Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYVX_1586391811816794e-91
PITG_000119160872146e-21
PPTG_166729286872163e-20
PHYSO_4782539169652086e-20
PHYCA_5047069253652032e-18
PHYKE_57209221651863e-16
HYAP_015139248651821e-15
PHALS_108359264751663e-13
PYU1_G00322593697227681346e-09
PYAR_194629980111645780.092
PHYSO_2965561113655770.17
PITG_000131113556760.19
PPTG_166701113856760.21
PHYRA_788191020053750.38
PHYRA_788181113465730.45
PHYKE_57191113056701.1
HYAP_015081113261691.8
PPTG_166711020956693.0
PITG_000121018557683.7
PHALS_108371110846654.9
PHYCA_1044361018156666.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYVX_15863

Length=181
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYVX_15863                                                            266        4e-91
PITG_00011                                                            87.0       6e-21
PPTG_16672                                                            87.8       3e-20
PHYSO_478253                                                          84.7       6e-20
PHYCA_504706                                                          82.8       2e-18
PHYKE_5720                                                            76.3       3e-16
HYAP_01513                                                            74.7       1e-15
PHALS_10835                                                           68.6       3e-13
PYU1_G003225                                                          56.2       6e-09
PYAR_19462                                                            34.7       0.092
PHYSO_296556                                                          34.3       0.17 
PITG_00013                                                            33.9       0.19 
PPTG_16670                                                            33.9       0.21 
PHYRA_78819                                                           33.5       0.38 
PHYRA_78818                                                           32.7       0.45 
PHYKE_5719                                                            31.6       1.1  
HYAP_01508                                                            31.2       1.8  
PPTG_16671                                                            31.2       3.0  
PITG_00012                                                            30.8       3.7  
PHALS_10837                                                           29.6       4.9  
PHYCA_104436                                                          30.0       6.8  

>PYVX_15863
Length=181

 Score = 266 bits (679),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 181/181 (100%), Positives = 181/181 (100%), Gaps = 0/181 (0%)

Query  1    MSPRRPEDELRGSQASMASTDVPMTPRKSGAGIMRAVGGLFrrksgassrssmssapser  60
            MSPRRPEDELRGSQASMASTDVPMTPRKSGAGIMRAVGGLFRRKSGASSRSSMSSAPSER
Sbjct  1    MSPRRPEDELRGSQASMASTDVPMTPRKSGAGIMRAVGGLFRRKSGASSRSSMSSAPSER  60

Query  61   swrmsrsrsrPEAATTLATMQPPHQSGKQAsetssansfsspsDPTELDVADAAPEFLFY  120
            SWRMSRSRSRPEAATTLATMQPPHQSGKQASETSSANSFSSPSDPTELDVADAAPEFLFY
Sbjct  61   SWRMSRSRSRPEAATTLATMQPPHQSGKQASETSSANSFSSPSDPTELDVADAAPEFLFY  120

Query  121  GGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADPREYE  180
            GGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADPREYE
Sbjct  121  GGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADPREYE  180

Query  181  F  181
            F
Sbjct  181  F  181

>PITG_00011
Length=160

 Score = 87.0 bits (214),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 60/87 (69%), Gaps = 10/87 (11%)

Query  104  DPTELDVADAAPE---------FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHM  154
            DP++L +AD++ E         FLF+GGSD D  F+P+LRPS LD +  + IRP ++  M
Sbjct  75   DPSDLLLADSSDESGAEPQRVSFLFFGGSDTDSTFQPELRPSELDDLHQNDIRPSLQAKM  134

Query  155  PVFFSAPQYENLRRSSILGADPREYEF  181
            P+FFS P  EN+RRSSIL  DP+EYEF
Sbjct  135  PLFFSPPLVENMRRSSIL-PDPKEYEF  160

>PPTG_16672
Length=286

 Score = 87.8 bits (216),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 10/87 (11%)

Query  104  DPTELDVADAAPE---------FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHM  154
            DP+EL +AD++ E         FLF+GGSDVD  F+P+LRPS LD +  + IRP ++  M
Sbjct  201  DPSELLMADSSDESGAEPQRVSFLFFGGSDVDSTFQPELRPSELDDLHENDIRPSLQAKM  260

Query  155  PVFFSAPQYENLRRSSILGADPREYEF  181
            P+FFS P  E++RRSSIL  DP+EYEF
Sbjct  261  PLFFSPPLVEHMRRSSIL-PDPKEYEF  286

>PHYSO_478253
Length=169

 Score = 84.7 bits (208),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 50/65 (77%), Gaps = 1/65 (2%)

Query  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176
            FLF+GGSDVD  F+P+LRPS LD +  + IRP ++  MP+FFS P  EN+RRSSIL  DP
Sbjct  106  FLFFGGSDVDSTFQPELRPSELDDLHENEIRPSLQVKMPLFFSPPLVENMRRSSIL-PDP  164

Query  177  REYEF  181
            +EYEF
Sbjct  165  KEYEF  169

>PHYCA_504706
Length=253

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 1/65 (2%)

Query  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176
            FLF+GGSD D  F+P+LRPS  D +  + IRP ++  MP+FFS P  EN+RRSSIL  DP
Sbjct  190  FLFFGGSDTDSTFQPELRPSEYDELHENDIRPSLQAKMPLFFSPPMVENMRRSSIL-PDP  248

Query  177  REYEF  181
            +EYEF
Sbjct  249  KEYEF  253

>PHYKE_5720
Length=221

 Score = 76.3 bits (186),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 1/65 (2%)

Query  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176
            FLF+GGSD +  F PDLRPS LD +  + +RP ++  MP FFS P  E++RRSSIL  DP
Sbjct  158  FLFFGGSDNESTFVPDLRPSDLDDLHENDLRPSLQAKMPQFFSPPVVEHMRRSSIL-PDP  216

Query  177  REYEF  181
            REYEF
Sbjct  217  REYEF  221

>HYAP_01513
Length=248

 Score = 74.7 bits (182),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (2%)

Query  117  FLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENLRRSSILGADP  176
            FL +GGS+VD  F+P+L PS  D V  S IRPV++  MP+FFS P  E LRRSS   +DP
Sbjct  185  FLIFGGSEVDSTFEPELHPSEYDDVHGSEIRPVLQNKMPLFFSLPLAERLRRSSA-KSDP  243

Query  177  REYEF  181
            +EYE 
Sbjct  244  KEYEL  248

>PHALS_10835
Length=264

 Score = 68.6 bits (166),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 1/75 (1%)

Query  107  ELDVADAAPEFLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYENL  166
            EL V      FLF+GGSDVD  F+P+LRPS LD +  + IRP ++  MP+F   P  +N+
Sbjct  191  ELGVELQRVSFLFFGGSDVDCTFQPELRPSELDDLHENDIRPSLQAKMPLFLPPPLPKNV  250

Query  167  RRSSILGADPREYEF  181
            RRSSIL  DP EYEF
Sbjct  251  RRSSIL-PDPEEYEF  264

>PYU1_G003225
Length=227

 Score = 56.2 bits (134),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 42/68 (62%), Gaps = 3/68 (4%)

Query  116  EFLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQY-ENL-RRSSILG  173
            +FLFY GS  D +FKP+   S +  +  +AIRP +   MPVFFS P    N  RRSSIL 
Sbjct  125  QFLFYPGSAEDNSFKPEKVTSSIVEIDYNAIRPSLTLQMPVFFSPPTEPSNFPRRSSIL-  183

Query  174  ADPREYEF  181
             DPREYE 
Sbjct  184  TDPREYEL  191

>PYAR_19462
Length=116

 Score = 34.7 bits (78),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 25/45 (56%), Gaps = 8/45 (18%)

Query  115  PEFLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFS  159
            P+FLF+ GSD   A +  L+ S ++        P++   MPVFF+
Sbjct  70   PQFLFFCGSDTSAA-RASLKSSKIET-------PMISHRMPVFFN  106

>PHYSO_296556
Length=136

 Score = 34.3 bits (77),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 28/55 (51%), Gaps = 8/55 (15%)

Query  115  PEFLFYGGSDVDGAFKPDLRPSH--------LDLVQPSAIRPVVKQHMPVFFSAP  161
            P+FLF+ G+D  G+   +L  ++          +  P+  +P +  HMPVFF  P
Sbjct  67   PQFLFFCGTDSSGSPSAELTAANGTTLASRIASMNAPAPAQPAIDHHMPVFFMPP  121

>PITG_00013
Length=135

 Score = 33.9 bits (76),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 10/56 (18%)

Query  115  PEFLFYGGSDVDGAF------KPD---LRPSHLDLVQPSAIRPVVKQHMPVFFSAP  161
            P+FLF+ GSD + A+       P+   L      +  P+ ++PV+  HMPVFF  P
Sbjct  66   PQFLFFCGSD-NSAYPSSELTSPNGSTLASRFASMKAPTPVQPVIDHHMPVFFMPP  120

>PPTG_16670
Length=138

 Score = 33.9 bits (76),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 10/56 (18%)

Query  115  PEFLFYGGSDVDGAF------KPD---LRPSHLDLVQPSAIRPVVKQHMPVFFSAP  161
            P+FLF+ GSD + AF       P+   L      +  P+  +PV+  HMPVFF +P
Sbjct  69   PQFLFFCGSD-NSAFPSGELTSPNGSTLASRLARMKAPTPAQPVIDHHMPVFFMSP  123

>PHYRA_78819
Length=200

 Score = 33.5 bits (75),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 29/53 (55%), Gaps = 9/53 (17%)

Query  116  EFLFYGGSD--------VDGAFKPDLRPSHLDLVQPSAI-RPVVKQHMPVFFS  159
            +FLFYGGSD          G ++ D+  ++++ + P+A   P +   MP FFS
Sbjct  109  QFLFYGGSDPPTPTSAGGPGGYRSDMISNYVEPISPAAFASPRINHEMPCFFS  161

>PHYRA_78818
Length=134

 Score = 32.7 bits (73),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (48%), Gaps = 10/65 (15%)

Query  106  TELDVADAAPEFLFYGGSDVDGAF------KPD---LRPSHLDLVQPSAIRPVVKQHMPV  156
            + L   +  P+FLF+ GSD   AF       P+   L     ++  P+  +P +  HMPV
Sbjct  56   SRLSSINERPQFLFFCGSDTS-AFPSGELTSPNGSTLASRLANMTAPTPAQPAIDHHMPV  114

Query  157  FFSAP  161
            FF  P
Sbjct  115  FFMPP  119

>PHYKE_5719
Length=130

 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 10/56 (18%)

Query  115  PEFLFYGGSDVDGAF------KPD---LRPSHLDLVQPSAIRPVVKQHMPVFFSAP  161
            P+FLF+ GSD   AF       P+   L      +  P+  +P +  HMPVFF  P
Sbjct  68   PQFLFFCGSDTS-AFPSGELTSPNGSTLASRLASITCPTPAQPAINHHMPVFFMPP  122

>HYAP_01508
Length=132

 Score = 31.2 bits (69),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 28/61 (46%), Gaps = 11/61 (18%)

Query  116  EFLFYGGSDV----------DGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAPQYEN  165
            +FL + GSD           DG      R + L+    +A +PV+ +HMPVFF  P    
Sbjct  66   QFLLFCGSDTATSPAELVSADGTTLAS-RFAKLNAPGTAATQPVINRHMPVFFMPPVVAE  124

Query  166  L  166
            L
Sbjct  125  L  125

>PPTG_16671
Length=209

 Score = 31.2 bits (69),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 12/56 (21%)

Query  116  EFLFYGGSD----------VDGAFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159
            +FLFYGGSD              ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  113  QFLFYGGSDPPTPTSAGGLYSNGYRSDMISNYVEPMSPAASIESPRINHEMPCFFS  168

>PITG_00012
Length=185

 Score = 30.8 bits (68),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 13/57 (23%)

Query  116  EFLFYGGSD-----------VDGAFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159
            +FLFYGGSD             G ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  88   QFLFYGGSDPPTPTSVGDLYPSGGYRSDMISNYVEPMSPAASIESPRISHEMPCFFS  144

>PHALS_10837
Length=108

 Score = 29.6 bits (65),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  116  EFLFYGGSDVDGAFKPDLRPSHLDLVQPSAIRPVVKQHMPVFFSAP  161
            +F+F+ GSD       D    H  +++ +A +PV+   MPVF   P
Sbjct  49   QFVFFCGSDASAVPSGDYASFHNSILEATA-QPVIDHRMPVFIMPP  93

>PHYCA_104436
Length=181

 Score = 30.0 bits (66),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 12/56 (21%)

Query  116  EFLFYGGSD------VDG----AFKPDLRPSHLDLVQPSAI--RPVVKQHMPVFFS  159
            +FLFYGGSD      V G     ++ D+  ++++ + P+A    P +   MP FFS
Sbjct  87   QFLFYGGSDPPTPNSVGGLHQNGYRSDMISNYVEPMSPAASIESPRISHEMPCFFS  142

Lambda      K        H        a         alpha
   0.316    0.133    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7377564909

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40