/207 (14%)

Query  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYD-----  195
            LS ++      +R PF DC + CD+  P      SPGV   PQ F R D D+K+D     
Sbjct  3    LSEFFRDLWDLVRSPFEDCTSCCDVLDPDYYRKTSPGVRRTPQMFNRWDHDVKFDVGSNP  62

Query  196  -------FTAGPIsssaasksssparstrsktssDSFLS---------------YDDPYD  233
                   F+  P+ SS+ +  +  + ++ +  S  S  S               Y++  +
Sbjct  63   PSRLPPSFSFSPVISSSHAGRTQRSFTSPASLSGSSPSSGSGSASRSQSPSSYSYEEEDE  122

Query  234  QPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPV  293
            +  QFLFY GSDP TPT    A  +G ++D IS Y      EP     +ASPRISH++P 
Sbjct  123  RQVQFLFYGGSDPPTPTGGG-AYPSGYRSDMISKYI--QPTEPISPASIASPRISHEMPC  179

Query  294  FFSPRNAPTSPAAAPLYSPHLFRITER  320
            FFSPR  PTSP +AP+YSPHLF+ITE+
Sbjct  180  FFSPRTTPTSPMSAPIYSPHLFKITEQ  206

>PITG_00012
Length=185

 Score = 102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 105/202 (52%), Gaps = 30/202 (15%)

Query  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200
            LS ++ S   F+  PF DC + CD+  P      SPGV   PQ F R +  +KY+ T+  
Sbjct  3    LSEFFHSVWDFVCRPFEDCTSCCDVLDPDYYRKTSPGVHRSPQMFNRWEHGVKYNITS--  60

Query  201  IsssaasksssparstrsktssDSFLSYDDPYDQPTQFLFYCGSDPLTPTSA-QLAARNG  259
                     S P  S     S  ++   ++  ++  QFLFY GSDP TPTS   L    G
Sbjct  61   ---------SRPPSSGSRSDSPSNYSYEEEEEERQVQFLFYGGSDPPTPTSVGDLYPSGG  111

Query  260  LKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAP-TSPAAAPLYSPHL  314
             ++D IS Y    +P A  E        SPRISH++P FFSPRN P  SP +AP+YSPHL
Sbjct  112  YRSDMISNYVEPMSPAASIE--------SPRISHEMPCFFSPRNTPLQSPMSAPIYSPHL  163

Query  315  FRITE-----REYDPYFMRYSR  331
            F+I+E     R    Y MRYSR
Sbjct  164  FKISEQRMSRRSTGYYNMRYSR  185

>PHYCA_104436
Length=181

 Score = 102 bits (253),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 96/187 (51%), Gaps = 29/187 (16%)

Query  139  GVLSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTA  198
            G     WD     +R PF DC + CD+  P      SPGV   PQ F R + D++    +
Sbjct  5    GFFRYIWD----LVRQPFEDCTSCCDVLDPDYYRKTSPGVRRSPQMFNRWEYDVQSKTLS  60

Query  199  GPIsssaasksssparstrsktssDSFLSYDDPYDQPTQFLFYCGSDPLTPTSAQLAARN  258
               S S +S +S                SY++  ++  QFLFY GSDP TP S     +N
Sbjct  61   SSGSRSGSSANSPLN------------YSYEEEDERQVQFLFYGGSDPPTPNSVGGLHQN  108

Query  259  GLKTDTISGY----TPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT-SPAAAPLYSPH  313
            G ++D IS Y    +P A  E        SPRISH++P FFSPRN P  SP +AP+YSPH
Sbjct  109  GYRSDMISNYVEPMSPAASIE--------SPRISHEMPCFFSPRNTPIQSPMSAPIYSPH  160

Query  314  LFRITER  320
            LF+I E+
Sbjct  161  LFKIAEQ  167

>PHYRA_78819
Length=200

 Score = 98.6 bits (244),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 108/206 (52%), Gaps = 23/206 (11%)

Query  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200
            +S ++ S    LR PF +C + CD+  P      SPGV   PQ F R + D+KYDF+   
Sbjct  3    VSEFFHSVWDLLRRPFEECTSCCDVLDPNYYRKTSPGVRRSPQMFNRFN-DVKYDFSKSR  61

Query  201  IsssaasksssparstrsktssD-----------SFLSYDDPYDQPTQFLFYCGSDPLTP  249
              SS    SS+       +++             ++   ++  ++  QFLFY GSDP TP
Sbjct  62   PPSSLPPSSSNSHADITQRSNMSSGSGSRSASPMNYSYEEEEEERHVQFLFYGGSDPPTP  121

Query  250  TSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT-SPAAAP  308
            TSA      G ++D IS Y      EP      ASPRI+H++P FFSPRN P  SP +AP
Sbjct  122  TSA--GGPGGYRSDMISNYV-----EPISPAAFASPRINHEMPCFFSPRNTPAQSPMSAP  174

Query  309  LYSPHLFRITE---REYDPYFMRYSR  331
            +YSPHLF+I E   R    ++ RYSR
Sbjct  175  IYSPHLFKIAEQRHRHSAGHYSRYSR  200

>PPTG_07275
Length=184

 Score = 92.0 bits (227),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 96/184 (52%), Gaps = 19/184 (10%)

Query  145  WDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPR--MDRDLKYDFTAGPIs  202
            WD    FLR PF DC + CD+  P+  S  SPGV   P  F R   + DLKYDF+     
Sbjct  2    WD----FLRRPFEDCKSYCDVLDPYYYSKTSPGVRRNPPKFDRACWENDLKYDFSLSRPP  57

Query  203  ssaasks---ssparstrsktssDSFLSYDDPYDQPTQFLFYCGSDPLTPTSAQLAARNG  259
             S  S S        S     S  + + +++  +Q  QFLFY GSD  TP S      +G
Sbjct  58   PSFQSSSSGRMQFTLSRSRSQSRSASVLHEEEEEQQVQFLFYGGSDISTPVSVGKLCSSG  117

Query  260  LKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAP-TSPAAAPLYSPHLFRIT  318
             ++D I   TP       V  P   PRISH+IP FFSPR+ P  SP +AP+YSPHLF+I 
Sbjct  118  YRSDVIC--TPMR----LVSQP---PRISHEIPCFFSPRDTPMMSPMSAPIYSPHLFQIN  168

Query  319  EREY  322
            E+ +
Sbjct  169  EQRW  172

>HYAP_01509
Length=208

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 98/191 (51%), Gaps = 29/191 (15%)

Query  151  FLRHPFRDCYNMCD-LERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP---------  200
            F+  PF DC +  D L+R +  S  SPGV   PQ F R + D+K+ +T            
Sbjct  13   FVCRPFSDCSSCVDVLDRSY-YSKTSPGVYASPQMFNRWENDVKHGYTRSRPLPSRLPPP  71

Query  201  ---------IsssaasksssparstrsktssDSFLSYDDPYDQPTQFLFYCGSDPLTPTS  251
                     ++  + S SS P   + S   S      ++  D+  QFLFY GSDP TPTS
Sbjct  72   PPPRTRKKGLTKRSTSSSSRPRSESSSNNPSYYSFEDEEERDRRVQFLFYGGSDPPTPTS  131

Query  252  -AQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPTSPAAAPLY  310
               LAA  G ++D IS             T + SP+I+H+IP FFSPR+ P S  +A +Y
Sbjct  132  RGGLAASTGYRSDMISDAVSL--------TSIRSPQINHEIPCFFSPRDTPRSSVSASMY  183

Query  311  SPHLFRITERE  321
            SPH+F+ITE++
Sbjct  184  SPHVFKITEQK  194

>PHYCA_97367
Length=191

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 94/187 (50%), Gaps = 21/187 (11%)

Query  141  LSRWWDSFTGFLRHPFRDCYN----MCDLERPFGASPGSPGVTVLPQHF--PRMDRDLKY  194
            +S ++     F+  PF DC +    + ++  P+     SPGV   P  F   R D DLKY
Sbjct  3    VSDFFQDVWDFVCRPFEDCKSCSEVLDNVLDPYYYGKTSPGVRRTPPTFDRTRWDNDLKY  62

Query  195  DFTAGPIsssaasksssparstrsktssDSFLSYDDPYDQPTQFLFYCGSDPLTPTSAQL  254
            DF+      S +  +S          S  +  S ++  D+  QFLFY GSD    TS +L
Sbjct  63   DFSLSRPPPSQSPANSRVVFPLSRSRSLSASRSLEE--DEQIQFLFYSGSD--ISTSDRL  118

Query  255  AARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAP-TSPAAAPLYSPH  313
             +         SGY   A + P +      PR+SH+IP FFSPR+AP  +P +AP+YSPH
Sbjct  119  CS---------SGYRSDAISRP-LQPITEPPRLSHEIPCFFSPRDAPLMAPMSAPIYSPH  168

Query  314  LFRITER  320
            LF I+E+
Sbjct  169  LFMISEQ  175

>PYU1_G003226
Length=206

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 4/69 (6%)

Query  236  TQFLFYCGSDPLTPTSAQLAARNGLKTDTISG----YTPTAGAEPQVHTPLASPRISHQI  291
            T F+FYCGSD  T  + Q  + NG  + + +     ++  A    +    +A+P+ISHQI
Sbjct  98   TDFMFYCGSDTPTSDAGQRNSFNGAASFSSTASASEFSEAAEVASEERAKVATPKISHQI  157

Query  292  PVFFSPRNA  300
            PVFFSPRNA
Sbjct  158  PVFFSPRNA  166

>PYIW_19157
Length=262

 Score = 49.7 bits (117),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 22/106 (21%)

Query  227  SYDDPYD---QPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAE--------  275
            SY+  Y+   + T F+FYCG D  TP S       G      S  + TA +E        
Sbjct  85   SYEQEYEASIKSTDFMFYCGFD--TPKSEHGRGEGG----GFSFSSSTAPSEFSDDGERA  138

Query  276  --PQVHTPLASPRISHQIPVFFSPRNA-PTSPAAAPLYSPHLFRIT  318
               +VH  + +P++SHQIPVFFSPRNA P  P   P   P   RI+
Sbjct  139  SMDRVH--VTTPKLSHQIPVFFSPRNAVPMLPRPKPREKPRPLRIS  182

>PHALS_10836
Length=204

 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 79/194 (41%), Gaps = 30/194 (15%)

Query  141  LSRWWDSFTGFLRHPFRDCYNMCDLERPFGASPGSPGVTVLPQHFPRMDRDLKYDFTAGP  200
            +SR+       +  PF  C N CD+  P      SPG    PQ F   D D     T  P
Sbjct  1    MSRFIRILWDLVCQPFEYCRNCCDVLDPAYYRKMSPGGRRNPQMFNCWDNDKN---TLTP  57

Query  201  IsssaasksssparstrsktssDS-FLS-----------------YDDPYDQPTQFLFYC  242
               +++  + S +    S  ++D+ F++                 +++  +    FLFY 
Sbjct  58   SYPTSSFPTLSSSNLEYSCRANDNKFITLSTSRSRSVSSTPSESAHEEEGENQLHFLFYG  117

Query  243  GSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFSPRNAPT  302
            GSD L+P +     R  + +D     +P    E        SPRI H++P FFS   AP 
Sbjct  118  GSDSLSPKAVGKRYRRDIISDCQEPTSPVVSIE--------SPRIDHKMPCFFSSTIAPL  169

Query  303  S-PAAAPLYSPHLF  315
              P +  +YS +L 
Sbjct  170  QFPMSDSIYSANLL  183

>PYAP_20399
Length=135

 Score = 44.7 bits (104),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 39/70 (56%), Gaps = 10/70 (14%)

Query  234  QPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLAS----PRISH  289
            +P QFLF+CGSD    +      R G +T+    +   A AE Q     AS    P+ISH
Sbjct  65   EPQQFLFFCGSDN---SGVAAGRRTGYQTNHDFSF---ANAEVQARASRASEIQAPQISH  118

Query  290  QIPVFFSPRN  299
            +IPVFF+P++
Sbjct  119  KIPVFFAPQH  128

>PYAR_19462
Length=116

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 38/74 (51%), Gaps = 24/74 (32%)

Query  227  SYDDPYDQPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPR  286
            S +   ++  QFLF+CGSD    TSA   AR  LK+  I                  +P 
Sbjct  61   SRESSVNERPQFLFFCGSD----TSA---ARASLKSSKIE-----------------TPM  96

Query  287  ISHQIPVFFSPRNA  300
            ISH++PVFF+P+NA
Sbjct  97   ISHRMPVFFNPQNA  110

>PHYSO_296556
Length=136

 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 37/76 (49%), Gaps = 10/76 (13%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPL-ASPRISHQIPVFF  295
            QFLF+CG+D     SA+L A NG         T  A     ++ P  A P I H +PVFF
Sbjct  68   QFLFFCGTDSSGSPSAELTAANG---------TTLASRIASMNAPAPAQPAIDHHMPVFF  118

Query  296  SPRNAPTSPAAAPLYS  311
             P  +P +P     YS
Sbjct  119  MPPLSPVAPELGAGYS  134

>PHYKE_5719
Length=130

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 35/72 (49%), Gaps = 12/72 (17%)

Query  237  QFLFYCGSDPLTPTSAQLAARNG--LKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVF  294
            QFLF+CGSD     S +L + NG  L +   S   PT           A P I+H +PVF
Sbjct  69   QFLFFCGSDTSAFPSGELTSPNGSTLASRLASITCPTP----------AQPAINHHMPVF  118

Query  295  FSPRNAPTSPAA  306
            F P  +PT P  
Sbjct  119  FMPPLSPTGPGC  130

>PYIR_14499
Length=186

 Score = 40.4 bits (93),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 41/81 (51%), Gaps = 26/81 (32%)

Query  227  SYDDPYD---QPTQFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVH----  279
            +Y+  Y+   + T F+FYCG D  TP S                 T  +  + ++H    
Sbjct  85   TYEKEYEASIKKTDFMFYCGFD--TPNS-----------------TAPSDLDEEMHEERA  125

Query  280  TPLASPRISHQIPVFFSPRNA  300
            + +A+P+IS  IPVFFSPRNA
Sbjct  126  SLVATPKISRNIPVFFSPRNA  146

>PHYRA_78818
Length=134

 Score = 38.5 bits (88),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 35/68 (51%), Gaps = 8/68 (12%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFS  296
            QFLF+CGSD     S +L + NG    T++       A     TP A P I H +PVFF 
Sbjct  66   QFLFFCGSDTSAFPSGELTSPNG---STLASRL----ANMTAPTP-AQPAIDHHMPVFFM  117

Query  297  PRNAPTSP  304
            P  +PT P
Sbjct  118  PPLSPTRP  125

>PITG_00013
Length=135

 Score = 35.4 bits (80),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFS  296
            QFLF+CGSD     S++L + NG    T++    +  A   V      P I H +PVFF 
Sbjct  67   QFLFFCGSDNSAYPSSELTSPNG---STLASRFASMKAPTPVQ-----PVIDHHMPVFFM  118

Query  297  PRNAPTSPAAA  307
            P   P+ P+  
Sbjct  119  PPLPPSRPSVG  129

>PPTG_16670
Length=138

 Score = 34.7 bits (78),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 8/69 (12%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFS  296
            QFLF+CGSD     S +L + NG    T++       A  +  TP A P I H +PVFF 
Sbjct  70   QFLFFCGSDNSAFPSGELTSPNG---STLASRL----ARMKAPTP-AQPVIDHHMPVFFM  121

Query  297  PRNAPTSPA  305
               +P+ P+
Sbjct  122  SPLSPSRPS  130

>PYVX_15867
Length=187

 Score = 35.0 bits (79),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 11/74 (15%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPL-ASPRISHQIPVFF  295
            QFLF+CGSD          +  G K ++    T  A     ++ P+ A+P ISH++PVFF
Sbjct  112  QFLFFCGSDSRD-------SGRGWKNNSPES-TELAQRLTSLNFPMPAAPAISHKMPVFF  163

Query  296  SPR--NAPTSPAAA  307
            +P      TSP AA
Sbjct  164  TPAQPTQATSPLAA  177

>PYU1_G003227
Length=138

 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 35/76 (46%), Gaps = 20/76 (26%)

Query  237  QFLFYCGSDPLTPTSAQLAARNGLKTDTISGYTPTAGAEPQVHTPLASPRISHQIPVFFS  296
            QFLF+CG++     S+   +R  L+               Q  T    P ISH++PVFF+
Sbjct  70   QFLFFCGTESSG-RSSSFTSRMNLQPQ-------------QFQTKQTQPAISHRMPVFFA  115

Query  297  PRNAPTSPAAAPLYSP  312
            P      P+A P  SP
Sbjct  116  P------PSALPTLSP  125

>PYAP_20623
Length=715

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 41/95 (43%), Gaps = 14/95 (15%)

Query  10   PVRPSCRSTAARRLALR---PIVQESARRE-GVQQLSVAAALNLGEAAR--HSPPTGGEY  63
             V  SC  T   RLALR     V++   RE  V +      +N+ +A R  H      E 
Sbjct  311  AVVQSCVMTGNERLALRCYHACVEDEVEREIAVVRADENIYVNVLKACRAAHDKSLFREI  370

Query  64   YRPHSLVERRSPSDYKHRRALLGRAMRFGHAHDHD  98
            YR       R  S+ K R A  G A+RF H H HD
Sbjct  371  YR-------RMVSENKARSAGFGSAIRFCHEH-HD  397

Lambda      K        H        a         alpha
   0.320    0.136    0.430    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 21178249275

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40