Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G001740147522062069343e-129
PYIR_26626147522121917472e-100
PYU1_G001744568762131667151e-95
PYU1_G001741854041991686871e-91
PYU1_G001742932042131666881e-91
PYIR_25089854042621706756e-89
PYU1_G001739932032661645976e-77
PHYCA_129425147522041865873e-76
PHYRA_84190720132061645777e-75
PPTG_10635528561991645761e-74
PHYSO_284086147522041635742e-74
PHYCA_14369109792481645756e-74
PPTG_10636109792461645749e-74
PHYSO_341599109791851645689e-74
PHYRA_85631109792281645693e-73
PHYRA_82864231281931675629e-73
PHYKE_8389147522041645612e-72
PPTG_10643457052501625653e-72
PHYCA_102852242061951645576e-72
PPTG_17122147522041865586e-72
PHALS_00498109791991635561e-71
PPTG_10634720132081645501e-70
PYVX_18173449665001625713e-70
PHYCA_102624720131951685455e-70
PHYSO_536424606911971615446e-70
PHYSO_507031586531971615446e-70
PHYKE_7718109792201645451e-69
PHYRA_81106147522021645431e-69
PHYCA_102550457052681645481e-69
PHYKE_3446231281991875394e-69
PYVX_18174854042041865395e-69
PITG_18450147522031865387e-69
PPTG_15264231281941645291e-67
PPTG_17366239131941645291e-67
PHYKE_8388568762051885301e-67
PHYCA_511409568762041645143e-65
PHYSO_477820568762021645119e-65
PPTG_17121568762021645101e-64
PHYRA_81107568762021645091e-64
PHALS_03284309411881635045e-64
PYVX_18176568762011645041e-63
PYAP_22278932042891715101e-63
PYAP_22273932032681695073e-63
PYIR_26546866052391694964e-62
PYAR_24096932032271644893e-61
PPTG_10048213141901644855e-61
PYIW_18791854041941644831e-60
PYAP_22279854042231654737e-59
PHYCA_510817445761881684585e-57
PPTG_17123147532011594474e-55
PPTG_0882086622501684505e-55
PHYCA_537323449662001674441e-54
PHYSO_499978231281741664383e-54
PHYSO_501575820771741664383e-54
PPTG_14255469372681664463e-54
PPTG_14254445761881674386e-54
PYU1_G001738534612261614391e-53
PHYRA_81105534612011624362e-53
PHYSO_417649445761851684316e-53
PHYKE_9185445762811704396e-53
PITG_13520109791711344253e-52
PHYSO_353401534611461404224e-52
PITG_18452147538561614597e-52
PYIW_18788932032441664227e-51
HYAP_07096534612511624132e-49
PHYCA_53693413059831674413e-49
PHYSO_262732469371881684022e-48
PHYSO_254168462841701483974e-48
PHYSO_343376532371721293915e-47
PITG_1049986623231594018e-47
PHYSO_341596528562311243782e-44
PHYSO_527908600641741553672e-43
PYIW_18792932041251053441e-40
PHYCA_14368528562191643512e-40
PHYSO_340369526762001703181e-35
PHYSO_246676457051871642986e-33
PYAP_18131991722261142982e-32
PYVX_18179534611471622843e-31
PYIW_187905687686792714e-30
PHYSO_342364529831941792752e-29
PYAP_18711943562101712721e-28
PYAP_246891014392521752662e-27
PYAP_18709943552351722601e-26
PYU1_G007476539131951312543e-26
PYIR_2213497753002072509e-25
PHYKE_600144782891792472e-24
PHYRA_78625541464341662506e-24
PHYRA_78626578954731662507e-24
PHYSO_438103557212381792417e-24
PYIR_1643542333041292421e-23
PYIR_1644442341821712342e-23
PYAR_14260845342121342336e-23
PYIR_24421899032131322328e-23
PITG_1193697753331372371e-22
PHYSO_340333526712841792351e-22
PHYRA_78175764333191372362e-22
PHYSO_34033244782951792342e-22
PITG_0527144782781782332e-22
H310_0636217301971292282e-22
PYIW_242891643031961802282e-22
PHYKE_10578778802391832293e-22
PYU1_G005324845341911322255e-22
PYU1_G005326463491911322255e-22
PYU1_G00532842331911322255e-22
PYAR_206171040482541692295e-22
H257_1355017302661432305e-22
PYIW_27477823991801612237e-22
PPTG_0313997753201372301e-21
PYU1_G005323943552511322271e-21
PHYCA_534296526713091332301e-21
PYU1_G005325943562071322241e-21
PYAR_14256943551991322231e-21
PHYCA_1961197755311372332e-21
PHYRA_7868968382961792272e-21
PHYKE_6077188563221372282e-21
PHYCA_13036542352661352262e-21
PHYRA_74651699693441342283e-21
PYIW_242881643022011842213e-21
PYU1_G01469042342951682253e-21
PYIR_16443823992751662243e-21
HYAP_0168373983361242265e-21
PHYCA_12727044782791792236e-21
PYAR_2411397811921732161e-20
PHYSO_533682604462781332211e-20
PHYKE_839053461130972121e-20
PPTG_07509718142991822211e-20
PYU1_G001528861322741822192e-20
PYVX_18175147521471852112e-20
PPTG_04622696962731372192e-20
PYVX_14662510865401422243e-20
PYIW_168101650732161722153e-20
PHYSO_533903604652081812134e-20
PYIW_2196497752651842174e-20
PPTG_0750738072991822184e-20
PHYRA_78176597733121352184e-20
PYIW_19151831912481342146e-20
PHYCA_98479819502761672157e-20
PHYRA_7358442332871372167e-20
PYU1_G001514188574691232181e-19
PYIR_23585845342401682111e-19
PHALS_0539242353671422162e-19
PYAP_1871342341841642072e-19
SPRG_199171339462411392102e-19
PHYCA_12942213313531762142e-19
PHYRA_73607194343431342133e-19
PYVX_20783375052761772113e-19
PITG_0494942353371352124e-19
PHYKE_2454751493741862134e-19
PPTG_04647194343271372124e-19
PPTG_1422144782751382104e-19
PHYKE_9023371742751162104e-19
PHYSO_48552442342781452095e-19
PPTG_0461842353261352116e-19
PHYSO_524101597733081352106e-19
PHYSO_48395542353201352107e-19
PHYRA_77971705552301812058e-19
PYIW_254631650392161392041e-18
PHYRA_85794726192301812051e-18
PHALS_03177526712591382061e-18
PHYRA_7358242353261772082e-18
CCI4738117292111392032e-18
PHYRA_84947539132651662052e-18
SPRG_19916161733051402072e-18
PHYCA_534473423310501342112e-18
SPRG_2216117303001392062e-18
PHYRA_86016727462361082032e-18
PHYKE_607897753171352072e-18
PYU1_G005985820772001352012e-18
PHYCA_531163194343141372062e-18
PYAR_16493841752561212042e-18
SDRG_173181339462411392033e-18
PYVX_20789539132901662053e-18
PHYRA_73606571983661372073e-18
PHYKE_1913732362801832034e-18
PHYCA_97965401872881812044e-18
PYIW_1552617302561402024e-18
PPTG_0315697874451832074e-18
PYIR_22133839874411792074e-18
PHYRA_86752732363001792044e-18
PYU1_G00152797792781242034e-18
PYU1_G00152397762781242034e-18
PPTG_03138188562941352035e-18
PHYKE_2937571983661342055e-18
PHYCA_19612188566101352075e-18
PYIR_15187820772071821986e-18
PHYCA_12943369712871812026e-18
PHYRA_80632711613301362046e-18
PYAP_24691101441145721946e-18
PHYKE_902473982991592027e-18
PHYKE_6002526711971271977e-18
SPRG_077961259803221772037e-18
PITG_0494842342321281997e-18
PYU1_G005872161732971392027e-18
PHYCA_12331697763161732037e-18
PHALS_0317644782071811979e-18
PYU1_G005871944962841392019e-18
PYAP_1970799579241961981e-17
PYU1_G007364851643161332011e-17
PPTG_07521450302811061992e-17
PHYRA_7914038074241052032e-17
PYU1_G00152697803341232012e-17
PYVX_19277793613311352002e-17
PHALS_03179308833721802012e-17
PYIR_24743851643571832012e-17
PYIR_26867868821631511912e-17
PYU1_G00151997822651871972e-17
CCA1717917291851391923e-17
SDRG_165351259803131771983e-17
PHYSO_484051571982851331973e-17
PYU1_G005873510322141391943e-17
PHYCA_112615308831961681933e-17
PHYKE_6079597733021351983e-17
H310_054321431863011771973e-17
H257_112641259792821811973e-17
PPTG_07516464352941441974e-17
PPTG_0461942342761281964e-17
PYAP_22462820772101811934e-17
PPTG_0752038142941441974e-17
PHYSO_24648197753181351984e-17
PITG_1981815643147641894e-17
PHYRA_78161375713731861985e-17
PPTG_03153597733141331975e-17
PYVX_16138786195591971995e-17
PHYRA_7358342346301281996e-17
PPTG_18166242064451831996e-17
PHYKE_391342343211241966e-17
PYU1_G001520839873791801986e-17
PHYKE_771752856568441997e-17
PITG_1194297802711591947e-17
SPRG_0782697753711791977e-17
PHYKE_1029517292921391957e-17
PHYRA_83500718143941051977e-17
PYAR_1816599579261971938e-17
PYIR_19612831912601391938e-17
PHYRA_83494464352241081918e-17
PYIW_242871643013251831951e-16
H257_112651431862821811931e-16
SPRG_078251259983371791951e-16
PHYSO_31868397763521831951e-16
PYAP_18221944962261891901e-16
PYIW_2557397812791561921e-16
PHYRA_8063173983201241931e-16
PYU1_G005866574611941311882e-16
PHYCA_12347697813011851922e-16
PHYSO_426658554392101361882e-16
PYU1_G005867944952001331882e-16
PHYKE_81047713586611802e-16
PHYRA_83499204334731771952e-16
SDRG_009721259983331831932e-16
PYAP_16994841752641251902e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001740

Length=206
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001740                                                          364        3e-129
PYIR_26626                                                            292        2e-100
PYU1_G001744                                                          280        1e-95 
PYU1_G001741                                                          269        1e-91 
PYU1_G001742                                                          269        1e-91 
PYIR_25089                                                            264        6e-89 
PYU1_G001739                                                          234        6e-77 
PHYCA_129425                                                          230        3e-76 
PHYRA_84190                                                           226        7e-75 
PPTG_10635                                                            226        1e-74 
PHYSO_284086                                                          225        2e-74 
PHYCA_14369                                                           226        6e-74 
PPTG_10636                                                            225        9e-74 
PHYSO_341599                                                          223        9e-74 
PHYRA_85631                                                           223        3e-73 
PHYRA_82864                                                           221        9e-73 
PHYKE_8389                                                            220        2e-72 
PPTG_10643                                                            222        3e-72 
PHYCA_102852                                                          219        6e-72 
PPTG_17122                                                            219        6e-72 
PHALS_00498                                                           218        1e-71 
PPTG_10634                                                            216        1e-70 
PYVX_18173                                                            224        3e-70 
PHYCA_102624                                                          214        5e-70 
PHYSO_536424                                                          214        6e-70 
PHYSO_507031                                                          214        6e-70 
PHYKE_7718                                                            214        1e-69 
PHYRA_81106                                                           213        1e-69 
PHYCA_102550                                                          215        1e-69 
PHYKE_3446                                                            212        4e-69 
PYVX_18174                                                            212        5e-69 
PITG_18450                                                            211        7e-69 
PPTG_15264                                                            208        1e-67 
PPTG_17366                                                            208        1e-67 
PHYKE_8388                                                            208        1e-67 
PHYCA_511409                                                          202        3e-65 
PHYSO_477820                                                          201        9e-65 
PPTG_17121                                                            201        1e-64 
PHYRA_81107                                                           200        1e-64 
PHALS_03284                                                           198        5e-64 
PYVX_18176                                                            198        1e-63 
PYAP_22278                                                            201        1e-63 
PYAP_22273                                                            199        3e-63 
PYIR_26546                                                            195        4e-62 
PYAR_24096                                                            192        3e-61 
PPTG_10048                                                            191        5e-61 
PYIW_18791                                                            190        1e-60 
PYAP_22279                                                            186        7e-59 
PHYCA_510817                                                          181        5e-57 
PPTG_17123                                                            176        4e-55 
PPTG_08820                                                            177        5e-55 
PHYCA_537323                                                          175        1e-54 
PHYSO_499978                                                          173        3e-54 
PHYSO_501575                                                          173        3e-54 
PPTG_14255                                                            176        3e-54 
PPTG_14254                                                            173        6e-54 
PYU1_G001738                                                          173        1e-53 
PHYRA_81105                                                           172        2e-53 
PHYSO_417649                                                          170        6e-53 
PHYKE_9185                                                            173        6e-53 
PITG_13520                                                            168        3e-52 
PHYSO_353401                                                          167        4e-52 
PITG_18452                                                            181        7e-52 
PYIW_18788                                                            167        7e-51 
HYAP_07096                                                            163        2e-49 
PHYCA_536934                                                          174        3e-49 
PHYSO_262732                                                          159        2e-48 
PHYSO_254168                                                          157        4e-48 
PHYSO_343376                                                          155        5e-47 
PITG_10499                                                            159        8e-47 
PHYSO_341596                                                          150        2e-44 
PHYSO_527908                                                          145        2e-43 
PYIW_18792                                                            137        1e-40 
PHYCA_14368                                                           139        2e-40 
PHYSO_340369                                                          127        1e-35 
PHYSO_246676                                                          119        6e-33 
PYAP_18131                                                            119        2e-32 
PYVX_18179                                                            114        3e-31 
PYIW_18790                                                            108        4e-30 
PHYSO_342364                                                          110        2e-29 
PYAP_18711                                                            109        1e-28 
PYAP_24689                                                            107        2e-27 
PYAP_18709                                                            104        1e-26 
PYU1_G007476                                                          102        3e-26 
PYIR_22134                                                            100        9e-25 
PHYKE_6001                                                            99.8       2e-24 
PHYRA_78625                                                           100        6e-24 
PHYRA_78626                                                           100        7e-24 
PHYSO_438103                                                          97.4       7e-24 
PYIR_16435                                                            97.8       1e-23 
PYIR_16444                                                            94.7       2e-23 
PYAR_14260                                                            94.4       6e-23 
PYIR_24421                                                            94.0       8e-23 
PITG_11936                                                            95.9       1e-22 
PHYSO_340333                                                          95.1       1e-22 
PHYRA_78175                                                           95.5       2e-22 
PHYSO_340332                                                          94.7       2e-22 
PITG_05271                                                            94.4       2e-22 
H310_06362                                                            92.4       2e-22 
PYIW_24289                                                            92.4       2e-22 
PHYKE_10578                                                           92.8       3e-22 
PYU1_G005324                                                          91.3       5e-22 
PYU1_G005326                                                          91.3       5e-22 
PYU1_G005328                                                          91.3       5e-22 
PYAR_20617                                                            92.8       5e-22 
H257_13550                                                            93.2       5e-22 
PYIW_27477                                                            90.5       7e-22 
PPTG_03139                                                            93.2       1e-21 
PYU1_G005323                                                          92.0       1e-21 
PHYCA_534296                                                          93.2       1e-21 
PYU1_G005325                                                          90.9       1e-21 
PYAR_14256                                                            90.5       1e-21 
PHYCA_19611                                                           94.4       2e-21 
PHYRA_78689                                                           92.0       2e-21 
PHYKE_6077                                                            92.4       2e-21 
PHYCA_130365                                                          91.7       2e-21 
PHYRA_74651                                                           92.4       3e-21 
PYIW_24288                                                            89.7       3e-21 
PYU1_G014690                                                          91.3       3e-21 
PYIR_16443                                                            90.9       3e-21 
HYAP_01683                                                            91.7       5e-21 
PHYCA_127270                                                          90.5       6e-21 
PYAR_24113                                                            87.8       1e-20 
PHYSO_533682                                                          89.7       1e-20 
PHYKE_8390                                                            86.3       1e-20 
PPTG_07509                                                            89.7       1e-20 
PYU1_G001528                                                          89.0       2e-20 
PYVX_18175                                                            85.9       2e-20 
PPTG_04622                                                            89.0       2e-20 
PYVX_14662                                                            90.9       3e-20 
PYIW_16810                                                            87.4       3e-20 
PHYSO_533903                                                          86.7       4e-20 
PYIW_21964                                                            88.2       4e-20 
PPTG_07507                                                            88.6       4e-20 
PHYRA_78176                                                           88.6       4e-20 
PYIW_19151                                                            87.0       6e-20 
PHYCA_98479                                                           87.4       7e-20 
PHYRA_73584                                                           87.8       7e-20 
PYU1_G001514                                                          88.6       1e-19 
PYIR_23585                                                            85.9       1e-19 
PHALS_05392                                                           87.8       2e-19 
PYAP_18713                                                            84.3       2e-19 
SPRG_19917                                                            85.5       2e-19 
PHYCA_12942                                                           87.0       2e-19 
PHYRA_73607                                                           86.7       3e-19 
PYVX_20783                                                            85.9       3e-19 
PITG_04949                                                            86.3       4e-19 
PHYKE_2454                                                            86.7       4e-19 
PPTG_04647                                                            86.3       4e-19 
PPTG_14221                                                            85.5       4e-19 
PHYKE_9023                                                            85.5       4e-19 
PHYSO_485524                                                          85.1       5e-19 
PPTG_04618                                                            85.9       6e-19 
PHYSO_524101                                                          85.5       6e-19 
PHYSO_483955                                                          85.5       7e-19 
PHYRA_77971                                                           83.6       8e-19 
PYIW_25463                                                            83.2       1e-18 
PHYRA_85794                                                           83.6       1e-18 
PHALS_03177                                                           84.0       1e-18 
PHYRA_73582                                                           84.7       2e-18 
CCI47381                                                              82.8       2e-18 
PHYRA_84947                                                           83.6       2e-18 
SPRG_19916                                                            84.3       2e-18 
PHYCA_534473                                                          85.9       2e-18 
SPRG_22161                                                            84.0       2e-18 
PHYRA_86016                                                           82.8       2e-18 
PHYKE_6078                                                            84.3       2e-18 
PYU1_G005985                                                          82.0       2e-18 
PHYCA_531163                                                          84.0       2e-18 
PYAR_16493                                                            83.2       2e-18 
SDRG_17318                                                            82.8       3e-18 
PYVX_20789                                                            83.6       3e-18 
PHYRA_73606                                                           84.3       3e-18 
PHYKE_1913                                                            82.8       4e-18 
PHYCA_97965                                                           83.2       4e-18 
PYIW_15526                                                            82.4       4e-18 
PPTG_03156                                                            84.3       4e-18 
PYIR_22133                                                            84.3       4e-18 
PHYRA_86752                                                           83.2       4e-18 
PYU1_G001527                                                          82.8       4e-18 
PYU1_G001523                                                          82.8       4e-18 
PPTG_03138                                                            82.8       5e-18 
PHYKE_2937                                                            83.6       5e-18 
PHYCA_19612                                                           84.3       5e-18 
PYIR_15187                                                            80.9       6e-18 
PHYCA_12943                                                           82.4       6e-18 
PHYRA_80632                                                           83.2       6e-18 
PYAP_24691                                                            79.3       6e-18 
PHYKE_9024                                                            82.4       7e-18 
PHYKE_6002                                                            80.5       7e-18 
SPRG_07796                                                            82.8       7e-18 
PITG_04948                                                            81.3       7e-18 
PYU1_G005872                                                          82.4       7e-18 
PHYCA_123316                                                          82.8       7e-18 
PHALS_03176                                                           80.5       9e-18 
PYU1_G005871                                                          82.0       9e-18 
PYAP_19707                                                            80.9       1e-17 
PYU1_G007364                                                          82.0       1e-17 
PPTG_07521                                                            81.3       2e-17 
PHYRA_79140                                                           82.8       2e-17 
PYU1_G001526                                                          82.0       2e-17 
PYVX_19277                                                            81.6       2e-17 
PHALS_03179                                                           82.0       2e-17 
PYIR_24743                                                            82.0       2e-17 
PYIR_26867                                                            78.2       2e-17 
PYU1_G001519                                                          80.5       2e-17 
CCA17179                                                              78.6       3e-17 
SDRG_16535                                                            80.9       3e-17 
PHYSO_484051                                                          80.5       3e-17 
PYU1_G005873                                                          79.3       3e-17 
PHYCA_112615                                                          79.0       3e-17 
PHYKE_6079                                                            80.9       3e-17 
H310_05432                                                            80.5       3e-17 
H257_11264                                                            80.5       3e-17 
PPTG_07516                                                            80.5       4e-17 
PPTG_04619                                                            80.1       4e-17 
PYAP_22462                                                            79.0       4e-17 
PPTG_07520                                                            80.5       4e-17 
PHYSO_246481                                                          80.9       4e-17 
PITG_19818                                                            77.4       4e-17 
PHYRA_78161                                                           80.9       5e-17 
PPTG_03153                                                            80.5       5e-17 
PYVX_16138                                                            81.3       5e-17 
PHYRA_73583                                                           81.3       6e-17 
PPTG_18166                                                            81.3       6e-17 
PHYKE_3913                                                            80.1       6e-17 
PYU1_G001520                                                          80.9       6e-17 
PHYKE_7717                                                            81.3       7e-17 
PITG_11942                                                            79.3       7e-17 
SPRG_07826                                                            80.5       7e-17 
PHYKE_10295                                                           79.7       7e-17 
PHYRA_83500                                                           80.5       7e-17 
PYAR_18165                                                            79.0       8e-17 
PYIR_19612                                                            79.0       8e-17 
PHYRA_83494                                                           78.2       8e-17 
PYIW_24287                                                            79.7       1e-16 
H257_11265                                                            79.0       1e-16 
SPRG_07825                                                            79.7       1e-16 
PHYSO_318683                                                          79.7       1e-16 
PYAP_18221                                                            77.8       1e-16 
PYIW_25573                                                            78.6       1e-16 
PHYRA_80631                                                           79.0       1e-16 
PYU1_G005866                                                          77.0       2e-16 
PHYCA_123476                                                          78.6       2e-16 
PHYSO_426658                                                          77.0       2e-16 
PYU1_G005867                                                          77.0       2e-16 
PHYKE_8104                                                            73.9       2e-16 
PHYRA_83499                                                           79.7       2e-16 
SDRG_00972                                                            79.0       2e-16 
PYAP_16994                                                            77.8       2e-16 
PHYKE_7445                                                            79.0       2e-16 
PHYSO_454780                                                          75.9       3e-16 
PPTG_06256                                                            78.6       3e-16 
SPRG_07799                                                            78.6       3e-16 
HYAP_01682                                                            78.6       3e-16 
PHYCA_19598                                                           79.0       3e-16 
PYU1_G001524                                                          78.2       3e-16 
PHYSO_318693                                                          79.0       3e-16 
PHYCA_15126                                                           78.6       3e-16 
PPTG_06253                                                            77.8       3e-16 
SPRG_07797                                                            78.2       4e-16 
PHYSO_459106                                                          76.6       4e-16 
PHYKE_2809                                                            77.8       4e-16 
SDRG_17317                                                            73.9       4e-16 
PYAP_22257                                                            77.0       4e-16 
PYU1_G005868                                                          77.0       4e-16 
PHYCA_120062                                                          76.3       5e-16 
PYIR_25999                                                            77.8       5e-16 
SDRG_16534                                                            77.8       5e-16 
SPRG_07795                                                            77.8       5e-16 
SDRG_15426                                                            78.6       6e-16 
PHYCA_15125                                                           77.4       7e-16 
PYIR_17978                                                            76.3       7e-16 
PHYRA_78172                                                           77.8       7e-16 
PHYRA_80750                                                           76.6       8e-16 
PHYRA_78177                                                           77.0       9e-16 
PYIR_25571                                                            76.6       9e-16 
PPTG_04803                                                            76.3       9e-16 
PYAP_14265                                                            76.6       1e-15 
PHYSO_533747                                                          74.7       1e-15 
PYAP_18226                                                            75.1       1e-15 
PYVX_21297                                                            75.9       1e-15 
PYU1_G001525                                                          76.3       1e-15 
PHYSO_525076                                                          77.0       1e-15 
PHYSO_374518                                                          72.4       1e-15 
PITG_08892                                                            76.3       1e-15 
PITG_21641                                                            76.6       2e-15 
PYIR_20481                                                            75.9       2e-15 
PPTG_03148                                                            75.9       2e-15 
PYIW_18794                                                            75.1       2e-15 
SDRG_07565                                                            75.5       2e-15 
PITG_11937                                                            75.9       2e-15 
PHYKE_6069                                                            75.9       2e-15 
SDRG_08782                                                            76.6       2e-15 
PITG_08895                                                            73.9       2e-15 
PYAR_24818                                                            73.9       2e-15 
SDRG_08137                                                            75.5       2e-15 
SDRG_08129                                                            74.3       2e-15 
PHYSO_337515                                                          75.9       2e-15 
PHYKE_2379                                                            75.5       2e-15 
PHYRA_78169                                                           76.3       2e-15 
PPTG_03160                                                            76.3       2e-15 
PHYRA_86201                                                           75.5       2e-15 
PPTG_04620                                                            75.9       3e-15 
PHYCA_122958                                                          75.1       3e-15 
SDRG_00948                                                            75.9       3e-15 
PPTG_03140                                                            75.9       3e-15 
PHYRA_84732                                                           74.7       3e-15 
PPTG_06249                                                            75.1       3e-15 
PITG_04947                                                            75.1       3e-15 
PHYSO_329293                                                          75.1       4e-15 
PHYSO_476077                                                          74.3       4e-15 
PHYSO_472009                                                          74.3       4e-15 
PHYCA_552912                                                          75.5       4e-15 
PHYSO_488921                                                          74.7       5e-15 
PHYCA_69583                                                           73.6       5e-15 
PYAP_19712                                                            74.3       5e-15 
PHYCA_18657                                                           74.3       6e-15 
PPTG_03147                                                            74.3       6e-15 
HYAP_14170                                                            73.9       6e-15 
PHYKE_6076                                                            73.9       7e-15 
PPTG_03161                                                            75.1       7e-15 
SPRG_07627                                                            75.1       7e-15 
PHYCA_6388                                                            73.9       7e-15 
PHYCA_132255                                                          70.5       9e-15 
PHYKE_2539                                                            73.2       1e-14 
PHYSO_375794                                                          70.5       1e-14 
PYVX_24563                                                            73.2       1e-14 
PHALS_04411                                                           73.2       1e-14 
PYAR_25949                                                            71.6       1e-14 
PHYSO_255975                                                          71.6       1e-14 
PHYRA_78174                                                           73.2       1e-14 
PYAR_25093                                                            71.6       2e-14 
PYIR_14463                                                            73.6       2e-14 
H257_11258                                                            73.6       2e-14 
PHALS_01293                                                           73.6       2e-14 
PHYRA_78164                                                           73.2       2e-14 
PYVX_22508                                                            72.8       2e-14 
PYAR_21940                                                            72.4       2e-14 
PYIW_19601                                                            72.0       2e-14 
PHYRA_77293                                                           72.8       2e-14 
PHYRA_78165                                                           72.8       3e-14 
PPTG_10186                                                            72.4       3e-14 
PYIR_16375                                                            72.0       3e-14 
PYIR_22549                                                            72.0       3e-14 
PHYCA_15124                                                           72.4       3e-14 
PITG_08202                                                            70.9       3e-14 
PYAP_18138                                                            72.0       3e-14 
PITG_20631                                                            72.0       3e-14 
PYAP_16338                                                            72.0       3e-14 
HYAP_11923                                                            73.2       3e-14 
PITG_20312                                                            72.0       3e-14 
PHYSO_374025                                                          72.4       4e-14 
PHYCA_10471                                                           72.4       4e-14 
PYU1_G007254                                                          70.5       4e-14 
PHYSO_255056                                                          71.6       4e-14 
PITG_11951                                                            69.7       4e-14 
PHALS_02295                                                           71.6       5e-14 
PYVX_21174                                                            67.4       6e-14 
PHYSO_262844                                                          71.2       6e-14 
PHALS_02044                                                           70.5       7e-14 
PYAR_17166                                                            67.8       8e-14 
PHYCA_18729                                                           71.6       9e-14 
PHYRA_78162                                                           72.0       9e-14 
PHALS_02041                                                           70.9       9e-14 
PHALS_05394                                                           70.9       9e-14 
PYIR_20482                                                            68.6       1e-13 
PHYRA_73581                                                           70.9       1e-13 
PHYCA_14560                                                           70.9       1e-13 
PPTG_10073                                                            68.9       1e-13 
PYAR_21271                                                            69.7       1e-13 
PYU1_G006404                                                          70.1       2e-13 
PPTG_03143                                                            70.9       2e-13 
PYAP_24338                                                            69.7       2e-13 
PPTG_03145                                                            70.1       2e-13 
PYIW_16208                                                            69.7       2e-13 
PYAP_18584                                                            68.6       2e-13 
PHYCA_19599                                                           70.5       3e-13 
PYVX_22510                                                            70.5       3e-13 
PYVX_23997                                                            68.2       3e-13 
PHYCA_103479                                                          69.7       3e-13 
PPTG_01148                                                            69.7       3e-13 
PYIW_18065                                                            69.7       3e-13 
PYAR_17163                                                            65.9       4e-13 
PHYRA_78167                                                           69.3       4e-13 
PYU1_G001516                                                          69.3       4e-13 
PHYRA_79881                                                           68.6       5e-13 
PPTG_04801                                                            68.6       5e-13 
PYAR_15391                                                            67.4       5e-13 
PYIW_23029                                                            65.9       5e-13 
PHYKE_6066                                                            68.9       5e-13 
PHALS_08575                                                           68.9       5e-13 
PHYKE_5749                                                            68.9       6e-13 
PYIR_20483                                                            68.6       7e-13 
PYIR_23689                                                            67.4       8e-13 
PYAP_23455                                                            68.9       8e-13 
PPTG_20376                                                            66.6       8e-13 
PYU1_G003057                                                          67.0       1e-12 
PHYKE_3912                                                            67.8       1e-12 
PITG_01966                                                            68.6       1e-12 
PITG_11943                                                            66.2       1e-12 
PHALS_02296                                                           67.8       1e-12 
PYAP_23672                                                            67.8       1e-12 
PHYKE_7446                                                            68.6       1e-12 
PHYSO_525490                                                          68.2       1e-12 
PHYCA_19606                                                           67.8       2e-12 
SPRG_04679                                                            66.6       2e-12 
PHYCA_10470                                                           67.4       2e-12 
PHALS_02037                                                           67.4       2e-12 
H310_05438                                                            67.0       3e-12 
PITG_11944                                                            67.0       3e-12 
PYU1_G005869                                                          66.2       4e-12 
PPTG_01153                                                            66.6       4e-12 
PITG_11957                                                            66.6       4e-12 
PPTG_18176                                                            65.9       5e-12 
PYU1_G001518                                                          66.2       5e-12 
PHALS_05110                                                           64.7       5e-12 
PYVX_21438                                                            65.9       6e-12 
PHYRA_86151                                                           63.9       6e-12 
PHYRA_86751                                                           63.9       6e-12 
PHYCA_562062                                                          65.1       7e-12 
PYAP_16347                                                            64.3       7e-12 
PYIR_20304                                                            64.7       8e-12 
PHYRA_87941                                                           63.5       8e-12 
PYVX_22511                                                            65.5       9e-12 
SDRG_17448                                                            65.1       1e-11 
PHYKE_10296                                                           65.9       1e-11 
PHALS_10635                                                           65.1       1e-11 
PPTG_06106                                                            64.7       1e-11 
PYIR_22634                                                            64.7       1e-11 
PYIR_16437                                                            64.7       2e-11 
PYIR_25334                                                            64.3       2e-11 
PHYRA_86241                                                           63.2       2e-11 
PHYRA_77290                                                           64.7       2e-11 
PHYKE_9025                                                            64.7       2e-11 
PHYKE_7443                                                            64.7       2e-11 
PYIR_24935                                                            63.9       2e-11 
H310_05433                                                            64.3       3e-11 
PYU1_G006405                                                          63.9       3e-11 
PYAR_14261                                                            61.6       4e-11 
PHYRA_93650                                                           62.8       4e-11 
PHYCA_559281                                                          61.2       4e-11 
PYIW_26655                                                            63.2       4e-11 
PYAR_23090                                                            61.2       5e-11 
PYIR_23622                                                            62.8       5e-11 
PYAR_15784                                                            61.6       7e-11 
PYAR_22058                                                            61.6       7e-11 
PYAR_26311                                                            61.2       8e-11 
PHYSO_342361                                                          60.8       9e-11 
PPTG_07511                                                            60.8       1e-10 
PHYSO_488139                                                          62.0       1e-10 
H257_11271                                                            62.4       2e-10 
PPTG_01152                                                            61.6       2e-10 
PYVX_16673                                                            62.4       2e-10 
PYU1_G007242                                                          61.6       2e-10 
PYAP_23673                                                            61.6       2e-10 
PHYRA_95184                                                           62.4       2e-10 
PYU1_G001475                                                          61.2       2e-10 
PYVX_24274                                                            60.8       2e-10 
PYU1_G005878                                                          57.4       3e-10 
PYAP_18307                                                            60.8       3e-10 
PYIW_21963                                                            61.2       3e-10 
PYAR_13902                                                            58.5       5e-10 
PHYRA_77291                                                           60.1       5e-10 
PYU1_G007250                                                          58.9       6e-10 
PYAR_17307                                                            59.7       6e-10 
PYVX_21643                                                            59.7       8e-10 
H257_11306                                                            60.1       8e-10 
HYAP_11925                                                            59.7       1e-09 
PYIW_23030                                                            59.3       1e-09 
PHYCA_14559                                                           58.9       1e-09 
PPTG_01147                                                            58.9       1e-09 
PYAP_25026                                                            58.5       2e-09 
PYAR_15390                                                            57.4       2e-09 
PHYSO_261686                                                          58.2       2e-09 
PPTG_04617                                                            58.9       2e-09 
PYU1_G006403                                                          58.2       2e-09 
PHYSO_256017                                                          56.6       3e-09 
PITG_01969                                                            58.2       3e-09 
PYU1_G001517                                                          58.5       3e-09 
PHYCA_558591                                                          55.5       3e-09 
PYIW_20715                                                            57.8       3e-09 
PHYCA_12944                                                           56.2       5e-09 
PHYKE_6067                                                            57.8       5e-09 
PYIW_14247                                                            57.0       6e-09 
PITG_04404                                                            56.6       7e-09 
PHYRA_95036                                                           57.0       7e-09 
PYIW_14252                                                            56.6       7e-09 
PYIR_24867                                                            57.4       7e-09 
PYIR_22136                                                            57.4       7e-09 
PYIR_22135                                                            57.4       8e-09 
PYIW_15528                                                            57.0       8e-09 
PHALS_01460                                                           57.0       8e-09 
PPTG_09880                                                            56.2       9e-09 
PHYSO_324715                                                          56.6       9e-09 
PYAP_16337                                                            56.2       1e-08 
PYAR_23252                                                            55.8       1e-08 
PHYSO_246472                                                          55.5       2e-08 
PHYRA_77292                                                           55.1       2e-08 
PYIR_26519                                                            55.5       2e-08 

>PYU1_G001740
Length=206

 Score = 364 bits (934),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 206/206 (100%), Positives = 206/206 (100%), Gaps = 0/206 (0%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPSAIKSVALAAIVSAAALCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT
Sbjct  1    MAPSAIKSVALAAIVSAAALCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120
            TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD
Sbjct  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYK  180
            GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYK
Sbjct  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYK  180

Query  181  ECVPLGRKRlleeesefesannaTRV  206
            ECVPLGRKRLLEEESEFESANNATRV
Sbjct  181  ECVPLGRKRLLEEESEFESANNATRV  206

>PYIR_26626
Length=212

 Score = 292 bits (747),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 169/191 (88%), Gaps = 2/191 (1%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS +KS+ALAAIVS+AALCDS  DAHQ VILP PTFT P K+  W+PLAFLENQGYKT
Sbjct  1    MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNS-NADFECGYTNKNGARQPIPA-NFRTTGYT  118
            TADFN Y KSKGYK+LRAFMDDKKAYKV++  A+FECGYTN NG RQPIPA   R+TGYT
Sbjct  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQV  178
            HDGPCEVWLDNTKV+SG+NC+KDFPGKTH++SYA+CKGSCTLRWYWMG+RFLK K SWQV
Sbjct  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180

Query  179  YKECVPLGRKR  189
            YKECVP+G  R
Sbjct  181  YKECVPIGSGR  191

>PYU1_G001744
Length=213

 Score = 280 bits (715),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK  84
            ADAHQ V+LP PTFTV T+ E+++PLAFLENQG+KTTADFNAYYK+KGYKSLRAFMDDKK
Sbjct  25   ADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKK  84

Query  85   AYKVNSNADFECGYTNKNGARQPIPA-NFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            AYKV + ADF+CG+T  +G RQPIPA   R+TGYTHDGPCEVWLDNT V+ G+NCH +FP
Sbjct  85   AYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFP  144

Query  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            G TH +SYA+CKGSCTLRWYWMGIRFLKGK+SWQVYK CVP+G KR
Sbjct  145  GTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKR  190

>PYU1_G001741
Length=199

 Score = 269 bits (687),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 1/168 (1%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            + ADAHQ V+LP PTFTV T+ E+++PLAFLENQG++TTADFNAYYK+KGYK+LRAFMDD
Sbjct  22   NTADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDD  81

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPA-NFRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            KKAY V S ADFECG+T  +G RQ IPA   R+TGYTHDGPCEVWLD+T+V+ G+NCH +
Sbjct  82   KKAYTVASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTE  141

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            F G TH + Y++CKGSCTLRWYWMGIRFLKG++SWQVYK CVP+G  R
Sbjct  142  FTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGSSR  189

>PYU1_G001742
Length=213

 Score = 269 bits (688),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 144/166 (87%), Gaps = 1/166 (1%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK  84
            ADAHQ V+LP PTFTV T+ E+++PLAFLENQGYKTT DFNAYYK+KGYK+LRAFMDD K
Sbjct  25   ADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPK  84

Query  85   AYKVNSNADFECGYTNKNGARQPIPA-NFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            AYKV + ADF+CG+T  +G RQPIPA   R+TGYTHDGPCEVWLD+T+V+ G+NCH +FP
Sbjct  85   AYKVAAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFP  144

Query  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            G T  + Y++CKGSCTLRWYWMGIRFLKGK+SWQVYK CVP+G KR
Sbjct  145  GTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGKR  190

>PYIR_25089
Length=262

 Score = 264 bits (675),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 2/170 (1%)

Query  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81
            D+  DAHQ VILP PTFTV T+ E+++PLAFLENQG+KTTADF+AYYK+KGYK+LRAFMD
Sbjct  22   DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  81

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPA--NFRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            DK AYKV   ADFECG+T   G  QPIP+    R+TGYTHDGPCEVWLD T+VL G+NCH
Sbjct  82   DKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCH  141

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
             +FPG T  + Y++CKGSC LRWYWMGIRFLKG++SWQVYK CVP+   R
Sbjct  142  SEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGSR  191

>PYU1_G001739
Length=266

 Score = 234 bits (597),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 2/164 (1%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            V DAHQ++I P P F V  KD +W PLAFLENQG  T+AD   + K KGY +LRA MDD+
Sbjct  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79

Query  84   KAYKVNSNADFECGYTNKNGARQPIP--ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y+VN++A FECGYT+     QPIP     R+TGYTHDGPCEVWLD+ KV+SG NCH  
Sbjct  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGKT  + Y++CKGSCTLRWYW+G+R+LK ++SWQ+YKECV L
Sbjct  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183

>PHYCA_129425
Length=204

 Score = 230 bits (587),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 2/186 (1%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS + S+ +AA +S+AAL    ADAHQ+V+LP PT+T   KD +++PLAFLE+QG+KT
Sbjct  1    MAPSLLSSLTVAAALSSAALLAPTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTH  119
              DFN + +S GYK+LRAFMD  K Y V   AD+ CG+TN   A QPIP    R+TGYTH
Sbjct  61   VEDFNGWRRSNGYKTLRAFMDGAK-YTVTDGADYYCGFTNAKAAPQPIPDGTMRSTGYTH  119

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            DGPCEVWLD+T+VL   NCH+ FPGKT+ + Y++CKGSC LRWYW+G RFLK +HSWQVY
Sbjct  120  DGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVY  179

Query  180  KECVPL  185
            K C+PL
Sbjct  180  KACIPL  185

>PHYRA_84190
Length=206

 Score = 226 bits (577),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 126/164 (77%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLEN+G+ T  DF A+    GYKSLR FMD+ 
Sbjct  7    TADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNA  66

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V + ADF CG+T+  G  QPIPA+   R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  67   K-YSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  125

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTLRWYWMG+RFLK  +SWQVYKEC+PL
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  169

>PPTG_10635
Length=199

 Score = 226 bits (576),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 126/164 (77%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +ADAHQ+V+LP P +T   KD +++PLAFLENQG+KT  DF ++    GYKSLR FMD  
Sbjct  7    MADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRA  66

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y+V S ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  67   K-YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKGSCTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  169

>PHYSO_284086
Length=204

 Score = 225 bits (574),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 126/163 (77%), Gaps = 2/163 (1%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP PT+T   K  +++PLAFLENQGY+T  DFNA+ + KGYK+LRAFMD  
Sbjct  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD-G  82

Query  84   KAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142
             +Y V   AD+ CG+T+  G  QPIP    R+TGYTHDGPCEVWLD T+VL   NCH+ F
Sbjct  83   ASYTVADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETF  142

Query  143  PGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             GKT+ + Y++CKGSCTLRWYW+G+RFLK ++SWQVYK CVPL
Sbjct  143  SGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

>PHYCA_14369
Length=248

 Score = 226 bits (575),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLENQG+KT  DF A+    GYKSLR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V + ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  84   K-YTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  186

>PPTG_10636
Length=246

 Score = 225 bits (574),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 127/164 (77%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +ADAHQ+V+LP P +T   KD +++PLAFLENQG+KT  DF ++     YKSLR FMD+ 
Sbjct  24   MADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y+V S ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  84   K-YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTLRWYW+GIRFLK ++SWQVYK C+PL
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  186

>PHYSO_341599
Length=185

 Score = 223 bits (568),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   K+ +++PLAFLENQG+KT  DF A+ K  GYKSLR FMD  
Sbjct  7    TADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRA  66

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V S ADF CG+T+  G  QPIP     R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  67   K-YDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  169

>PHYRA_85631
Length=228

 Score = 223 bits (569),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 124/164 (76%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLEN+G+ T  DF ++    GYKSLR FMD+ 
Sbjct  24   TADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  84   K-YNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTLRWYW+GIRFLK  +SWQVYKEC+PL
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

>PHYRA_82864
Length=193

 Score = 221 bits (562),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 126/167 (75%), Gaps = 2/167 (1%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLE QG+ T  DFNA+ +  GYK+LR FMD  
Sbjct  24   TADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPA-NFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142
            K Y V   AD+ CG+T+ NG  QPIPA N R+TGYTHDGPCEVWLDNT+VL G NCH+ F
Sbjct  84   K-YTVTEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQF  142

Query  143  PGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            P K + + Y++CKG+CTL WYW+G+RFLK  +SWQVYKEC+ L  ++
Sbjct  143  PDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTSQQ  189

>PHYKE_8389
Length=204

 Score = 220 bits (561),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 126/164 (77%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP PT+T   KD +++PLAFLENQG++T  DFNA+ ++ GYK+LRAFMD  
Sbjct  23   TADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   AD+ CG+TN + A Q IP+    R+TGYTHDGPCEVWLD T+VL+  NCH+ 
Sbjct  83   K-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  141

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C G+CTLRWYW+G+RFLK ++SWQVYK CVPL
Sbjct  142  ISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

>PPTG_10643
Length=250

 Score = 222 bits (565),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 3/162 (2%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  85
            DAHQ+V+LP P +T   KD +++PLAFLENQG+K   DF A+ K  GYKSLR FMD  K 
Sbjct  26   DAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRAK-  84

Query  86   YKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            Y+V   ADF CG+TN  G  QPIPA    R+TGYTHDGPCEV+LD+T VL G NCH+ FP
Sbjct  85   YEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFP  144

Query  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            GK   + Y++CKG+CTLRWYW+GIRFLK  +SWQVYKEC+PL
Sbjct  145  GKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PHYCA_102852
Length=195

 Score = 219 bits (557),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 123/164 (75%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLEN+G+ T  DF A+    GYKSLR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   ADF+CG+T+ NG  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  84   K-YPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTL W+W+G+RFLK  +SWQVYK C+PL
Sbjct  143  FPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PPTG_17122
Length=204

 Score = 219 bits (558),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 140/186 (75%), Gaps = 2/186 (1%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS + S+++AA++S+AAL    ++AHQ+V+LP PT+T   KD +++PLAFLENQGY+T
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTH  119
              DFN + ++ GYK+LR FMD  K Y V   AD+ CG+TN N A QPIP    R+TGYTH
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAK-YTVTDGADYYCGFTNVNAAPQPIPDGTMRSTGYTH  119

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            DGPCEVWLD  +VL   NCH+   GKT+ + Y++C G+CTLRWYW+G+R+LK  +SWQ+Y
Sbjct  120  DGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIY  179

Query  180  KECVPL  185
            K C+PL
Sbjct  180  KACIPL  185

>PHALS_00498
Length=199

 Score = 218 bits (556),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 124/163 (76%), Gaps = 3/163 (2%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
            AHQ+V+LP P +    KD R++PLAFLENQ +KTT D  AY+K   +K+LR FMD+ K Y
Sbjct  27   AHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAK-Y  85

Query  87   KVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144
             V   AD  CG+T+ NG  QPIPAN   R+TGYTHDGPCEVWL+NT+VLS SNCH+ FPG
Sbjct  86   TVVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPG  145

Query  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187
            K + + Y++CK +C LRWYW+G+RFLK K+SWQVYK C+PL R
Sbjct  146  KDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLSR  188

>PPTG_10634
Length=208

 Score = 216 bits (550),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 123/164 (75%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
              DAHQ+V+LP P +T   K+ +++PLAFLEN+G+ T  DF A+ K  GYKSLR F+D+ 
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   ADF+CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+T VL G NCH+ 
Sbjct  84   K-YPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y++CKG+CTL WYW+G+RFLK  +SWQVYK C+PL
Sbjct  143  FPGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYVX_18173
Length=500

 Score = 224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 1/162 (1%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK  84
            A AHQLVILP PT+TV  KD RW PLAFLE Q + TT DF  Y  + G+ SLRAFMDD  
Sbjct  232  AMAHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDS  291

Query  85   AYKVNSNADFECGYTNKNGARQPIPANF-RTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
             Y VN++ADF CG+T+ + A QPIP    R+TGYTHDGPCEVWLD+T+VL   NCH+   
Sbjct  292  LYSVNASADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVIS  351

Query  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            GKT+ + Y+AC GSCTL WYW+G+R+LK  +SWQVYK CVP+
Sbjct  352  GKTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393

 Score = 167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 100/166 (60%), Gaps = 2/166 (1%)

Query  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81
            DS     Q+V+ P P F V   D R SP+A+LE QG  T  +   +   +GY +LRA MD
Sbjct  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            D   Y V     F+CG T  N   QPIP N  F T+GYT DGPCE+W+DNT  L+G NCH
Sbjct  91   DDGLYSVTEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCH  150

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             +FP   H + Y+ C  SC + W+W+GI++   ++SWQV+K C+ L
Sbjct  151  TEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINL  196

>PHYCA_102624
Length=195

 Score = 214 bits (545),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 123/168 (73%), Gaps = 3/168 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             A AHQ+V+LP P +    +D +  PL FLE  G+KT ADF A+ K  GYKSLR FMD+ 
Sbjct  24   TATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V+  ADF+CG+T+ NG  QPIPA    R+TGYTHDGPCEVW+D+T V+ G NCH+ 
Sbjct  84   K-YPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            FPGK + + Y+ CKG CTL WYW+G+RFLK ++SWQVYKEC+PL  ++
Sbjct  143  FPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTSEQ  190

>PHYSO_536424
Length=197

 Score = 214 bits (544),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 120/161 (75%), Gaps = 3/161 (2%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
             HQ+V+LP P +T   K+ +++PLAFLEN+G+ T  DF A+ K  GYKSLR FMD  K Y
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK-Y  80

Query  87   KVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144
             V S ADF CG+T+  G  QPIP     R+TGYTHDGPCEVWLD+T VL G NCH+ FPG
Sbjct  81   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  140

Query  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            K + + Y++CKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  141  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYSO_507031
Length=197

 Score = 214 bits (544),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 120/161 (75%), Gaps = 3/161 (2%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
             HQ+V+LP P +T   K+ +++PLAFLEN+G+ T  DF A+ K  GYKSLR FMD  K Y
Sbjct  22   THQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK-Y  80

Query  87   KVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144
             V S ADF CG+T+  G  QPIP     R+TGYTHDGPCEVWLD+T VL G NCH+ FPG
Sbjct  81   DVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPG  140

Query  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            K + + Y++CKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  141  KDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPL  181

>PHYKE_7718
Length=220

 Score = 214 bits (545),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +ADAHQ+V+LP PT+T   KD +++PLAFLE +G+    DF A+    GYKSLR FMD+ 
Sbjct  28   IADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNA  87

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V S AD  CG+T+ NG  QPIP     R+TGYTHDGPCEVW+D+T  +   NCH+ 
Sbjct  88   K-YSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEA  146

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y+ACKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  147  FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

>PHYRA_81106
Length=202

 Score = 213 bits (543),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 123/164 (75%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            + DAHQ+V+LP PT+T  +KD +++PLAFLENQG++T  DFNA+ +S GYK+LRAFMD  
Sbjct  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   AD+ CG+TN +   Q IP     R+TGYTHDGPCEVWLD T+VL+  NCH+ 
Sbjct  84   K-YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C G+CTL WYWMG+R+LK  +SWQVYK CVPL
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPL  186

>PHYCA_102550
Length=268

 Score = 215 bits (548),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 120/164 (73%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             A AHQ+V+LP P +    +D +  PLAFLE+QG+KT  DF A+    GYKSLR FMD  
Sbjct  24   TATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V + ADF+CGYT+ NG  QPIPA    R+TGYTHDGPCEVW+D+T V+ G NCH+ 
Sbjct  84   K-YTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEK  142

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y+ CKG CTL WYW+G+RFLK  +SWQVYKEC+PL
Sbjct  143  FPGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPL  186

>PHYKE_3446
Length=199

 Score = 212 bits (539),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 132/187 (71%), Gaps = 3/187 (2%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAP       + A +S AA+   + DAHQ+V+LP P +   +K+ +++PLAFLENQG+ T
Sbjct  1    MAPPLASVFTVVAALSGAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFAT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYT  118
              D NA+ +  GYK+LRAFMD  K Y+V   AD+ CG+T+ NG  QPIP     R+TGYT
Sbjct  61   QEDANAWRRDNGYKTLRAFMDMAK-YQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYT  119

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQV  178
            HDGPCEVW+DNT+VL   NCH+   GK + + Y+AC+G+C LRWYW+G+RFLK  +SWQV
Sbjct  120  HDGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQV  179

Query  179  YKECVPL  185
            YK C+PL
Sbjct  180  YKACIPL  186

>PYVX_18174
Length=204

 Score = 212 bits (539),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 133/186 (72%), Gaps = 2/186 (1%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS     + AA  +  AL  +VADAHQ VILP PT+T   +D  ++PLAFLE+QG++T
Sbjct  1    MAPSFSVVASAAAAAAGVALLATVADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFET  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120
              DFNA+ +S GYK+LRAFMD + +Y V   AD  CG+T  +G  QPIPANFR+TGYTHD
Sbjct  61   VEDFNAWRRSNGYKTLRAFMD-QASYTVTDGADQTCGFTEIDGTPQPIPANFRSTGYTHD  119

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYA-ACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            GPCE+WLD+T+V +  NCH+   GK  A+ Y+    G+CTL WYWMG+R+L   +SWQVY
Sbjct  120  GPCEIWLDSTRVYANDNCHEAISGKDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVY  179

Query  180  KECVPL  185
            K CVPL
Sbjct  180  KNCVPL  185

>PITG_18450
Length=203

 Score = 211 bits (538),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 135/186 (73%), Gaps = 5/186 (3%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS   S+ +AA++S+  L    A AHQ+V+LP+PT+T   KD +++PL FLE QGY+T
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP-ANFRTTGYTH  119
              DFN + ++ GYK+LR FM+    Y V   AD+ CG+TN N A QP P    R+TGYTH
Sbjct  61   VEDFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNPDGAMRSTGYTH  116

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            DGPCEVWLD+T+VL   NCH+   GKT+ + Y++CKG+CTLRWYW+G+RFLK  +SWQ+Y
Sbjct  117  DGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIY  176

Query  180  KECVPL  185
            K C+PL
Sbjct  177  KACIPL  182

>PPTG_15264
Length=194

 Score = 208 bits (529),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 5/164 (3%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  85
            DAHQ+V+ P P +T   KD +++PLAFLE QG++T  DFNA+ +  GYK+LR FMD  K 
Sbjct  23   DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK-  81

Query  86   YKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            Y V   AD+ CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+ +VL G NCH+  P
Sbjct  82   YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIP  141

Query  144  GKTHAMSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            GK + + Y++C  KG C LRWYW+G+RFLK  +SWQVYKEC+PL
Sbjct  142  GKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PPTG_17366
Length=194

 Score = 208 bits (529),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 120/164 (73%), Gaps = 5/164 (3%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  85
            DAHQ+V+ P P +T   KD +++PLAFLE QG++T  DFNA+ +  GYK+LR FMD  K 
Sbjct  23   DAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK-  81

Query  86   YKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            Y V   AD+ CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+ +VL G NCH+  P
Sbjct  82   YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIP  141

Query  144  GKTHAMSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            GK + + Y++C  KG C LRWYW+G+RFLK  +SWQVYKEC+PL
Sbjct  142  GKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PHYKE_8388
Length=205

 Score = 208 bits (530),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 137/188 (73%), Gaps = 3/188 (2%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            M PS   S+ +AA++S+AAL   +A+AHQ+V+LP+PT+T   K  +++PLAFLE+QG+ T
Sbjct  1    MTPSFASSLLVAAVLSSAALIAPIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFST  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYT  118
              DF A+    GY SLRAF DD  +Y V+  ADF CG+T+ NGA QPIP +   R+TGYT
Sbjct  61   QEDFTAWRSDNGYASLRAFNDDA-SYTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYT  119

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQV  178
            HDGPCEVWLD+T V+  +NCH    GK + + Y++C  +CTL W+WMG+R+LK ++SWQV
Sbjct  120  HDGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQV  179

Query  179  YKECVPLG  186
            YK CVPL 
Sbjct  180  YKACVPLS  187

>PHYCA_511409
Length=204

 Score = 202 bits (514),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 122/164 (74%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +ADAHQ+V+LP PT+T   K  +++PLAFLE+QG+ T  DF A+ +  GY SLRAF +D 
Sbjct  23   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDG  81

Query  84   KAYKVNSNADFECGYTNKNGARQPIP-AN-FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             +Y V+  ADF CG+TNKNG  Q IP AN  R+TGYTHDGPCEVWLD+T V+   NCH+ 
Sbjct  82   ASYTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEA  141

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C  +CTL W+W+G+R+LK ++SWQ+YK CVPL
Sbjct  142  ISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  185

>PHYSO_477820
Length=202

 Score = 201 bits (511),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +A AHQ+V+LP PT+T   K  +++PLAFLE+QG+ T  DF A+    GY SLRAF +D 
Sbjct  21   LAGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDG  79

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             +Y V   ADF CG+TN NG  QPIP +   R+TGYTHDGPCEVWLD+T V+   NCH+ 
Sbjct  80   ASYTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHES  139

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C  +CTL W+W+G+R+LK ++SWQ+YK CVPL
Sbjct  140  ISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

>PPTG_17121
Length=202

 Score = 201 bits (510),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +A+AHQ+V+L  PT+T   KD +++PLAFLE+QG+ T  DF A+ K  GY SLRAF +D 
Sbjct  21   LANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAF-NDG  79

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             +Y V+  AD  CG+TN NG  QPIP     R+TGYTHDGPCEVWLD+T V+   NCH+ 
Sbjct  80   ASYTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEA  139

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C  +CTL W+W+G+R+LK ++SWQ+YK CVPL
Sbjct  140  ISGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

>PHYRA_81107
Length=202

 Score = 200 bits (509),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +ADAHQ+V+LP PT+T   K  +++PLAFLE+QG+ T  DF A+ +  GY SLRAF DD 
Sbjct  21   LADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDG  79

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             +Y V+  ADF CG+T+ NG  Q IP     R+TGYTHDGPCEVWLD+T V+   NCH+ 
Sbjct  80   ASYTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEV  139

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GK + + Y++C  +CTL W+WMG+R+L   +SWQVYK CVPL
Sbjct  140  ISGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPL  183

>PHALS_03284
Length=188

 Score = 198 bits (504),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 116/163 (71%), Gaps = 3/163 (2%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
            AHQ+++LP P +    KD +++PLAFLENQ + T+ADF  Y K   Y SLR F+  +  Y
Sbjct  13   AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANY  71

Query  87   KVNSNADFECGYTNKNGARQPIPA--NFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144
             V   AD +CG+T+ NG  QPIPA  N R TGYTHDG CE+WLD+TKVLSGSNCH DFPG
Sbjct  72   TVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPG  131

Query  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187
            K   + Y++CK +C + WYW+ +R LK ++SWQVYK C+PL R
Sbjct  132  KDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLTR  174

>PYVX_18176
Length=201

 Score = 198 bits (504),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 2/164 (1%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            +VADAHQ VILP PT+    KD  ++PLAFLE+QG+ T  DF A+    GY SLRAFMD 
Sbjct  20   TVADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMD-  78

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPAN-FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
              +Y V   AD  CG+TNK+G  Q +P    R+TGYTH GPCEVWLD+T VL   NCH  
Sbjct  79   GASYTVTDGADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDS  138

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              GKT+ + Y++C  +CTL W+WMG+R+L  ++SWQVYK CVPL
Sbjct  139  ISGKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPL  182

>PYAP_22278
Length=289

 Score = 201 bits (510),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 120/171 (70%), Gaps = 8/171 (5%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            S  DAHQ V +P PTFT   ++  W+PLAFLENQG K   D   + +SKG K+LR +MD+
Sbjct  20   SSVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDN  79

Query  83   KKAYKVNS-NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSG--SN  137
            K  YK+ +  A FECGYTN NGARQPIP N   R+TGYTHDGPCEVWLDNT+VL     N
Sbjct  80   KANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGN  139

Query  138  CHKDFPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKH-SWQVYKECVPL  185
            CH+D   K  ++ + ++ CKG+C LRWYW+G R + GK  SWQ+YK CVPL
Sbjct  140  CHRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PYAP_22273
Length=268

 Score = 199 bits (507),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 113/169 (67%), Gaps = 4/169 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            + +AHQ V  P   +T+  +   W P A LENQGYKTT DFNAY  + GYK+LR FMD  
Sbjct  22   LVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKP  81

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             AYK N  A  ECGYT+ N   QPIP N  FRT+GYTH+GPCE+W+D+  V SG NCH D
Sbjct  82   GAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141

Query  142  FPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188
               K  T  + Y+ACKG C L+WYW+GIR +  K+SWQ+YK C+PL  K
Sbjct  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADK  190

>PYIR_26546
Length=239

 Score = 195 bits (496),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 116/169 (69%), Gaps = 5/169 (3%)

Query  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQ-GYKTTADFNAYYKSKGYKSLRAFM  80
            DS A AHQ+V+LP PT+T+  K ++W P+A+LE Q G+    DFN Y  SKG+K++R FM
Sbjct  22   DSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFM  81

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNC  138
            D+ K Y+  S+ADF+CGYT  +G  QPIP N   RTTGYTH+GPCE+WLD+ KV  G NC
Sbjct  82   DNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNC  141

Query  139  HKDFPGKT--HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            H D         + +++C G CT+ WYWMGIR      SWQ+YKEC+PL
Sbjct  142  HYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYAR_24096
Length=227

 Score = 192 bits (489),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 4/164 (2%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKA  85
            +AHQ V LP+  +TV  ++  W P A LE QGYKTTADFNAY K+  YK+LR FMD   A
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  86   YKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
            YK NS A FECG+T+     QPIP +  FRT+GYTH+GPCE+W+D+ +V  G NCH D  
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  144  GK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                T  + Y+ACKG+C L+WYW+GIR     +SWQ+YK C+PL
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

>PPTG_10048
Length=190

 Score = 191 bits (485),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 114/164 (70%), Gaps = 3/164 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            + +AHQ+V+ P P +    +D + +PLAFLE+QG+KT  DF ++    GYK+LR FM+  
Sbjct  21   LTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHA  80

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V   ADF CG+TN  G  QPIPA    R+TGYTH+GPCE+W+ +T+V    NCH  
Sbjct  81   K-YTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVS  139

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             PGK + + Y+ CKG+C L WYW+G+RFLK  +SWQVYKEC+PL
Sbjct  140  LPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPL  183

>PYIW_18791
Length=194

 Score = 190 bits (483),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 113/164 (69%), Gaps = 4/164 (2%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK  84
            ADAHQ V +P P +TV  K   W+PL+FLE  G KT+   + + K KGY +LRA MDD K
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  85   AYKVNSNAD-FECGYTNKNGARQPIP--ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
             YK NSNAD F CGYT+ +   Q IP  +  RTTGYTH GPCEVW+D+ +V++G NCH+ 
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                T  + Y+ CKG CT+RWYW+G+R+LK K SWQVYK C+ L
Sbjct  139  VSNTTK-VDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

>PYAP_22279
Length=223

 Score = 186 bits (473),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 115/165 (70%), Gaps = 8/165 (5%)

Query  28   HQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYK  87
            HQ + +P PT T   ++   +PLAFLENQG K T D   Y + KG K+LR FMD+K  YK
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  88   VNS-NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGS--NCHKDF  142
            V +  A FECGYT+ NGARQPIP+N   R+TGYTHDGPCEVWLDNT+VL  +  +CHKD 
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  143  PGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                 ++ + ++ CKG+C LRWYW+  R +  K SWQVYK+CVPL
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PHYCA_510817
Length=188

 Score = 181 bits (458),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (68%), Gaps = 8/168 (5%)

Query  25   ADAHQLVILPNPTFTVPT-----KDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
             +AHQ+V +P+PT+T P      + E W+PL+FLE +G+KT  +F  Y    GYKSLR F
Sbjct  20   TEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDF  79

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSN  137
            M+ K  YKV+  AD  CG+++  G  Q IP++   RT+GYTHDGPCE+W+ +   LS  N
Sbjct  80   ME-KAKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLN  138

Query  138  CHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            CH+  P +T  + Y+ C  SC L WYW+G+R LKGK+SWQVYKEC+PL
Sbjct  139  CHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PPTG_17123
Length=201

 Score = 176 bits (447),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)

Query  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88
            Q+V+ P P F V   D +   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146
               A FECG T+     QPIP N  F+T+GYT DGPCEVWLD+TKV SG NCH +FP   
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            H + Y++C  +CTL WYW+GI++++G +SWQVYK CV L
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195

>PPTG_08820
Length=250

 Score = 177 bits (450),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 111/168 (66%), Gaps = 7/168 (4%)

Query  25   ADAHQLVILPNPTFT--VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
             DAHQL++ P P +   +  +D RW PLAFLE+QG+   ADFN +    GYK+LR FMD 
Sbjct  25   VDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDR  84

Query  83   KK-AYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
             K    V   AD  CG T   G  +PIP +   ++TGYTHDGPC V+LD+  VL   NCH
Sbjct  85   AKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCH  144

Query  140  KDFPGKTHAMSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +  PGK++ + Y++C  KG CTL W+W+GIRF+K + SWQVYKECVPL
Sbjct  145  EKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

>PHYCA_537323
Length=200

 Score = 175 bits (444),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 109/167 (65%), Gaps = 2/167 (1%)

Query  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81
            D+     Q+V  P P F V   D +   LA+L+ QG  T+ +  ++ +  GY SLRA +D
Sbjct  29   DAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            D+  Y+V   A FECG T+     QPIP N  F+T+GYT DGPCEVWLD+TKV +G NCH
Sbjct  89   DESLYQVTEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCH  148

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
             +FP   H + Y++C  SCTL WYW+GI++++G +SWQVYK CV LG
Sbjct  149  TEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLG  195

>PHYSO_499978
Length=174

 Score = 173 bits (438),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 3/166 (2%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS + +  +A ++S+AAL    ADAHQ+V+ P P +T   K+ +++PLAFLENQG+ T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYT  118
              DF  +    GYK+LR FMD  K Y V   ADF CG+T+  G  QPIP     R+TGYT
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGK-YTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYT  119

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYW  164
            HDGPCEVW+DNT+VL G NCH+    K + + Y+ACKG+CTLRWYW
Sbjct  120  HDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 173 bits (438),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 114/166 (69%), Gaps = 3/166 (2%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS + +  +A ++S+AAL    ADAHQ+V+ P P +T   K+ +++PLAFLENQG+ T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYT  118
              DF  +    GYK+LR FMD  K Y V   ADF CG+T+  G  QPIP     R+TGYT
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGK-YTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYT  119

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYW  164
            HDGPCEVW+DNT+VL G NCH+    K + + Y+ACKG+CTLRWYW
Sbjct  120  HDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYW  165

>PPTG_14255
Length=268

 Score = 176 bits (446),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 111/166 (67%), Gaps = 8/166 (5%)

Query  27   AHQLVILPNPTFTVP--TKDER---WSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81
            AHQ+V +P+PT+T    T  ER   W+PL+FLE +GY T  +F  Y    GYKSLR FMD
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            + K Y V   AD  CG+T+  G  Q IP +   RT+GYTHDGPCE+++ +T  LS  NCH
Sbjct  81   NAK-YSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCH  139

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +    +T  + Y+AC  SC L WYW+G+R+LK K+SWQVYKEC+PL
Sbjct  140  ESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PPTG_14254
Length=188

 Score = 173 bits (438),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 109/167 (65%), Gaps = 8/167 (5%)

Query  26   DAHQLVILPNPTFT-----VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFM  80
            +AHQ+V +P PT+T        + E W+PL+FLE +G+KT  +F  +    GYKSLR FM
Sbjct  21   EAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFM  80

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNC  138
            D  K YKV   AD  CG+T+  G  Q IP +   RTTGYTHDGPCE+++     LS  NC
Sbjct  81   DRAK-YKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNC  139

Query  139  HKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            H+  P +T  + Y+ C  SC L WYW+G+R LKGK+SWQVYKEC+P+
Sbjct  140  HESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PYU1_G001738
Length=226

 Score = 173 bits (439),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 106/161 (66%), Gaps = 2/161 (1%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
            A   V+ P P + V   + + +P+A LE QG KT+AD + + K KGY +LRA +DD+K Y
Sbjct  21   AQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY  80

Query  87   KVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPG  144
             VN +A  ECGYT+     QPIP    F +TGY  +GPCEVWLD+ KV+S  NCH  +PG
Sbjct  81   NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140

Query  145  KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                + Y++CKGSC LRWYW+GI+ +   +SWQVYK CV L
Sbjct  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYRA_81105
Length=201

 Score = 172 bits (436),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 2/162 (1%)

Query  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88
            Q+V+ P P F V   D +   LA+L+ QG  T+ +   + +  GY SLR+ +DD+  Y+V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146
               A F+CG T+     Q IP N  F+++GYT DGPCEVWLD+TK  +G NCH +FP   
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188
            H + Y+AC  +C LRWYW+GI++++G +SWQVYK C+ LG++
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALGKE  198

>PHYSO_417649
Length=185

 Score = 170 bits (431),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 109/168 (65%), Gaps = 8/168 (5%)

Query  25   ADAHQLVILPNPTFT-----VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
             +AHQ+V +P+PT+T        + E W+PL+FLE +G+KT  +F  Y    GYKSLR F
Sbjct  18   VEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDF  77

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSN  137
            M+  K YK+   AD  CG+T+  G  Q IP +   RT+GYTHDGPCE+++ +   LS  N
Sbjct  78   MERAK-YKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLN  136

Query  138  CHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            CH+    +T  + Y+ C  SC L WYW+G+R LKGK SWQVYKEC+PL
Sbjct  137  CHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PHYKE_9185
Length=281

 Score = 173 bits (439),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 110/170 (65%), Gaps = 8/170 (5%)

Query  23   SVADAHQLVILPNPTFTVPT-----KDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            S  +AHQ+V +P+PT+T P      + E W+PL+FLE +G KT  +F  Y     Y SLR
Sbjct  20   STTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLR  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSG  135
             FMD K  YKV+  AD  CG+T+  G  Q IP +   RT+GYTHDGPCE+++ +   LS 
Sbjct  80   DFMD-KAKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSY  138

Query  136  SNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             NCH+    +T  + Y+AC  SC L WYW+G+R LKG +SWQ+YKEC+PL
Sbjct  139  LNCHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PITG_13520
Length=171

 Score = 168 bits (425),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 96/134 (72%), Gaps = 3/134 (2%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   KD +++PLAFLENQG+KT  DF A+    GYKSLR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRA  83

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            K Y V S ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+  VL G NCH+ 
Sbjct  84   K-YDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEK  142

Query  142  FPGKTHAMSYAACK  155
            FPGK + + Y++CK
Sbjct  143  FPGKDYTVDYSSCK  156

>PHYSO_353401
Length=146

 Score = 167 bits (422),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 98/140 (70%), Gaps = 2/140 (1%)

Query  50   LAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP  109
            LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  YKV   A F+CG T+     QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  110  AN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGI  167
            +N  F+T+GYT DGPCEVWLD+TKV +G NCH  FP   H + Y+AC  SCTL WYW+GI
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  168  RFLKGKHSWQVYKECVPLGR  187
            ++++G +SWQVYK CV L +
Sbjct  123  KYVEGAYSWQVYKNCVALSK  142

>PITG_18452
Length=856

 Score = 181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 109/161 (68%), Gaps = 2/161 (1%)

Query  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88
            Q+V+ P P F V   D +   LA+L+ QG  T+ +  ++ + +GY SLRA +DD+  YKV
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146
               A FECG T+     QPIP N  F+T+GYT DGPCE+WLD+TKV SG NCH +FP   
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  147  HAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187
            H + Y++C GSC L WYW+GI++++G +SWQVYK CV L +
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSK  852

>PYIW_18788
Length=244

 Score = 167 bits (422),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 105/166 (63%), Gaps = 3/166 (2%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            SV  A+  V  P P F +    E  + +A LE+Q   T+AD   + K KGY SLRA +DD
Sbjct  22   SVVVANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDD  81

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHK  140
            +  Y VN ++ FECGYT+     QPIP N   R TGY  DGPCE+W+D+ K+LS +NC K
Sbjct  82   ETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKK  141

Query  141  DFPGKTHAMSYAACKGSCTLRWYWMGI-RFLKGKHSWQVYKECVPL  185
            DFPG +  + Y++CKG CTLRWY + + +   G +SW+VYK CV L
Sbjct  142  DFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187

>HYAP_07096
Length=251

 Score = 163 bits (413),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 3/162 (2%)

Query  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88
            Q+V+ P+P F V     +   LA+L+ QG  T+ +  ++ +  GY SLRA +DD+  Y V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  89   NSNADFECGYTN-KNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGK  145
            + +A F+CG+T+  +   Q IP N    ++GYT DGPCEVW D+T+V SG NC  +FP  
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  146  THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGR  187
             H + Y++C  SCTLRWYW+GI+++ G +SWQVYK C+ LGR
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGR  247

>PHYCA_536934
Length=983

 Score = 174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 111/167 (66%), Gaps = 8/167 (5%)

Query  26   DAHQLVILPNPTFTVP--TKDER---WSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFM  80
            +AHQ+V +P+PT+T    T  ER   W+PL+FLE +GY T  +F  Y    GYK+LR FM
Sbjct  37   EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  96

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNC  138
            D+ K Y V   AD  CG+++ NG  Q IP +   RT+GYTHDGPCE+W+ +   LS  NC
Sbjct  97   DNAK-YAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNC  155

Query  139  HKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            H+    +T  + Y+ C  SC L WYW+G+R+LK K+SWQVYKEC+PL
Sbjct  156  HESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PHYSO_262732
Length=188

 Score = 159 bits (402),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 106/168 (63%), Gaps = 22/168 (13%)

Query  25   ADAHQLVILPNPTFT-----VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
            A+AHQ+V +P+PT+T        + E W+PLAFLENQG++T               LR F
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDF  64

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSN  137
            MD+ K Y V   AD  CG+T+  G  Q IP++   RT+GYTHDGPCE+++ +   LS  N
Sbjct  65   MDNAK-YTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLN  123

Query  138  CHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            CH+    +T  + Y+ C  SCTL WYW+G+RFL  K+SWQVYKEC+P+
Sbjct  124  CHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PHYSO_254168
Length=170

 Score = 157 bits (397),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 16/148 (11%)

Query  40   VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYT  99
            V  KD +++PLAFLE QG+ T   F+A  +  GYK+LR FMD  K Y V   AD+ CG+T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGK-YTVTQGADYFCGWT  86

Query  100  NKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAAC--KGS  157
            N  G  QPIP   R+TGYTHDGPCE+WLD+ +VL           ++  + Y++C  KG 
Sbjct  87   NPKGTPQPIP---RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGG  133

Query  158  CTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            CT+ WYW+G+RFLK  +SWQVYKEC+PL
Sbjct  134  CTMHWYWLGVRFLKNSYSWQVYKECIPL  161

>PHYSO_343376
Length=172

 Score = 155 bits (391),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 90/129 (70%), Gaps = 3/129 (2%)

Query  38   FTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECG  97
            +T   K+ +++PLAFLENQG+ T  DF A+    GYK+LR FMD  K Y V   ADF CG
Sbjct  36   WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGK-YTVTKGADFSCG  94

Query  98   YTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACK  155
            +T+  G  QPIP     R+TGYTHDGPCEVW+DNT+VL G NCH+    K + + Y+ACK
Sbjct  95   WTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACK  154

Query  156  GSCTLRWYW  164
            G+CTLRWYW
Sbjct  155  GTCTLRWYW  163

>PITG_10499
Length=323

 Score = 159 bits (401),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 101/159 (64%), Gaps = 7/159 (4%)

Query  34   PNPTFT--VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKK-AYKVNS  90
            P P +   +  +D RW PLAFLE+QG+    DFN +    GYK LR FMD  K    V  
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  91   NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148
             AD  CG T   G  +PIP +   R+TGYTHDGPC ++LD+  V+   NCH+  PG+T+ 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  149  MSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            + +++C  KG CTL W+W+GIRF+K + SWQVYKEC+ L
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_341596
Length=231

 Score = 150 bits (378),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 11/124 (9%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+L         KD +++PLAFLENQG++T  DF ++    GYKSLR FMD K
Sbjct  24   TADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMD-K  74

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
              Y V S ADF CG+T+  G  QPIPA    R+TGYTHDGPCEVWLD+TKVL G NCH+ 
Sbjct  75   AKYTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEK  134

Query  142  FPGK  145
            FPGK
Sbjct  135  FPGK  138

>PHYSO_527908
Length=174

 Score = 145 bits (367),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 94/155 (61%), Gaps = 8/155 (5%)

Query  25   ADAHQLVILPNPTFTVPTK-----DERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
             DAHQ+V +P PT+T          E W PLAFLE QG+ T A+F  +    GYKSLR F
Sbjct  19   VDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDF  78

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSN  137
            MD+   Y V   AD  CG+T+ NG  Q IP +   RT+G+THD PCE+++ +   LS  N
Sbjct  79   MDNGN-YSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPN  137

Query  138  CHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKG  172
            CH+    +   + Y+AC  SC L WYW+G+RF+KG
Sbjct  138  CHESITSQPFKLDYSACGDSCVLYWYWLGVRFIKG  172

>PYIW_18792
Length=125

 Score = 137 bits (344),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 82/105 (78%), Gaps = 3/105 (3%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            ++ DAHQ V LP PT+TV T+ E+++PLAFLE QGYK TADF AYYKSKGYK+LR FMDD
Sbjct  19   ALVDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDD  78

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEV  125
            KKAYKV+   +FECG+++  G  QPIPA    R+TGYTHDGP  +
Sbjct  79   KKAYKVD-GGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHYCA_14368
Length=219

 Score = 139 bits (351),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 92/164 (56%), Gaps = 44/164 (27%)

Query  22   DSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMD  81
            DS A+AHQ+V+LP P +T   KD +++PLAFLENQG+KT  DF ++     YKSLR FMD
Sbjct  22   DSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMD  81

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
            + K Y V   ADF CG+T+                                         
Sbjct  82   NAK-YTVTDGADFSCGFTDP----------------------------------------  100

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
               K + + Y++CKG+CTLRWYW+GIRFLK ++SWQVYK C+PL
Sbjct  101  ---KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  141

>PHYSO_340369
Length=200

 Score = 127 bits (318),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 97/170 (57%), Gaps = 22/170 (13%)

Query  23   SVADAHQLVILPNPTFTVP--TKDER---WSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ++  A+Q+V +P PT+T    T DE+   W PLA+ E+QG+ T+++F  +  + G+K+LR
Sbjct  20   AITRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLR  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSG  135
             FMD+   Y V S               Q IP +   RT GYT DGPCE+WLDNT   S 
Sbjct  80   DFMDNGN-YSVTS--------------PQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSS  124

Query  136  SNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             +C    P  T+ + Y+ C  SC + WY +G+      +SW+VYKEC+PL
Sbjct  125  VDCLVSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PHYSO_246676
Length=187

 Score = 119 bits (298),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 86/164 (52%), Gaps = 41/164 (25%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
             ADAHQ+V+LP P +T   K  +++PLAFLENQG+KT  DF A+ K  GY++LR FM DK
Sbjct  7    TADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DK  65

Query  84   KAYKVNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141
              Y V S ADF CG+T+  G  QPIP     R+TGYTHDG     L    VL G      
Sbjct  66   AKYDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASL----VLDG------  115

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                                        +K  +SW+VYK C+PL
Sbjct  116  ----------------------------MKNSYSWKVYKACIPL  131

>PYAP_18131
Length=226

 Score = 119 bits (298),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 77/114 (68%), Gaps = 11/114 (10%)

Query  80   MDDKKAYKVNS-NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSG-  135
            MDDK  YKV +  A FECG T+ NG RQPIP N   R+TG+THDG   VW+DNT+VL   
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  136  -SNCHKDFPGK---THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              NCHK   G+   ++ + ++ CKG C +RWYW+G+R L  K SWQVYK C+P+
Sbjct  59   LGNCHKSI-GQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>PYVX_18179
Length=147

 Score = 114 bits (284),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/162 (39%), Positives = 80/162 (49%), Gaps = 58/162 (36%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            VADAHQ VILP PT+T    D  +SPLAFLE+QG+ T  DFN++  + GY +LRAFMD  
Sbjct  24   VADAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD--  81

Query  84   KAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFP  143
                                                           + +SG +   D  
Sbjct  82   -----------------------------------------------QAVSGKDTAVD--  92

Query  144  GKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                   Y++C GSCTL W+WMG+R+LKG +SWQVYK CVPL
Sbjct  93   -------YSSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPL  127

>PYIW_18790
Length=86

 Score = 108 bits (271),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 1/79 (1%)

Query  31   VILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNS  90
            V+LP PT+TV T+ E+++PLAFLENQG+KTTADF AYY+ KGYK+LR FMDD+ AYKV+ 
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVDG  64

Query  91   NADFECGYTNKNGARQPIP  109
              DFECG++   G  QPIP
Sbjct  65   -GDFECGWSTLKGTPQPIP  82

>PHYSO_342364
Length=194

 Score = 110 bits (275),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 89/179 (50%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFTVPTKDERWS---PLAFLENQGY----KTTADFNAYYKSKGYKSLR  77
            ADAH  + +P   F    ++ +WS   P  +  N  Y    K+   FN+   S  YK LR
Sbjct  21   ADAHGYIYVPQSQF-FGGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDLR  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              +D+   Y  N      CGYTN NG  QPIP N +     G  H GPCE+WLD+ KV++
Sbjct  80   TLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMA  133

Query  135  GSNC-----HKDFPGKTH---AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C     H +   KT      SY   KG C +R+YW+G + L  K  WQ YK C+PL
Sbjct  134  ADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

>PYAP_18711
Length=210

 Score = 109 bits (272),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 89/171 (52%), Gaps = 25/171 (15%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQG------YKTTADFNAYYKSKGYKSLRAF  79
            DAH  V  P   F   TK     P  ++   G      ++T A ++A  K +G K+LRAF
Sbjct  21   DAHTYVKSPLAEFKAGTK----YPSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLRAF  76

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT---TGYTHDGPCEVWLDNTKVLSGS  136
            ++ K           ECG TN N  R+PIP++      +   H GPCEVW DNT V S  
Sbjct  77   LESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVFSEV  127

Query  137  NCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
            +C K F   T   + Y+ CKG+C LR+YW+G++   G   WQ YK CVP+G
Sbjct  128  DCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQ--DGGKRWQSYKNCVPIG  176

>PYAP_24689
Length=252

 Score = 107 bits (266),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 89/175 (51%), Gaps = 25/175 (14%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQG------YKTTADFNAYYKSKGYKSLRA  78
            ADAH  V  P   F   TK     P +++   G       +T A ++A  K  G K+LRA
Sbjct  23   ADAHTYVSQPRAEFKPGTK----YPSSWVAEFGPPWPGTIRTGAQYDAVRKKHGVKTLRA  78

Query  79   FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT---TGYTHDGPCEVWLDNTKVLSG  135
            F++ K            CG TN N  R+PIP +      +   H GPCE+W DNT+V   
Sbjct  79   FLESKGPV---------CGSTNPNAKRKPIPRDGLIKFGSSMEHPGPCEIWFDNTRVFVD  129

Query  136  SNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRKR  189
            ++C+K F   T   + Y+ C+G C LR+YW+G++   G   WQ YK CVPLG  +
Sbjct  130  ADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DGGKRWQSYKNCVPLGNDK  182

>PYAP_18709
Length=235

 Score = 104 bits (260),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 87/172 (51%), Gaps = 18/172 (10%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLE---NQGYKTTADFNAYYKSKGYKSLRAFM  80
            VAD H  V L  P         + S +A  +   +  +KT A + A    KG+K LR+F+
Sbjct  17   VADVHAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFL  76

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSN  137
            +DK            CG +  N + +PIP++      +   H GPCEVWLDNT+     +
Sbjct  77   EDKGP---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDD  127

Query  138  CHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188
            C K F   T   M + ACKGSC LR+YW+G++   G   WQ YK C+PL  K
Sbjct  128  CEKAFGSATSFKMDFLACKGSCMLRFYWLGLQ--DGGKRWQSYKNCIPLNDK  177

>PYU1_G007476
Length=195

 Score = 102 bits (254),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 19/131 (15%)

Query  63   DFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT------TG  116
            DF    K KGYK+LR+F+++K A          CGYT  N   + IP + +        G
Sbjct  65   DFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVG  115

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAM--SYAACKGSCTLRWYWMGIRFLKGKH  174
            + H GPCE+WLDN  +L   NC K FPG    M   +++CKG+C LR YW+G  F     
Sbjct  116  FVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQGQ  173

Query  175  SWQVYKECVPL  185
             WQ YK CVP+
Sbjct  174  RWQTYKYCVPV  184

>PYIR_22134
Length=300

 Score = 100 bits (250),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 99/207 (48%), Gaps = 28/207 (14%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWS-----PLAFLEN  55
            +APS+   +ALAA   A A   S  DAH  + +P PTFT+     ++S     P      
Sbjct  2    LAPSSKTVLALAAAALAIASTPSSVDAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAP  61

Query  56   QGYKTTAD-------FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPI  108
             G   T D       F A  K+  Y S+RA ++ K  +   S A  ECG T+  G  QP+
Sbjct  62   TGMSFTTDPESNTNAFTAALKASTYDSVRALVEAKGVFI--SGATKECGITSATGTAQPL  119

Query  109  PANF------RTTGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAM--SYAACKGSC  158
            PA +       + G+T  H GPCEVW DN KV S  NC K++P     +   +A C G+ 
Sbjct  120  PAKYVEWSHSSSEGFTPSHQGPCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTS  179

Query  159  TLRWYWMGIRFLKGKHSWQVYKECVPL  185
             L+  W+ +       +WQ+Y  C PL
Sbjct  180  LLKIVWLALH----SSTWQIYINCAPL  202

>PHYKE_6001
Length=289

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 86/179 (48%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ADAH  +++P   F        +   D  W+   +  N     TA FNA  K+  Y  L+
Sbjct  21   ADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTA-FNALKKANNYVDLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ NG  QPIP++ + T      H GPCE+WLD+  V S
Sbjct  80   TLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVFS  133

Query  135  GSNCHKDFPGK------THAMSYAACKGSC--TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C+  +  +         + Y++C G     +R+YW+  + + GK  WQ YK C+PL
Sbjct  134  DEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPL  192

>PHYRA_78625
Length=434

 Score = 100 bits (250),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 78/166 (47%), Gaps = 49/166 (30%)

Query  25   ADAHQLVILPNPTFTVPTKDER-----WSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
            A+AHQ+V +P+PT+T            W+PL+FLE +G++T  +F  +    GY SLR F
Sbjct  238  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  297

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            +D  K YK+                                            LS  NCH
Sbjct  298  LDKAK-YKL-------------------------------------------ALSYLNCH  313

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +    +T  + Y+ C  SC L WYW+G R+LKG +SWQVYKEC+ L
Sbjct  314  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYRA_78626
Length=473

 Score = 100 bits (250),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 78/166 (47%), Gaps = 49/166 (30%)

Query  25   ADAHQLVILPNPTFTVPTKDER-----WSPLAFLENQGYKTTADFNAYYKSKGYKSLRAF  79
            A+AHQ+V +P+PT+T            W+PL+FLE +G++T  +F  +    GY SLR F
Sbjct  277  AEAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDF  336

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNTKVLSGSNCH  139
            +D  K YK+                                            LS  NCH
Sbjct  337  LDKAK-YKL-------------------------------------------ALSYLNCH  352

Query  140  KDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +    +T  + Y+ C  SC L WYW+G R+LKG +SWQVYKEC+ L
Sbjct  353  ESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PHYSO_438103
Length=238

 Score = 97.4 bits (241),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ADAH  +++P   FT       V   D  W+   +  N        F +   +  +K L+
Sbjct  20   ADAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEV-FKSLKSANNFKDLK  78

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ NG  QPIP + + T      H GPCE+WLDNTKVL 
Sbjct  79   TLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLY  132

Query  135  GSNCHKDFPGKTHAM------SYAACK-GSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C   +  +   +       Y++C  G C  +R+YW+  + L  K  WQ YK+C+PL
Sbjct  133  EDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PYIR_16435
Length=304

 Score = 97.8 bits (242),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 72/129 (56%), Gaps = 16/129 (12%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYT  118
            A+F    K KGY +LR++++DK            CG TN +   + IP++     +    
Sbjct  65   ANFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIV  115

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSW  176
            H GPCE+WLD+ +V+   NC   F  K  T  + +++CKGSC LRW+W+G++       W
Sbjct  116  HPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGERW  173

Query  177  QVYKECVPL  185
            QVYK CVPL
Sbjct  174  QVYKNCVPL  182

>PYIR_16444
Length=182

 Score = 94.7 bits (234),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 89/171 (52%), Gaps = 18/171 (11%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLE--NQGYKTTADFNAYYKSKGYKSLRAFMDD  82
             DAH  V +P   F   T +     + F    +  +K   +F    K KG+ +LR+++++
Sbjct  23   VDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPKNFAKVAKQKGFPTLRSYIEN  82

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSNCH  139
            K A          CG TN     +PIP++ +   +    H GPCE+WLDN +V    NC 
Sbjct  83   KGAI---------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQNDNCE  133

Query  140  KDFPGKTHA--MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLGRK  188
              F  K     + +++CKG+C LR++W+G++  +GK  WQVYK CVP+  K
Sbjct  134  GVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQ-DQGKR-WQVYKNCVPVKGK  182

>PYAR_14260
Length=212

 Score = 94.4 bits (233),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 17/134 (13%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN----FR  113
            +KT A + A    KG+K+LR+F++ K            CG +  +   +PIP++    F 
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFA  81

Query  114  TTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-MSYAACKGSCTLRWYWMGIRFLKG  172
            +T   H GPCE+WLD T      +C K F   T   ++++ACKGSC LR+YW+G++    
Sbjct  82   ST-LEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DS  138

Query  173  KHSWQVYKECVPLG  186
               WQ YK CVPLG
Sbjct  139  GTRWQSYKNCVPLG  152

>PYIR_24421
Length=213

 Score = 94.0 bits (232),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 73/132 (55%), Gaps = 16/132 (12%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGY  117
            F A  KS  YKS+R  ++ K ++   S A  ECG ++ +GA+QP+PA +       + G+
Sbjct  42   FTAALKSSSYKSVRDLVNAKASFI--SGASKECGISSSSGAKQPLPAQYVEWAHSSSEGF  99

Query  118  T--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGK  173
            T  H+GPCEVW DN    S  NC K++P     + Y  + C G+  LR+YW+ +      
Sbjct  100  TPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVALH----S  155

Query  174  HSWQVYKECVPL  185
             +WQVY  C PL
Sbjct  156  STWQVYINCAPL  167

>PITG_11936
Length=333

 Score = 95.9 bits (237),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 72/137 (53%), Gaps = 15/137 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT------  114
            TA+FN  + +  YKSL+ FM+D     VN +   ECGYTN +   QP+P  +        
Sbjct  66   TANFNKGFAASKYKSLKEFMNDNMVL-VNEDFTKECGYTNPDATPQPLPKTYVEWSHGAG  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEV+ D T+V    NC K+FP     + +   AC GS  L  YW+ +   
Sbjct  125  EGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH--  182

Query  171  KGKHSWQVYKECVPLGR  187
                SWQVY  C PL +
Sbjct  183  --SPSWQVYINCAPLEK  197

>PHYSO_340333
Length=284

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ADAH  +++P   F        +   D  W+   +  N      A F A   +  +K L+
Sbjct  21   ADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDA-FKALKTANNFKDLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ NG  QPIP + + T      H GPCE+WLD+ KVL 
Sbjct  80   TLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  135  GSNCHKDFPGKTHAM------SYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C   +  +   +       Y++C  G C  +R+YW+  + + GK  WQ YK+C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYRA_78175
Length=319

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 71/137 (52%), Gaps = 15/137 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT------  114
            TA+FN  + +  Y SL+ FM DK    VN     ECGYTN + A QP+P  +        
Sbjct  66   TANFNKGFAASKYSSLKEFMADKLVL-VNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDG  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+T+V    NC K+FP     + Y   AC GS  L  YW+ +   
Sbjct  125  EGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH--  182

Query  171  KGKHSWQVYKECVPLGR  187
                SWQVY  C  L +
Sbjct  183  --SASWQVYINCAALEK  197

>PHYSO_340332
Length=295

 Score = 94.7 bits (234),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 85/179 (47%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ADAH  +++P   F        +   D  W+   +  N      A F A   +  +K L+
Sbjct  21   ADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDA-FKALKTANNFKDLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ NG  QPIP + + T      H GPCE+WLD+ KVL 
Sbjct  80   TLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLY  133

Query  135  GSNCHKDFPGKTH------AMSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C   +  +         + Y++C  G C  +R+YW+  + + GK  WQ YK+C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PITG_05271
Length=278

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 86/178 (48%), Gaps = 25/178 (14%)

Query  26   DAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRA  78
            DAH  +++P   F        +   D  W+   +  N+     A F A   +  +K L+ 
Sbjct  22   DAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNA-FKALKTANKFKDLKT  80

Query  79   FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSG  135
             MDD   Y        +CG+T+ NG  QPIP + + T      H GPCE+WLD+TKVL  
Sbjct  81   LMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDDTKVLYE  134

Query  136  SNCHKDFPGKTH------AMSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
             +C   +  +         + Y++C  G C  +R+YW+  + + GK  WQ YK+C+PL
Sbjct  135  DDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>H310_06362
Length=197

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 26/129 (20%)

Query  70   SKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT--------GY--TH  119
            + G+K+LRA +D             +CGYT  N   +PIP + +          G+  +H
Sbjct  49   ATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSH  99

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKGSCTLRWYWMGIRFLKGKHSW  176
             GPCE+WLDNT+V    NC  +FP K  A   + +++C GSCT+R+YW+ +     +  W
Sbjct  100  TGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLW  155

Query  177  QVYKECVPL  185
            QVYK C PL
Sbjct  156  QVYKNCAPL  164

>PYIW_24289
Length=196

 Score = 92.4 bits (228),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 85/180 (47%), Gaps = 27/180 (15%)

Query  26   DAHQLVILPNPTFTVPTKDERWSP-------LAFLENQGYKTTADFNAYY---------K  69
            D H  + +P PTFT    +E +         L   E   Y  + + NA            
Sbjct  24   DGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTAFSSQTD  83

Query  70   SKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYT--HDGPCEVWL  127
            S  Y++LR  +D K  +  ++  D ECG+TN   A+QP+ A+  T G+T  H GPCE+W 
Sbjct  84   SIKYRNLRDLIDTKAVF--SAGTDKECGFTNVTSAKQPLSAH-ATGGFTPTHQGPCEIWC  140

Query  128  DNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            D   V    NC K++P     + Y  + C G+  L++YW+ +  +K    W+ Y  C PL
Sbjct  141  DRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>PHYKE_10578
Length=239

 Score = 92.8 bits (229),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 80/183 (44%), Gaps = 34/183 (19%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLR  77
            S ADAH  + +P PTF        W  +  ++N      G      F      KG     
Sbjct  18   SHADAHGALKVPEPTFEQGASHSNW--VTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKD  75

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-------TTGYTHDGPCEVWLDNT  130
              +D  K        D +CG+T  +   QP+P++ +         G+TH GPCEV++D+ 
Sbjct  76   VILDMVK--------DKKCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDK  127

Query  131  KVLSGSNCHKDFPG--------KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
             VL G NC  ++PG            + Y++C G C L +YW+G +       WQ Y  C
Sbjct  128  LVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQ----NEQWQSYVNC  183

Query  183  VPL  185
            VPL
Sbjct  184  VPL  186

>PYU1_G005324
Length=191

 Score = 91.3 bits (225),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---T  114
            ++T A + A    KGYK L++F+D K            CG T  N   + IP +      
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGK  173
            +   H GPCE+WL NT+     +C K F   T   + ++ACKG+C LR+YW+G++   G 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGG  163

Query  174  HSWQVYKECVPL  185
              WQ YK CVPL
Sbjct  164  KRWQSYKNCVPL  175

>PYU1_G005326
Length=191

 Score = 91.3 bits (225),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---T  114
            ++T A + A    KGYK L++F+D K            CG T  N   + IP +      
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGK  173
            +   H GPCE+WL NT+     +C K F   T   + ++ACKG+C LR+YW+G++   G 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGG  163

Query  174  HSWQVYKECVPL  185
              WQ YK CVPL
Sbjct  164  KRWQSYKNCVPL  175

>PYU1_G005328
Length=191

 Score = 91.3 bits (225),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---T  114
            ++T A + A    KGYK L++F+D K            CG T  N   + IP +      
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGK  173
            +   H GPCE+WL NT+     +C K F   T   + ++ACKG+C LR+YW+G++   G 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGG  163

Query  174  HSWQVYKECVPL  185
              WQ YK CVPL
Sbjct  164  KRWQSYKNCVPL  175

>PYAR_20617
Length=254

 Score = 92.8 bits (229),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 82/169 (49%), Gaps = 18/169 (11%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLE---NQGYKTTADFNAYYKSKGYKSLRAFM  80
            + DAH  V L  P    P    + S +A  +      +KT A + A  K++G   LR F+
Sbjct  18   IHDAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFL  77

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSN  137
            +DK            CG + K+   + IPA+ +    +   H GPCEVW D+       +
Sbjct  78   EDKGPV---------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDD  128

Query  138  CHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            C K F   T  A+ ++ C GSC LR+YW+G++   G   WQ YK CVPL
Sbjct  129  CEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPL  175

>H257_13550
Length=266

 Score = 93.2 bits (230),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 77/143 (54%), Gaps = 29/143 (20%)

Query  59   KTTADFNAYYKSK---GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT  115
            K  A FN  ++ +   G+K+LRA +D +           +CGY+  +   +PIP++    
Sbjct  90   KNVAAFNKAFRDQQATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNVV  140

Query  116  --------GY--THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKGSCTLRW  162
                    G+  +H GPCE+WLDNT+V    +C  +FP K  A   + +A+C GSCT+R+
Sbjct  141  WQNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRF  200

Query  163  YWMGIRFLKGKHSWQVYKECVPL  185
            YW+ +     +  WQVYK C PL
Sbjct  201  YWIALH----QDLWQVYKNCAPL  219

>PYIW_27477
Length=180

 Score = 90.5 bits (223),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 85/161 (53%), Gaps = 18/161 (11%)

Query  26   DAHQLVILPNPTFTVPTK--DERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            +AH  V +P   F   T    E     A      +K  A+F    K KG+++LR++++DK
Sbjct  1    NAHGFVEVPKSEFPSGTSYPSEWIVEFAPPWEGSWKDPANFAKVSKEKGFETLRSYIEDK  60

Query  84   KAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSNCHK  140
             A         +CG T+ N   + IP++     +    H GPCE+W+D+T+V+   NC K
Sbjct  61   GA---------KCGKTDPNAKAKAIPSDNVVKFSRAIVHPGPCELWIDDTRVMQDDNCEK  111

Query  141  DFPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVY  179
             F  K  T  + ++ACKG C LRW+W+G++   GK  WQVY
Sbjct  112  TFGSKIPTWKIDFSACKGKCMLRWFWLGLQ-DSGKR-WQVY  150

>PPTG_03139
Length=320

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 71/137 (52%), Gaps = 15/137 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA+FN  + +  Y SL+ FM DK    V+ +   ECGYTN +   QP+P  +        
Sbjct  66   TANFNKGFAASKYSSLKEFMTDKMVL-VSKDFTKECGYTNPDETPQPVPETYVEWSHGSG  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+T+V    NC K+FP     + Y   AC GS  L  YW+ +   
Sbjct  125  EGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH--  182

Query  171  KGKHSWQVYKECVPLGR  187
                SWQVY  C  L +
Sbjct  183  --SPSWQVYINCAALEK  197

>PYU1_G005323
Length=251

 Score = 92.0 bits (227),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 15/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF---RT  114
            ++T A + A    KGYK L++F++DK            CG +  +   +PIP++      
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLA  104

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGK  173
            +   H GPCEVW D+ +     +C K F   T   + ++ACKGSC LR+YW+G++   G 
Sbjct  105  STIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DGG  162

Query  174  HSWQVYKECVPL  185
              WQ YK C+PL
Sbjct  163  KRWQSYKNCIPL  174

>PHYCA_534296
Length=309

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHD  120
            F +   +  +K L+  MDD   Y        +CG+TN +G  QPIP + + T      H 
Sbjct  40   FKSLKSANNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHV  93

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAM------SYAAC-KGSC-TLRWYWMGIRFLKG  172
            GPCE+WLD+TKVL   +C+  +  +   +       Y++C  G C  +R+YW+  + + G
Sbjct  94   GPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDG  153

Query  173  KHSWQVYKECVPL  185
            K  WQ YK+C+PL
Sbjct  154  KTVWQSYKDCIPL  166

>PYU1_G005325
Length=207

 Score = 90.9 bits (224),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 15/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---T  114
            ++T A + A    KGYK L++F+D K            CG T  N   + IP +      
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGK  173
            +   H GPCE+WL NT+     +C K F   T   + ++ACKG+C LR+YW+G++   G 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQ--DGG  163

Query  174  HSWQVYKECVPL  185
              WQ YK C+PL
Sbjct  164  KRWQSYKNCIPL  175

>PYAR_14256
Length=199

 Score = 90.5 bits (223),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 14/132 (11%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY  117
            ++T A + A    KG+K+LRAF++DK            CG T  N   +P          
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLAS  101

Query  118  T--HDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKH  174
            T  H GPCE+WLD++      +C K F   T   + ++ACKGSC LR+YW+G++      
Sbjct  102  TIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQ--NSGK  159

Query  175  SWQVYKECVPLG  186
             WQ YK C+PLG
Sbjct  160  RWQSYKNCIPLG  171

>PHYCA_19611
Length=531

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 70/137 (51%), Gaps = 15/137 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT------  114
            TA+FN    +  Y SL+ FM+DK    VN     ECGYTN   A QP+P  +        
Sbjct  273  TANFNKGMAASKYTSLKEFMNDKMVL-VNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDG  331

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+T+V    NC K+FP     M Y   AC GS  L  YW+ +   
Sbjct  332  EGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH--  389

Query  171  KGKHSWQVYKECVPLGR  187
                SWQVY  C  L +
Sbjct  390  --SPSWQVYINCAALEK  404

 Score = 36.6 bits (83),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 49/129 (38%), Gaps = 28/129 (22%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120
            TA F   +++  YKSL+  ++D    K+ +                      R    T +
Sbjct  40   TAAFTKGFEASKYKSLKEVINDLGKTKLRN----------------------RFQRRTSN  77

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYA--ACKGSCTLRWYWMGIRFLKGKHSWQV  178
            GP  V      +    NC  ++P     + Y   AC G+  L +YW+ +       +WQV
Sbjct  78   GPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQV  133

Query  179  YKECVPLGR  187
            Y  C  L +
Sbjct  134  YTNCAALEK  142

>PHYRA_78689
Length=296

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 86/179 (48%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
            ADAH  +++P   F        V   D  W+   +  N   ++   F +   +  +K L+
Sbjct  21   ADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNP-QSVDTFKSLKTANNFKDLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ +G  QPIP + + T      H GPCE+WLD+TKVL 
Sbjct  80   TLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVLY  133

Query  135  GSNCHKDFPGKTH------AMSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C   +  +         + Y++C  G C  +R+YW+  + L  K  WQ YK+C+PL
Sbjct  134  EDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PHYKE_6077
Length=322

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 68/137 (50%), Gaps = 15/137 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA+FN    +  Y SL+ FM   KA   +     ECGYTN  GA QP+P  +        
Sbjct  66   TANFNKGMAASKYTSLKEFMA-AKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSG  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+T+V    NC  +FP     + Y   AC GS  L  YW+ +   
Sbjct  125  EGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH--  182

Query  171  KGKHSWQVYKECVPLGR  187
                SWQVY  C  L +
Sbjct  183  --SPSWQVYINCAALEK  197

>PHYCA_130365
Length=266

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 17/135 (13%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYT  118
            A F     S  YK +R+ MD    Y        +CG+T+ NG     P +   T   G  
Sbjct  64   ATFKELAASNNYKDVRSMMDGNSVYG------EDCGFTDPNGTPVDPPTDGTATFSRGIV  117

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAAC-KGSCTLRWYWMGIRFL  170
            H GPCE+WLD+  VL   +C   +   T         + Y++C  G C LR+YW+G++ L
Sbjct  118  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRL  177

Query  171  KGKHSWQVYKECVPL  185
             GK  WQ YK C+PL
Sbjct  178  DGKTVWQAYKNCIPL  192

>PHYRA_74651
Length=344

 Score = 92.4 bits (228),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 68/134 (51%), Gaps = 18/134 (13%)

Query  64   FNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTH  119
            + +  +S GY  +R  +D D   Y  +      CG+T+ N   +  P+    T   G  H
Sbjct  69   YTSLKESNGYSDIRTLLDSDTSLYGAD------CGFTDPNATPKDPPSTGDATFSRGMVH  122

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLK  171
             GPCE+WLD+TKVLS  NC   +   T         + Y++C  G CTLR+YW+  + L 
Sbjct  123  AGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLD  182

Query  172  GKHSWQVYKECVPL  185
                WQVYK CVPL
Sbjct  183  SSTVWQVYKNCVPL  196

>PYIW_24288
Length=201

 Score = 89.7 bits (221),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/184 (33%), Positives = 87/184 (47%), Gaps = 30/184 (16%)

Query  26   DAHQLVILPNPTFTVPTKDE------RWSPLAFLENQG--YKTTADFNA--YYKSKG---  72
            D H  + +P PTF   T  E      R  P       G  Y +    NA  Y ++ G   
Sbjct  24   DGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFGNQN  83

Query  73   -YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF--------RTTGYTHDGPC  123
             Y++LR  +D    +  ++ AD ECG+T+  GA+QP+PA +        +    TH+GPC
Sbjct  84   RYRNLRELVDFTAVF--SAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTHEGPC  141

Query  124  EVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKE  181
            EVW D        NC K+F G    +SY  + C G+  L++YW+ +        W+VY  
Sbjct  142  EVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSLD----SREWEVYIN  197

Query  182  CVPL  185
            CVPL
Sbjct  198  CVPL  201

>PYU1_G014690
Length=295

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 86/168 (51%), Gaps = 18/168 (11%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLE--NQGYKTTADFNAYYKSKGYKSLRAFMDD  82
            ADAH  + +P   F   T +     + F       +K  A+F    K KG+ +LR++++D
Sbjct  22   ADAHGFIEVPKSEFPKGTSNPSEWIVEFPPPWTGNWKDPANFAKVSKEKGFDTLRSYIED  81

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSNCH  139
            K A          CG T+ N   + IP++ +   +    H GPCE+WLD+ +V+   +C 
Sbjct  82   KGAL---------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEIWLDDKRVMQDDDCE  132

Query  140  KDFPGKTHA--MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              F  +     + +++CK +C LR++W+G++       WQVYK CVPL
Sbjct  133  ATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DSGTRWQVYKNCVPL  178

>PYIR_16443
Length=275

 Score = 90.9 bits (224),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 86/166 (52%), Gaps = 19/166 (11%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLE--NQGYKTTADFNAYYKSKGYKSLRAFMDD  82
             +AH  + +P   F   TK      + F       +K   +F    K KG+++LR++++D
Sbjct  23   VNAHGFIEVPKSEFVKGTKYPSEWIVEFPPPWEGNWKDPKNFATVSKQKGFETLRSYIED  82

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSNCH  139
            K A          CG TN N + + IP++     +    H GPCE+WLD+ +V+   NC 
Sbjct  83   KGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQDDNCE  133

Query  140  KDFPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVY-KEC  182
              F  K  T  + +++CKGSC LRW+W+G++   GK  WQVY K C
Sbjct  134  GTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ-DSGKR-WQVYSKSC  177

>HYAP_01683
Length=336

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 71/124 (57%), Gaps = 9/124 (7%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTN-KNGARQPIPANFRT-TGYTHDG  121
            F   + +KGYKSL AF+ + +   +    D  CG T  K+ AR  +PA+  T TG+TH G
Sbjct  70   FTETFPTKGYKSLGAFILENQELFL-PKVDLNCGLTVYKDSARSELPASELTYTGFTHPG  128

Query  122  PCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            PCEVW D+TKVL  S+C   +PGK   M Y  + C G+  +  YW+G+        WQVY
Sbjct  129  PCEVWCDDTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGVH----GDPWQVY  184

Query  180  KECV  183
             +C+
Sbjct  185  IDCM  188

>PHYCA_127270
Length=279

 Score = 90.5 bits (223),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 84/179 (47%), Gaps = 25/179 (14%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
             DAH  +++P   F        +   D  W+   +  N   ++   F +   +  +K L+
Sbjct  21   VDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNP-QSVDTFKSLKAANNFKDLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              MDD   Y        +CG+T+ NG  QPIP + + T      H GPCE+WLD+ KVL 
Sbjct  80   TLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVLY  133

Query  135  GSNCHKDFPGKTHAM------SYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C   +  K   +       Y++C  G C  +R+YW+  + L  K  WQ YK+C+PL
Sbjct  134  EDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PYAR_24113
Length=192

 Score = 87.8 bits (216),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 81/173 (47%), Gaps = 19/173 (11%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT--------TADFNAYYKSKGYKSLR  77
            DAH  +I P P +T    +     +  L+    KT         A FNA +K+  YKSL+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGAR-QPIPANFRTTGYT--HDGPCEVWLDNTKVLS  134
              +   +  KV++ A  ECG+   +GA  QP+P       +T  H GPCEVW DN     
Sbjct  80   ELVLQNQ--KVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDNNLAFQ  137

Query  135  GSNCHKDFPGKTHAMSYA--ACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              NC K+  G    ++Y   AC G+  L  YW+ +   +    WQVY  C PL
Sbjct  138  DDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPL  186

>PHYSO_533682
Length=278

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHD  120
            F ++     +K L+  MDD   Y        +CG+T+ NG  QPIP + + T   G  H 
Sbjct  66   FTSFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHV  119

Query  121  GPCEVWLDNTKVLSGSNCHKDF--PGK----THAMSYAAC-KGSC-TLRWYWMGIRFLKG  172
            GPCE+WLD+ KVLS  +C+  +  P +    T  + Y++C  G C  +R Y +G + L  
Sbjct  120  GPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVD  179

Query  173  KHSWQVYKECVPL  185
            K  WQ YK C+PL
Sbjct  180  KTVWQSYKNCIPL  192

>PHYKE_8390
Length=130

 Score = 86.3 bits (212),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 2/97 (2%)

Query  29   QLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKV  88
            Q+V+ P P F V   D +   LA+L+ QG  T+ +   +  S GY SLRA +DD+  YKV
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  89   NSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPC  123
               A F+CG T+     Q IP N  F+T+GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PPTG_07509
Length=299

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 83/182 (46%), Gaps = 34/182 (19%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRA  78
            +ADAH  +  P  TF        W  +  ++N      G      F    K KG      
Sbjct  18   IADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDV  75

Query  79   FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTK  131
             +D  K        D +CGYT  +   +PIPA+ +         G+TH GPCE+++D+  
Sbjct  76   VLDMVK--------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  132  VLSGSNCHKDFPG---KTHAMS-----YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            VL G NC +DFPG    +  MS     +++C G CTL  YW+G +  +    WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCV  183

Query  184  PL  185
            PL
Sbjct  184  PL  185

>PYU1_G001528
Length=274

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 82/182 (45%), Gaps = 26/182 (14%)

Query  25   ADAHQLVILPNPTFTVPTKDERW----SPLAFLENQGYKTTAD-------FNAYYKSKGY  73
            ADAH  + +P PTFT+     ++       A     G   T D       F A  K+  Y
Sbjct  24   ADAHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAALKTSSY  83

Query  74   KSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCEV  125
            KS+R   + K    V + A  +CGYT+  GA QP+PA +         G+T  H GPCEV
Sbjct  84   KSVRDLWNAKGVLGV-TGATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCEV  142

Query  126  WLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            W DN    + +NC K++P     + +  A C G   L  YW+ +        WQ Y  C 
Sbjct  143  WCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALH----SPQWQAYINCA  198

Query  184  PL  185
            PL
Sbjct  199  PL  200

>PYVX_18175
Length=147

 Score = 85.9 bits (211),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 89/185 (48%), Gaps = 59/185 (32%)

Query  1    MAPSaiksvalaaivsaaalCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60
            MAPS      +AA+ +AA++   VADAHQ VILP P++T   +D  +SPLAFL       
Sbjct  1    MAPSLTTVATVAAVATAASVLGPVADAHQYVILPQPSWTTSDRDVWYSPLAFL-------  53

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGYTHD  120
                    +++G+K+     +D  A++                         R  GY   
Sbjct  54   --------ENQGFKT----QEDFSAWR-------------------------RANGY---  73

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYK  180
                      +    S  + D      A+ Y++CKGSCTL WYWMG+R+LKG +SWQVYK
Sbjct  74   -------KTLRSFMDSGKYTD-----TAIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYK  121

Query  181  ECVPL  185
             CVPL
Sbjct  122  NCVPL  126

>PPTG_04622
Length=273

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 18/137 (13%)

Query  61   TADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---G  116
            T  + +  +S GY  +RA +D D   Y  N      CG+T+ +   +  P     T   G
Sbjct  66   TTLYTSLKESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRG  119

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAACK-GSCTLRWYWMGIR  168
              H GPCE+WLD+T VLS  +C   +   T         + Y++C  G C LR+YW+  +
Sbjct  120  MVHAGPCEIWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQ  179

Query  169  FLKGKHSWQVYKECVPL  185
             +  K  WQVYK+CVPL
Sbjct  180  GVDSKMVWQVYKDCVPL  196

>PYVX_14662
Length=540

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 73/142 (51%), Gaps = 19/142 (13%)

Query  55   NQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT  114
            NQG   T  + +    KG   +R+ +DD   Y  +      CG+T+ +G  Q IP + + 
Sbjct  60   NQGSVDT--YKSLAAEKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIPTDGKA  111

Query  115  T---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA------MSYAAC-KGSC-TLRWY  163
            T   G  H GPCE+WLD+T VL   +C+  + G          + Y++C  G C  +R+Y
Sbjct  112  TFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFY  171

Query  164  WMGIRFLKGKHSWQVYKECVPL  185
            W+  + + G   WQVYK C+PL
Sbjct  172  WLAFQGVDGDTVWQVYKNCIPL  193

>PYIW_16810
Length=216

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 84/172 (49%), Gaps = 16/172 (9%)

Query  26   DAHQLVILPNPTFTVPTKDER--WS-PLAFLENQGYKTTADFNAYYKSKGYKSLRAF-MD  81
            DAH  + LP PTF    K +   W+  +   +N    T A F A YK  G+KSLRAF MD
Sbjct  24   DAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIMD  83

Query  82   DKKAYKVN---SNADFECGYTNKNGARQPIPANFRTTG--YTHDGPCEVWLDNTKVLSGS  136
            ++   K +   S    ECG+T+ NG  QP+P      G  + H+GPCE W D+  V+  +
Sbjct  84   NQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLVMPFT  143

Query  137  NCHKDFPGKTHA-MSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
               K + G   A M Y  A C G   L +YW+          +Q Y  CVP+
Sbjct  144  ASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFV----SPFQAYTNCVPI  191

>PHYSO_533903
Length=208

 Score = 86.7 bits (213),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (49%), Gaps = 28/181 (15%)

Query  25   ADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLR  77
             DAH  + +P   F        +   D  W    +  N   K+   F +   +  +K L+
Sbjct  22   VDAHGYIYVPQSQFKGGENSQWLVQIDPVWKSDDWYGNTA-KSVEVFKSLKVANNFKDLK  80

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
              +DD   Y        +CG+T+ NG  QPIP + +     G  H GPCE WLD+ KVL 
Sbjct  81   TMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  135  GSNCHKDFPGKTHA-------MSYAACK-GSC-TLRWYWMGIRFLKGKHS-WQVYKECVP  184
              +C+ ++ G ++        + Y++C+ G C  +R+YW+G + L  K + WQ YK+C+P
Sbjct  135  ADDCYSEY-GHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIP  193

Query  185  L  185
            L
Sbjct  194  L  194

>PYIW_21964
Length=265

 Score = 88.2 bits (217),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 83/184 (45%), Gaps = 28/184 (15%)

Query  24   VADAHQLVILPNPTFTVPTKDERWS-----PLAFLENQGYKTTAD-------FNAYYKSK  71
            +  AH  + +P  TF V     +++     P       G   T D       F A  K+ 
Sbjct  21   LVSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKAS  80

Query  72   GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPC  123
             YKS+RA +DDK  +   +N   ECG T+  GA+QP+P  +       + G+T  H GPC
Sbjct  81   TYKSMRALVDDKAVFIKEANK--ECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPC  138

Query  124  EVWLDNTKVLSGSNCHKDFPGKTHAM--SYAACKGSCTLRWYWMGIRFLKGKHSWQVYKE  181
            EVW D+    +  NC  D+      +   +A C G+  L+  W+ +       +WQ+Y  
Sbjct  139  EVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQIYIN  194

Query  182  CVPL  185
            C PL
Sbjct  195  CAPL  198

>PPTG_07507
Length=299

 Score = 88.6 bits (218),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 82/182 (45%), Gaps = 34/182 (19%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRA  78
             ADAH  +  P  TF        W  +  ++N      G      F    K KG      
Sbjct  18   TADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDV  75

Query  79   FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTK  131
             +D  K        D +CGYT  +   +PIPA+ +         G+TH GPCE+++D+  
Sbjct  76   VLDMVK--------DKKCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  132  VLSGSNCHKDFPG---KTHAMS-----YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            VL G NC +DFPG    +  MS     +++C G CTL  YW+G +  +    WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCV  183

Query  184  PL  185
            PL
Sbjct  184  PL  185

>PHYRA_78176
Length=312

 Score = 88.6 bits (218),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRT  114
            TA F   ++S  Y SL+ F+DDK    V ++A   CG  + +   QP+P      A+  +
Sbjct  67   TAAFTTAFESSSYSSLKEFIDDKATITV-TDATLTCGACDPDETAQPLPETYVEWAHSDS  125

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+ +V    +C  DF      + Y   AC GS  L +YW+ +   
Sbjct  126  EGFTASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH--  183

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  184  --SSTWQVYVNCAPL  196

>PYIW_19151
Length=248

 Score = 87.0 bits (214),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 78/134 (58%), Gaps = 18/134 (13%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY  117
            +K   +F A  K KG+ +LR++++DK A          CG+T+   + + IPA+ RT  +
Sbjct  55   WKDPKNFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPAD-RTIRF  104

Query  118  T----HDGPCEVWLDNTKVLSGSNCHKDFPGKTHA--MSYAACKGSCTLRWYWMGIRFLK  171
            +    H GPCE+++D+T+V    +C   F G   +  + ++ CKG C +R+YW+G++   
Sbjct  105  SRDIPHPGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASG  164

Query  172  GKHSWQVYKECVPL  185
             +  WQVYK CVP+
Sbjct  165  TR--WQVYKSCVPV  176

>PHYCA_98479
Length=276

 Score = 87.4 bits (215),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 75/167 (45%), Gaps = 32/167 (19%)

Query  34   PNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNAD  93
            PNP + V   D  W         G      F    + KG       +D   + K      
Sbjct  37   PNPEWVV-NVDNYWDI-----GSGGDQCGLFKTMAEEKGVSVKDVVLDMVGSGK------  84

Query  94   FECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG--  144
             ECG+T  +G+RQP+P +           G+TH GPCE+++D+T VL G NC  ++PG  
Sbjct  85   -ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGD  143

Query  145  ------KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                      + Y++CKG CTL  YW+G +       WQ Y  CVPL
Sbjct  144  VGSTVTSDMPVDYSSCKGDCTLTIYWLGFQ----NAQWQAYINCVPL  186

>PHYRA_73584
Length=287

 Score = 87.8 bits (216),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 18/137 (13%)

Query  61   TADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---G  116
            T  +++  KS GY  +R  +D D   Y  N      CG+TN +   +  P     T   G
Sbjct  63   TTLYSSLKKSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRG  116

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAACKGS-CTLRWYWMGIR  168
              H GPCE+WLD+T VLS  +C   +   +         + Y++C  S C LR+YW+  +
Sbjct  117  MVHAGPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQ  176

Query  169  FLKGKHSWQVYKECVPL  185
             +  K  WQVYK+CVPL
Sbjct  177  GVDSKTVWQVYKDCVPL  193

>PYU1_G001514
Length=469

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 16/123 (13%)

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCE  124
            YKS+RA +D K  ++     D +CG T+  GA+QP+PA +       + G+T  H GPCE
Sbjct  83   YKSMRALVDAKGVFQ--PGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPCE  140

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            VW DNT+V    NC KD+      + Y  + C G+  L+ YW+ +       +WQ Y  C
Sbjct  141  VWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQAYINC  196

Query  183  VPL  185
             PL
Sbjct  197  APL  199

>PYIR_23585
Length=240

 Score = 85.9 bits (211),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 80/168 (48%), Gaps = 17/168 (10%)

Query  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYK-TTADFNAYYKSKGYKSLRAFMDD  82
            VA+AH  +  P   F        W         G K + ADF      KG+ + RAF++ 
Sbjct  21   VANAHGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKTAPGKGFATTRAFLES  80

Query  83   KKAYKVNSNADFECGYTNKNGARQPIPANFR---TTGYTHDGPCEVWLDNTKVLSGSNCH  139
            +            CG T  N + +PIP++     +    H GPCE+W+DNT+V    +C 
Sbjct  81   RGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWIDNTRVYHNDDCE  131

Query  140  KDFPGK--THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              F     T  + ++ACKGSC LR+YW+G++   G   +Q Y +C+ L
Sbjct  132  AAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGGARFQSYSKCLAL  177

>PHALS_05392
Length=367

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 69/142 (49%), Gaps = 19/142 (13%)

Query  55   NQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRT  114
            ++G  +T  F     +  +K +R+ MD    Y        +CGYT+ NG     P+N   
Sbjct  143  DEGLLST--FKELATANNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEA  194

Query  115  T---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAACKGS-CTLRWY  163
            T   G  H GPCE+WLD+  VL   +C   +   T         + Y++C    C LR+Y
Sbjct  195  TFSRGIVHAGPCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFY  254

Query  164  WMGIRFLKGKHSWQVYKECVPL  185
            W+ ++ L GK  WQ YK C+PL
Sbjct  255  WLALQRLDGKTVWQAYKNCIPL  276

>PYAP_18713
Length=184

 Score = 84.3 bits (207),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 81/164 (49%), Gaps = 18/164 (11%)

Query  23   SVADAHQLVILPNPTF--TVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFM  80
            S ADAH  V  P   F  + P   E  +      +  +KT A +    K KG+K LR+F+
Sbjct  20   STADAHGYVAEPPAEFPKSTPYPSEWVAEFPPPWSGTFKTGAQYAVVAKDKGFKDLRSFL  79

Query  81   DDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSGSN  137
            +DK            CG TN N   + +P++ +        H GPCE+W+D+T V    +
Sbjct  80   EDKGP---------ACGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCELWIDDTMVYHNDD  130

Query  138  CHKDFPGKTHA--MSYAACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            C  +F  K     + +++CKG C LR+YW+G++   GK  WQ Y
Sbjct  131  CELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ-DSGKR-WQSY  172

>SPRG_19917
Length=241

 Score = 85.5 bits (210),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (54%), Gaps = 28/139 (20%)

Query  62   ADFNAYYKSKG-YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-----  115
            A+FN  +K++  YK+LRA +D             +CG T  N AR+ IP+N + T     
Sbjct  61   ANFNKAFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQNPD  111

Query  116  ---GY--THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKG-SCTLRWYWMG  166
               G+  +H GPCEVWLDN +V    +C  +FP K  A   + Y++C    C LR+YW+ 
Sbjct  112  TGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIA  171

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   +    WQVYK CVPL
Sbjct  172  LHSPR----WQVYKNCVPL  186

>PHYCA_12942
Length=353

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 80/176 (45%), Gaps = 31/176 (18%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRAF  79
            ADAH  +  P PTF   + +  W  +  ++N      G      F      +G       
Sbjct  20   ADAHGSLKQPKPTFDGSSAE--W--VTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKDVI  75

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKV  132
            +D  K        D +CGYT  +   QPIP++           G+TH GPCE+++D+  V
Sbjct  76   LDMVK--------DKKCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMV  127

Query  133  LSGSNCHKDFPGKTHA---MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            L G NC ++F G   +   + Y++C G+C L  YW+G +       WQ Y  CVPL
Sbjct  128  LHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAYVNCVPL  179

>PHYRA_73607
Length=343

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 66/134 (49%), Gaps = 18/134 (13%)

Query  64   FNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTH  119
            +++   S GY  +R  +D D   Y  +      CG+TN +   +  P     T   G  H
Sbjct  69   YSSLKSSNGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVH  122

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAACKGS-CTLRWYWMGIRFLK  171
             GPCE+WLD+TKVLS  NC   +   T         + Y++C  S C LR+YW+  + + 
Sbjct  123  VGPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  182

Query  172  GKHSWQVYKECVPL  185
                WQVYK CVPL
Sbjct  183  SSMVWQVYKNCVPL  196

>PYVX_20783
Length=276

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 81/177 (46%), Gaps = 25/177 (14%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKS-------KGYKS  75
            S A  H  +I+P PT           P   ++      +A +  YY++        G  S
Sbjct  18   SQASGHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISS  77

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP----ANFRTTGYTHDGPCEVWLDNTK  131
            L+ ++    ++        ECG T K+G  QP+P    A   T G +H GPCE+W D+T+
Sbjct  78   LKEYITTYGSFD-------ECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTR  130

Query  132  VLSGSNCHKDFPGKTHA---MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            V + +NC  +F G++ A   +  A C GS    +YW+ +        WQVY  CV L
Sbjct  131  VFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLALH----AQPWQVYINCVAL  183

>PITG_04949
Length=337

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 17/135 (13%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYT  118
            A F        +K +R+ MD    +        ECG+T+  G     P++   T   G  
Sbjct  65   ATFKELAPKNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIV  118

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAACK-GSCTLRWYWMGIRFL  170
            H GPCE+WLD+  VL   +C   +   T         + Y++C  G C LR+YW+ ++ L
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRL  178

Query  171  KGKHSWQVYKECVPL  185
            KGK  WQ YK C+PL
Sbjct  179  KGKTVWQAYKNCIPL  193

>PHYKE_2454
Length=374

 Score = 86.7 bits (213),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 32/186 (17%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTT--------------ADFNAYY  68
            S+ + H  +  P  TF+    D+      F+   G  +T              A F   +
Sbjct  16   SIVNGHGWMTKPEATFSASAGDK----TQFVATIGSSSTGFEGSYNSAPADNVASFTKAF  71

Query  69   KSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTGYT--HDG  121
            K+  YKSL+A +DDK    V S A   CG  + + A QP+P+        + G+T  H+G
Sbjct  72   KASSYKSLKALIDDKAKITV-SGATLTCGSADPSAAAQPLPSTLEWSHSDSEGFTPSHEG  130

Query  122  PCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVY  179
            PCE W D+ +V    NC  +FP     M Y +    G+  L +YW+ +       SWQVY
Sbjct  131  PCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----GPSWQVY  186

Query  180  KECVPL  185
              C  L
Sbjct  187  VNCAAL  192

>PPTG_04647
Length=327

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 67/137 (49%), Gaps = 18/137 (13%)

Query  61   TADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---G  116
            T+ +     S GY  +R  +D D   Y        +CGYTN +   +  P     T   G
Sbjct  65   TSVYTTLKSSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRG  118

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKT-------HAMSYAACKGS-CTLRWYWMGIR  168
              H GPCE+WLD+T VLS  NC   +   T         + Y++C  S C LR+YW+  +
Sbjct  119  MVHVGPCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQ  178

Query  169  FLKGKHSWQVYKECVPL  185
             +  K  WQVYK+CVPL
Sbjct  179  GVDSKMVWQVYKDCVPL  195

>PPTG_14221
Length=275

 Score = 85.5 bits (210),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 68/138 (49%), Gaps = 17/138 (12%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---  115
            K+   F +   +  +K L+  MDD   Y        +CG+TN NG  QPIP + + T   
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSR  114

Query  116  GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH------AMSYAACK-GSC-TLRWYWMGI  167
               H GPC +WLD+  VL   +C   +  +         + Y++C  G C  +R+YW+  
Sbjct  115  ALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAF  174

Query  168  RFLKGKHSWQVYKECVPL  185
            + L  K  WQ YK+C+PL
Sbjct  175  QGLNKKTVWQSYKDCIPL  192

>PHYKE_9023
Length=275

 Score = 85.5 bits (210),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 63/116 (54%), Gaps = 8/116 (7%)

Query  71   KGYKSLRAFMDDKKAYKVNSNADFECGYTN-KNGARQPIPANFRTTGYTHDGPCEVWLDN  129
            K YK+L A + DK+     S  D ECG T  K+ AR  +P     TG+TH GPCEVW DN
Sbjct  76   KKYKTLSALIADKQELYSKS-VDPECGLTAYKDSARSELPKELAFTGFTHPGPCEVWCDN  134

Query  130  TKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            TKVL  ++C K +P     MSY  + C  +  L  YW+ +        WQVY +CV
Sbjct  135  TKVLYKADCQKAYPDIPATMSYDSSLCANANRLTIYWIAVH----GDPWQVYADCV  186

>PHYSO_485524
Length=278

 Score = 85.1 bits (209),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 68/145 (47%), Gaps = 22/145 (15%)

Query  57   GYKTTADFNAYYK----SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPAN  111
            G K      A YK    S   K +R  +D D K Y  N      CGYTN +   +  P +
Sbjct  56   GAKGDEGLVALYKELKDSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTD  109

Query  112  FRTT---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTL  160
               T   G  H GPCE+WLD+  VL   +C   +   T         + Y++C  G C  
Sbjct  110  GTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMF  169

Query  161  RWYWMGIRFLKGKHSWQVYKECVPL  185
            R+YW+ ++ L GK  WQVYK C+PL
Sbjct  170  RFYWLALQRLDGKTYWQVYKNCIPL  194

>PPTG_04618
Length=326

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 17/135 (13%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYT  118
            A F        YK +R+ MD    Y  +      CG+T+  G     P++   T   G  
Sbjct  65   ATFKELAPKNNYKDVRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIV  118

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAAC-KGSCTLRWYWMGIRFL  170
            H GPCE+WLD+  VL   +C   +   T         + Y++C  G C LR+YW+ ++ L
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  171  KGKHSWQVYKECVPL  185
             GK  WQ YK C+PL
Sbjct  179  DGKTVWQAYKNCIPL  193

>PHYSO_524101
Length=308

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRT  114
            TA F   ++S  Y SL+  ++DK    V ++A   CG  + +   QP+P      A+  +
Sbjct  66   TAAFTTAFESSSYSSLKELINDKATITV-TDATLTCGMCDPDETAQPLPDTYVEWAHSDS  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+ +V    +C  D+      + Y   AC GS TL +YW+ +   
Sbjct  125  EGFTASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH--  182

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PHYSO_483955
Length=320

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 64/135 (47%), Gaps = 17/135 (13%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYT  118
            A F     +  YK +R+ MD    Y        +CG+T+  G     P +   T   G  
Sbjct  65   ATFKELSAANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIV  118

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFL  170
            H GPCE+WLD+  VL   +C   +   T         + Y++C  G C LR+YW+ ++ L
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  171  KGKHSWQVYKECVPL  185
             GK  WQ YK C+PL
Sbjct  179  DGKTVWQAYKNCIPL  193

>PHYRA_77971
Length=230

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 76/181 (42%), Gaps = 33/181 (18%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRAF  79
            A+AH  +  P PTF        W  +  ++N      G      +      KG       
Sbjct  20   AEAHGHLDQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVV  77

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKV  132
            +D          AD +CG+T  +   QP+P N +         GYTH GPCE+++D+  V
Sbjct  78   LD-------MVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMV  130

Query  133  LSGSNCHKDFPGKTH--------AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            L   NC  D+PG  +         + Y++C G CT   YW+G +       WQ Y  CVP
Sbjct  131  LHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVP  186

Query  185  L  185
            L
Sbjct  187  L  187

>PYIW_25463
Length=216

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 67/139 (48%), Gaps = 25/139 (18%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPA----NFRT  114
            +    F A +   GYKSL+  MD +            CG++  + A   +       F+ 
Sbjct  65   QNVQQFTAAWSKTGYKSLKELMDKQVP---------GCGFSRTDIAAVDVSGMSSMKFQN  115

Query  115  TGY------THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMG  166
              Y      +H GPCE W+DNTKV    +C K +PG      MSYAACKG+C L +YW+ 
Sbjct  116  NEYKEGFLGSHHGPCEGWIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLA  175

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   K    WQ YK CVP+
Sbjct  176  LHSQK----WQAYKHCVPI  190

>PHYRA_85794
Length=230

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 76/181 (42%), Gaps = 33/181 (18%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRAF  79
            A+AH  +  P PTF        W  +  ++N      G      +      KG       
Sbjct  20   AEAHGHLNQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVV  77

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKV  132
            +D          AD +CG+T  +   QP+P N +         GYTH GPCE+++D+  V
Sbjct  78   LD-------MVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMV  130

Query  133  LSGSNCHKDFPGKTH--------AMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            L   NC  D+PG  +         + Y++C G CT   YW+G +       WQ Y  CVP
Sbjct  131  LHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVP  186

Query  185  L  185
            L
Sbjct  187  L  187

>PHALS_03177
Length=259

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---  115
            K+   F +   +  +K L+  MD       N     +CGY++ NG  QPIP + + T   
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMD-------NPVLGRDCGYSDPNGKPQPIPKDGKATFSR  113

Query  116  GYTHDGPCEVWLDNTKVLSGSNCHKDFPG------KTHAMSYAAC-KGSC-TLRWYWMGI  167
               H GPCE+WLDN KVL   +C+  +            + Y++C  G C  +R+YW+  
Sbjct  114  AMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAF  173

Query  168  RFLKGKHSWQVYKECVPL  185
            + + GK  WQ YK C+PL
Sbjct  174  QGINGKTFWQSYKMCIPL  191

>PHYRA_73582
Length=326

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 79/177 (45%), Gaps = 25/177 (14%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTT-------ADFNAYYKSKGYKSLRAF  79
            AH  +  P PT+     ++    +A L   G+  +       A F     +  YK L+  
Sbjct  23   AHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLKTL  82

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSGS  136
            MD  +  +       +CG+T+ NG     P +   T   G  H GPCE+WLD+  VL   
Sbjct  83   MDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQND  135

Query  137  NCHKDFPGKTHA-------MSYAACK-GSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +C   +   T         + Y+ C  G C LR+YW+ ++ L GK  WQ YK C+PL
Sbjct  136  DCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCIPL  192

>CCI47381
Length=211

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 71/139 (51%), Gaps = 27/139 (19%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-----  115
            TA F   + S  +++LR F+ DK  Y         CG TN N + +PIPA+         
Sbjct  60   TATFLTAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPD  110

Query  116  ---GY--THDGPCEVWLDNTKVLSGSNCHKDF---PGKTHAMSYAACKGSCTLRWYWMGI  167
               G+  +H GPCEVWL  T+V    NC   F   P +   +++++C G C L+++W+ +
Sbjct  111  TREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARI-PINFSSCSGGCLLQFFWLAL  169

Query  168  RFLKGKHSWQVYKECVPLG  186
                 +  WQVYK C+P+ 
Sbjct  170  H----EPQWQVYKNCIPIA  184

>PHYRA_84947
Length=265

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 74/166 (45%), Gaps = 12/166 (7%)

Query  28   HQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYK  87
            H  +ILP P            P   ++      +A +  YY++      +  +   K Y 
Sbjct  23   HGNIILPKPEGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYEAVDSWFTKNNIASLKEYI  82

Query  88   VNSNADF-ECGYTNKNGARQPIP----ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142
                 D  ECG T KNGA QP+P    A     G +H GPCE+W D+T+V   SNC   F
Sbjct  83   TTYGTDISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPGPCEIWCDDTRVFHDSNCVAKF  142

Query  143  PGKTHA---MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             G++ A   +  + CK S  L +YW+ +        WQVY  CV L
Sbjct  143  SGQSPAKIPIDVSTCKSSSELVFYWLALHI----QPWQVYINCVAL  184

>SPRG_19916
Length=305

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 75/140 (54%), Gaps = 28/140 (20%)

Query  61   TADFNAYYKSK-GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT----  115
             A+FN  +K++  +K+LR  +D +           +CG T  NGA++ IP N   T    
Sbjct  60   VANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNP  110

Query  116  ----GY--THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKG-SCTLRWYWM  165
                G+  +H GPCEVW+D+ +V    +C  +FP K  A   + Y++C G  C LR+YW+
Sbjct  111  DTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWL  170

Query  166  GIRFLKGKHSWQVYKECVPL  185
             +     +  WQVYK CVPL
Sbjct  171  ALH----EPMWQVYKNCVPL  186

>PHYCA_534473
Length=1050

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 68/134 (51%), Gaps = 18/134 (13%)

Query  64   FNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTH  119
            + +  +S GY  +R  +D D   Y  N      CG+T+ +   +  P     T   G  H
Sbjct  841  YASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVH  894

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAACKGS-CTLRWYWMGIRFLK  171
             GPCE+WLD+TKVLS  +C   +   T         + Y++C  S C LR+YW+  + + 
Sbjct  895  AGPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  954

Query  172  GKHSWQVYKECVPL  185
             K  WQVYK+CVPL
Sbjct  955  SKIVWQVYKDCVPL  968

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 18/136 (13%)

Query  62   ADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GY  117
            A +    KS   K +R  +D D K Y  +      CG T+     +  P+    T   G 
Sbjct  534  AMYKQLKKSNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGI  587

Query  118  THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAACK-GSCTLRWYWMGIRF  169
             H GPCE+WLD+  VL   +C   +   T A       + Y++C  G C  R+YW+ ++ 
Sbjct  588  VHAGPCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQR  647

Query  170  LKGKHSWQVYKECVPL  185
               K  WQVYK C+PL
Sbjct  648  RDSKTLWQVYKNCIPL  663

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 55/125 (44%), Gaps = 17/125 (14%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHD  120
            F        YK +R  MD    Y  +      CG+T+  G     P +   T   G  H 
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGIVHA  120

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLKG  172
            GPCE+WLD+  VL   +C   +   T         + Y++C  G C LR+YW+ ++ LKG
Sbjct  121  GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKG  180

Query  173  KHSWQ  177
              + Q
Sbjct  181  GGASQ  185

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 61/138 (44%), Gaps = 22/138 (16%)

Query  57   GYKTTADFNAYYK----SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPAN  111
            G K      A YK    S   K +R  +D D K Y  +      CGYTN +   +  P +
Sbjct  262  GAKGDDGLVALYKELKASNNAKDIRTLLDSDTKLYGAD------CGYTNPDVTPKDPPTD  315

Query  112  FRTT---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTL  160
               T   G  H GPCE+WLD+  VLS  +C   +   T         + Y++C  G C  
Sbjct  316  GTATFSRGIVHAGPCEIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMF  375

Query  161  RWYWMGIRFLKGKHSWQV  178
            R+YW+ ++ L G  + Q 
Sbjct  376  RFYWLALQRLDGGGASQT  393

>SPRG_22161
Length=300

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 75/139 (54%), Gaps = 28/139 (20%)

Query  62   ADFNAYYKSKG-YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-----  115
            A+FN  +K++  +K+LR  +D +           +CG T  NGA++ IP N   T     
Sbjct  61   ANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIPTNGMMTWQNPD  111

Query  116  ---GY--THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKGS-CTLRWYWMG  166
               G+  +H GPCEVW+DN +V    +C  +FP K  A   + Y++C  + C LR+YW+ 
Sbjct  112  TGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLA  171

Query  167  IRFLKGKHSWQVYKECVPL  185
            +     +  WQVYK CVPL
Sbjct  172  LH----EPMWQVYKNCVPL  186

>PHYRA_86016
Length=236

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 61/108 (56%), Gaps = 19/108 (18%)

Query  93   DFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG-  144
            D +CGYT  +   QPIP + +         G+TH GPCE+++D+T VL G +C +++PG 
Sbjct  19   DKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGG  78

Query  145  --KTHAMS-----YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
               ++ MS     Y++C G CTL  YW+  +  +    WQ Y  CVPL
Sbjct  79   PDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PHYKE_6078
Length=317

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (52%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRT  114
            TA F   ++S  Y SL+ F++DK    V ++A   CG  + + A Q +P      A+  +
Sbjct  66   TAAFTTAFESSSYSSLKEFINDKATITV-TDATLTCGSCDPDEAAQALPDTYVEWAHSDS  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+T+V    +C  D+      + +   AC GS T+  YW+ +   
Sbjct  125  EGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALH--  182

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PYU1_G005985
Length=200

 Score = 82.0 bits (201),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 70/135 (52%), Gaps = 17/135 (13%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY-  117
            + T  F + + + GY SL+A +D       NS  D      ++  A +     FR   + 
Sbjct  66   ENTQQFTSGFHAAGYSSLKALLDPVAPGCGNSRVDVPPVGVSRLAAME-----FRNDEFH  120

Query  118  -----THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMGIRFL  170
                 +H GPCEVW+DN ++  G +C   F G   T  ++++ C+G CTL +YW+ +   
Sbjct  121  EGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLALH--  178

Query  171  KGKHSWQVYKECVPL  185
              + +WQVYK+CVP+
Sbjct  179  --EPTWQVYKQCVPI  191

>PHYCA_531163
Length=314

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 68/137 (50%), Gaps = 18/137 (13%)

Query  61   TADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---G  116
            T+ + +   S GY  +R  +D D   Y        +CGYTN +   +  P+    T   G
Sbjct  66   TSVYTSLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRG  119

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKT-------HAMSYAACKGS-CTLRWYWMGIR  168
              H GPCE+WLD+T VLS  +C   +   T         + Y++C  S C LR+YW+  +
Sbjct  120  MVHVGPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQ  179

Query  169  FLKGKHSWQVYKECVPL  185
             +     WQVYK+CVPL
Sbjct  180  GVDSAIVWQVYKDCVPL  196

>PYAR_16493
Length=256

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (53%), Gaps = 5/121 (4%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGA-RQPIPANFRTTGYTHDGP  122
            F   +    YK+L+  +  ++       +D +CG T K+ A R  +PA  + +G+TH GP
Sbjct  72   FETNFPKSKYKTLKDLIMGEQTVLTEYKSDAQCGLTTKDEAKRATLPATLKYSGFTHAGP  131

Query  123  CEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            CEVW DNTK+   ++C K +   T  +  + C+G+  L  YW+ +        WQVY +C
Sbjct  132  CEVWCDNTKLAFANDCEKTYATGTIPIDTSKCQGADRLTIYWVAVH----SEPWQVYTDC  187

Query  183  V  183
            V
Sbjct  188  V  188

>SDRG_17318
Length=241

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 74/139 (53%), Gaps = 28/139 (20%)

Query  62   ADFNAYYKSKG-YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-----  115
             +FN  +K++  YK+LRA +D             +CG T  N AR+ IP+N + T     
Sbjct  61   VNFNKAFKAQSKYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQNPD  111

Query  116  ---GY--THDGPCEVWLDNTKVLSGSNCHKDFPGKTHA---MSYAACKG-SCTLRWYWMG  166
               G+  +H GPCEVWLDN +V    +C  +FP K  A   + Y++C    C LR+YW+ 
Sbjct  112  TGEGFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIA  171

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   +    WQVYK CVPL
Sbjct  172  LHSPR----WQVYKNCVPL  186

>PYVX_20789
Length=290

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 72/166 (43%), Gaps = 11/166 (7%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAY  86
             H  +ILP PT           P   ++       + ++ YY+          +   K Y
Sbjct  22   GHGNIILPKPTGDSDHVYYYGGPAGTIDMPEIIGDSIYSEYYQGVADWFTENGISSLKEY  81

Query  87   KVNSNADFECGYTNKNGARQPIP----ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDF  142
                    ECG T K+G  QP+P    A   T G +H GPCE+W D+T+V + +NC  DF
Sbjct  82   XXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSHPGPCEIWCDDTRVFNSTNCVTDF  141

Query  143  PGKTHAM---SYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             G++ AM     A C  S    +YW+ +        WQVY  CV L
Sbjct  142  SGQSPAMIPIDVATCTASSEFVFYWLALH----AQPWQVYINCVAL  183

>PHYRA_73606
Length=366

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (49%), Gaps = 18/137 (13%)

Query  61   TADFNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---G  116
            T+ +     S GY  +R  +D D   Y        +CGYTN +   +  P     T   G
Sbjct  66   TSVYTGLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRG  119

Query  117  YTHDGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAACKGS-CTLRWYWMGIR  168
              H GPCE+WLD+T VLS  +C   +   T         + Y++C  S C LR+YW+  +
Sbjct  120  MVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQ  179

Query  169  FLKGKHSWQVYKECVPL  185
             +  +  WQVYK+CVPL
Sbjct  180  GVDSEIVWQVYKDCVPL  196

>PHYKE_1913
Length=280

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 78/183 (43%), Gaps = 34/183 (19%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLR  77
            S ADAH  +  P PTF        W  +  +EN      G      +      KG     
Sbjct  18   SRADAHGHLKSPEPTFEDGAPTVEW--VTLIENYWDIGSGGDQVGKYKTMAAEKGMSVKD  75

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNT  130
              +D  K        D  CGYT  +   +P+P++ +         G+TH GPCEV++++ 
Sbjct  76   VVLDMVK--------DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYINDK  127

Query  131  KVLSGSNCHKDFPGKTHA--------MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
             VL G +C  ++PG            + Y++C G CTL  YW+  +  +    WQ Y  C
Sbjct  128  MVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYINC  183

Query  183  VPL  185
            VPL
Sbjct  184  VPL  186

>PHYCA_97965
Length=288

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 78/181 (43%), Gaps = 34/181 (19%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRAF  79
            A+AH  +  P  TF        W  +  ++N      G      F    K KG       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKV  132
            +D  K        D +CGYT  +   QPIP++           G+TH GPCE+++D+  V
Sbjct  80   LDMVK--------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMV  131

Query  133  LSGSNCHKDFPG------KTHAMS--YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            L G +C  +FPG      K   MS  +++C G CTL  YW+  +       WQ Y  CVP
Sbjct  132  LHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVP  187

Query  185  L  185
            L
Sbjct  188  L  188

>PYIW_15526
Length=256

 Score = 82.4 bits (202),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 69/140 (49%), Gaps = 27/140 (19%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY-  117
            +  A+F A +   GY SL+  +D   +          CGYTN N A   + +  ++  Y 
Sbjct  63   QNAAEFTAAWPKTGYTSLKEMLDKSVS---------GCGYTNPNAAPVDV-SGLKSMKYQ  112

Query  118  ----------THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWM  165
                      +H GPCE W+DNTK+    +C K +PG   T  + Y+ CKG+C L +YW+
Sbjct  113  NNEYKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWL  172

Query  166  GIRFLKGKHSWQVYKECVPL  185
             +   K    WQVYK CV +
Sbjct  173  AVHSPK----WQVYKGCVAI  188

>PPTG_03156
Length=445

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 84/183 (46%), Gaps = 26/183 (14%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLE--NQGYKTT---------ADFNAYYKSK  71
            S   AH  +  P  TF+    D+    +A +E  + G+K T         A F   + + 
Sbjct  16   SCVSAHGWLSKPAATFSNEAGDKS-QFIATIEASSSGFKGTFNTAPADNVASFTKAFATS  74

Query  72   GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTGYT--HDGPCE  124
             YKSL+AF+DDK    V + A   CG    +   QP+P         + G+T  H+GPCE
Sbjct  75   TYKSLKAFIDDKAKITV-TGATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEGPCE  133

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
             W D+ +V    NC  +F      M Y  + C G+ TL +YWM +       +WQVY  C
Sbjct  134  AWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMH----GPTWQVYVNC  189

Query  183  VPL  185
             PL
Sbjct  190  APL  192

>PYIR_22133
Length=441

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 76/179 (42%), Gaps = 27/179 (15%)

Query  28   HQLVILPNPTFTVPTKDERWSPL-----AFLENQGYKTTAD-------FNAYYKSKGYKS  75
            H  + LP PTF+    D     L     A     G   T D       FNA  K+  YKS
Sbjct  26   HGSMSLPKPTFSTQGGDTTQPGLNVDSSALTAPSGMSFTTDPTSNTNAFNAAIKTSAYKS  85

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTGYT--HDGPCEVWLD  128
            ++  +  K      +N D  CG T   GA+QP+PA          G+T  H+GPCEVW D
Sbjct  86   VKDLIAAKGVPIPGANKD--CGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWCD  143

Query  129  NTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            N    S  NC K+FP     + Y  + C G   L+  W+ +       +WQ Y  C  +
Sbjct  144  NVLAFSDGNCAKNFPSAPAKLPYDKSKCVGKSVLKTIWLALH----SPTWQAYINCAAI  198

>PHYRA_86752
Length=300

 Score = 83.2 bits (204),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 85/179 (47%), Gaps = 26/179 (15%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQ-GYKTTADFNAYYKSKGYKSLRAFMD  81
            S ADAH  +  P  TF        W  +  ++N     +  D    YK+   +   +  D
Sbjct  18   SHADAHGNLKEPEATFEDGAPTVEW--VTLIDNYWDIGSGGDQVGKYKTMAAEKKMSVRD  75

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLS  134
                  ++   D +CGYT  +   QPIP + +         G+TH GPCE+++D+T VL 
Sbjct  76   ----VVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLH  131

Query  135  GSNCHKDFPG---KTHAMS-----YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            G +C +++PG    ++ MS     Y++C G CTL  YW+  +  +    WQ Y  CVPL
Sbjct  132  GDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PYU1_G001527
Length=278

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 63/124 (51%), Gaps = 16/124 (13%)

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCE  124
            YKS+RA +D K  ++   N   ECG T+  G +QP+PA +       + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            VW DN    S  NC  ++P     + +  + C G   L++YW+ +       +WQ Y  C
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  183  VPLG  186
             PL 
Sbjct  197  APLA  200

>PYU1_G001523
Length=278

 Score = 82.8 bits (203),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 63/124 (51%), Gaps = 16/124 (13%)

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCE  124
            YKS+RA +D K  ++   N   ECG T+  G +QP+PA +       + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            VW DN    S  NC  ++P     + +  + C G   L++YW+ +       +WQ Y  C
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  183  VPLG  186
             PL 
Sbjct  197  APLA  200

>PPTG_03138
Length=294

 Score = 82.8 bits (203),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRT  114
            TA F   ++S  + SL+  +++K    V S+A   CG  + +   QP+P      A+  +
Sbjct  66   TAAFTKAFESSSFSSLKELINEKATLTV-SDATLTCGSCDPDETAQPLPDTYVEWAHSDS  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCE+W D+ +V  G +C  D+      + Y   AC GS  L +YW+ +   
Sbjct  125  EGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALH--  182

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PHYKE_2937
Length=366

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 65/134 (49%), Gaps = 18/134 (13%)

Query  64   FNAYYKSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTH  119
            + +   S GY  +R  +D D   Y        +CGYTN +   +  P     T   G  H
Sbjct  73   YTSLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVH  126

Query  120  DGPCEVWLDNTKVLSGSNCHKDFPGKTH-------AMSYAACKGS-CTLRWYWMGIRFLK  171
             GPCE+WLD+T VLS  +C   +   T         + Y++C  S C LR+YW+  + + 
Sbjct  127  VGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVD  186

Query  172  GKHSWQVYKECVPL  185
                WQVYK+CVPL
Sbjct  187  SSMVWQVYKDCVPL  200

>PHYCA_19612
Length=610

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA F   ++S  Y SL+  ++DK    V ++A   CG  + +   Q +PA +       +
Sbjct  371  TAAFTTAFESSSYSSLKELINDKATITV-TDATLTCGACDPDETAQALPATYVEWAHSDS  429

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+ +V  G +C  D+      + Y   AC GS  L +YW+ +   
Sbjct  430  EGFTASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH--  487

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  488  --SSTWQVYVNCAPL  500

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 64/135 (47%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA F   + S  Y SL+  +       V ++A   CG  N +   QP+P  +       T
Sbjct  69   TAAFTKAFASSSYTSLKDLITSLATVTV-TDATLTCGSCNPDETAQPLPDKYVEWSHSST  127

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+ +V    +C  D+      + Y   AC G+ TL +YW+ +   
Sbjct  128  EGFTSSHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  185

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  186  --SSTWQVYVNCAPL  198

>PYIR_15187
Length=207

 Score = 80.9 bits (198),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 86/182 (47%), Gaps = 28/182 (15%)

Query  23   SVADAHQLVILPNPTFTVP-TKDERWSPLAFLENQGYK----------TTADFNAYYKSK  71
            S  +AH  + +P  ++T   TK    + L+   N  ++           T  F A +++ 
Sbjct  24   SQVEAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAA  83

Query  72   GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY------THDGPCEV  125
            GY SL+  +D       NS  D      ++  A +     FR   Y      +H GPCEV
Sbjct  84   GYPSLKTLLDPAAPGCGNSRLDVPAVDVSRLSAME-----FRNDEYHEGFVSSHHGPCEV  138

Query  126  WLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            W+DNT+     +C   FPG   +  ++++ CK  CTL +YW+ +     + +WQVYK+CV
Sbjct  139  WIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLALH----EPTWQVYKQCV  194

Query  184  PL  185
            P+
Sbjct  195  PI  196

>PHYCA_12943
Length=287

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 78/181 (43%), Gaps = 34/181 (19%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLRAF  79
            A+AH  +  P  TF        W  +  ++N      G      F    K KG       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKV  132
            +D  K        D +CGYT  +   QPIP++           G+TH GPCE+++D+  V
Sbjct  80   LDMVK--------DKKCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMV  131

Query  133  LSGSNCHKDFPG------KTHAMS--YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            L G +C  +FPG      K   MS  +++C G CTL  YW+  +       WQ Y  CVP
Sbjct  132  LHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVP  187

Query  185  L  185
            L
Sbjct  188  L  188

>PHYRA_80632
Length=330

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 70/136 (51%), Gaps = 12/136 (9%)

Query  57   GYKTTAD---FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTN-KNGARQPIPA-N  111
            GY TTA    F A + S GY SL  F++  +    + N D +CGYT   + ARQ +PA N
Sbjct  60   GYGTTATVAFFEAQFNSSGYNSLGQFIETNQVLY-SDNIDEQCGYTVYDDTARQTMPATN  118

Query  112  FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRF  169
               TG+TH GPCEVW D+T VL   +C   +P     + Y  + C  +     YW+ +  
Sbjct  119  LTHTGFTHPGPCEVWCDDTVVLFEYDCQATYPDIPAGIPYDESLCADANRFTIYWLAVH-  177

Query  170  LKGKHSWQVYKECVPL  185
                  WQVY +CV L
Sbjct  178  ---GAPWQVYTDCVWL  190

>PYAP_24691
Length=145

 Score = 79.3 bits (194),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)

Query  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTH-AMSYAACKGSCTLRWYWMGIRFLKGKHSWQ  177
            H GPCE+W DNT+V   S+C K F   T   + Y+ CKG+C LR+YW+G++   G   WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQ--DGGKRWQ  60

Query  178  VYKECVPLGRKR  189
             YK CVP+G  +
Sbjct  61   SYKNCVPIGNGK  72

>PHYKE_9024
Length=299

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 79/159 (50%), Gaps = 17/159 (11%)

Query  34   PNPTFTVPTKDERWSPLAFLENQ--GYKTTADFNAY---YKSKGYKSLRAFMDDKKAYKV  88
            PN  +     +E W      +N   GY      N +   + SKGY SL AF+  K     
Sbjct  38   PNNGYGSTIDNEIW---GVYDNSKYGYGVNGTLNFFKDTFPSKGYDSLGAFIS-KNQELY  93

Query  89   NSNADFECGYTN-KNGARQPIPANFRT-TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKT  146
            +S  D +CG T  K+ AR  +PA+  T +G+TH GPCEVW D+TKVL   +C   +P   
Sbjct  94   SSATDADCGLTVYKDSARSELPASKLTYSGFTHTGPCEVWCDDTKVLFDYDCQTKYPDIP  153

Query  147  HAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
              MSY  + C  +  L  YW+G+        WQVY +CV
Sbjct  154  ATMSYDESLCANANRLTIYWIGLH----GDPWQVYTDCV  188

>PHYKE_6002
Length=197

 Score = 80.5 bits (197),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 14/127 (11%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---  115
            ++   F++  K+  +  L+  MDD   Y        +CG+T+ +G  QPIP++ + T   
Sbjct  61   QSVTTFDSLKKANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSR  114

Query  116  GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAAC-KGSC-TLRWYWMGIRFLKGK  173
               H GPCE+WLD+TK  S  NC      +T  + Y++C  G C  +R+YW+  + L  K
Sbjct  115  AMQHVGPCEIWLDSTKAFSKDNCAD---METFPVDYSSCNSGGCKEMRYYWLAFQGLDSK  171

Query  174  HSWQVYK  180
              WQ Y+
Sbjct  172  TVWQSYR  178

>SPRG_07796
Length=322

 Score = 82.8 bits (203),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 76/177 (43%), Gaps = 25/177 (14%)

Query  25   ADAHQLVILPNPTFTVPTKDER-----WSPLAFLENQGYK-----TTADFNAYYKSKGYK  74
            AD H  +I P PTF     D             L    Y       T  F   +K+  ++
Sbjct  16   ADGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQFTTQFKASPFR  75

Query  75   SLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR----TTGY--THDGPCEVWLD  128
            +L AF+D +            CG TN  GA QP+P+  +      G+  +H+GPCEVW D
Sbjct  76   TLAAFVDSQNVASCG-----RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWCD  130

Query  129  NTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +T+V    NC  +      ++    C G+  LR  W+ +       SWQVY  CVPL
Sbjct  131  STRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLALH----TPSWQVYINCVPL  183

>PITG_04948
Length=232

 Score = 81.3 bits (199),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 18/128 (14%)

Query  70   SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEV  125
            S   K +R  +D D   Y        +CGYTN + + +  P +   T   G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLKGKHSWQ  177
            WLD+  VL   +C   +   T         + Y++C  G C LR+YW+ ++ L GK  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQ  186

Query  178  VYKECVPL  185
            VYK C+PL
Sbjct  187  VYKNCIPL  194

>PYU1_G005872
Length=297

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 68/139 (49%), Gaps = 25/139 (18%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP----ANFRT  114
            + T  F A +   GYKSL+  MD  KA          CGY+N N A   +       F+ 
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMD--KAVPG-------CGYSNPNAAPVDVSKMSAMKFQN  116

Query  115  TGY------THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMG  166
              Y      +H GPCE W+DNT+V    +C   FPG   T  MSY +CKG+C L +YW+ 
Sbjct  117  NEYKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLA  176

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   K    WQ YK CV +
Sbjct  177  LHSPK----WQAYKSCVAI  191

>PHYCA_123316
Length=316

 Score = 82.8 bits (203),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 75/173 (43%), Gaps = 25/173 (14%)

Query  33   LPNPTFTVPTKDERWSPLAFLENQGY-----------KTTADFNAYYKSKGYKSLRAFMD  81
            L  P  T P   ++   +A +E+                T  F A + S  Y S++ F+ 
Sbjct  27   LGQPVVTFPNDVDKTQFIATIESSASWFSGSFSGSPAANTEAFWAAFNSSKYSSIKDFVT  86

Query  82   DKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTGYT--HDGPCEVWLDNTKVLS  134
            DK     N  A  ECG T+ N   Q +PA        T G+T  H+GPCE W D+T+V  
Sbjct  87   DKGQIVAN-GATIECGLTDPNETPQSLPAELEWTHSDTEGFTSSHEGPCEAWCDDTQVFQ  145

Query  135  GSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             +NC   F      M Y  A C GS  L +YW+ +       +WQ+Y  C  L
Sbjct  146  DTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH----SSTWQIYVNCAAL  194

>PHALS_03176
Length=207

 Score = 80.5 bits (197),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/181 (29%), Positives = 80/181 (44%), Gaps = 26/181 (14%)

Query  23   SVADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKS  75
            S  D H  +++P   F        +   D  W    +  N   K+   F     +  +K 
Sbjct  19   SNTDGHGYMLIPQAQFKGSANSAWIVQIDPLWKSSDWNGNT-QKSVKTFQKLKAANKFKD  77

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKV  132
            L+  MD        S    +CG+++  G  QPIP + + T      H GPCE+WLDN KV
Sbjct  78   LKTLMD-------TSAFGAKCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWLDNKKV  130

Query  133  LSGSNCHKDFPG------KTHAMSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVP  184
            L   +C+  +            + Y++C  G C  +R+YW+  + + GK  WQ YK C+P
Sbjct  131  LYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSYKNCIP  190

Query  185  L  185
            L
Sbjct  191  L  191

>PYU1_G005871
Length=284

 Score = 82.0 bits (201),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 67/139 (48%), Gaps = 25/139 (18%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP----ANFRT  114
            + T  F A +   GYKSL+  MD          A   CGY+N N A   +       F+ 
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMD---------KAVPGCGYSNPNAAPVDVSKMSAMKFQN  116

Query  115  TGY------THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMG  166
              Y      +H GPCE W+DNT+V    +C   FPG   T  MSY +CKG+C L +YW+ 
Sbjct  117  NEYKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLA  176

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   K    WQ YK CV +
Sbjct  177  LHSPK----WQAYKSCVAI  191

>PYAP_19707
Length=241

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query  92   ADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148
            A  +CG T+ N   QPIP +   T      H GPCEVWLDNTKV S   C K+FP K   
Sbjct  65   AGSKCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEFPNKRIK  124

Query  149  MSYAACK-GSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            + +A CK GSC LRW WM          W+ +  CV
Sbjct  125  VDFAKCKSGSCQLRWVWMATH----TSPWEFFDNCV  156

>PYU1_G007364
Length=316

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 67/133 (50%), Gaps = 25/133 (19%)

Query  66   AYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT--------GY  117
            A+  S  Y SLR  +              +CG T  +   +PIP++   +        G+
Sbjct  82   AFQASGKYASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEGF  132

Query  118  --THDGPCEVWLDNTKVLSGSNCHKDFPGKTHAM--SYAACKGSCTLRWYWMGIRFLKGK  173
              +H GPCE+WLD+T VL   NC   FPG    M   +++C G C +R+YW+ ++    +
Sbjct  133  VPSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----E  188

Query  174  HSWQVYKECVPLG  186
             +WQ+YK C+PL 
Sbjct  189  PAWQIYKNCIPLA  201

>PPTG_07521
Length=281

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 56/106 (53%), Gaps = 19/106 (18%)

Query  95   ECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG---  144
            ECG+T  +G RQPIP++           G+TH GPCE++LD+  VL G NC  ++PG   
Sbjct  85   ECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDV  144

Query  145  -----KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                     + Y++C   CTL  YW+  +      +WQ Y  CVPL
Sbjct  145  GSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAYINCVPL  186

>PHYRA_79140
Length=424

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 58/105 (55%), Gaps = 19/105 (18%)

Query  96   CGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG----  144
            CG T+ + + QPIP++ +         G+TH GPCE++LD+T VL   NC  D+PG    
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  --KTHAM--SYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +T  M   Y++C G CTL  YW+  +  +    WQ Y  CVPL
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPL  186

>PYU1_G001526
Length=334

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 63/123 (51%), Gaps = 16/123 (13%)

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCE  124
            YKS+RA +D K  ++   N   ECG T+  G +QP+PA +       + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            VW DN    S  NC  ++P     + +  + C G   L++YW+ +       +WQ Y  C
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  183  VPL  185
             PL
Sbjct  197  APL  199

>PYVX_19277
Length=331

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRT  114
            TA F   + +  Y SLR F++D     V S+    CGYTN N   Q +P      A+  T
Sbjct  66   TASFTKAFDASTYTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTST  124

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D T+V    +C  ++      + Y   AC GS  L +YW+ +   
Sbjct  125  EGFTSSHEGPCEVWCDETRVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALH--  182

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C  L
Sbjct  183  --SSTWQVYINCAAL  195

>PHALS_03179
Length=372

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 91/180 (51%), Gaps = 23/180 (13%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKS--KGYKSLRA--  78
            S  ++H  V++P   F     +E W     ++      ++D+N   +   K Y+SL+A  
Sbjct  59   SSIESHGYVLIPQTQFKGLPGNEAW----IVQIDPLWKSSDWNGNTEQSVKAYQSLKAAN  114

Query  79   -FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLS  134
             F D K   + ++    ECG+++  G  QPIP + + T      H GPCE+WLDN KVL 
Sbjct  115  NFKDLKTLMETHA-LGPECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMWLDNKKVLY  173

Query  135  GSNCHKDFPGKTHA-------MSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +C+  + G   A       + Y++C  G C  +R+YW+  + +KG   WQ YK C+PL
Sbjct  174  EDDCYAKY-GNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQSYKNCIPL  232

>PYIR_24743
Length=357

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 87/183 (48%), Gaps = 33/183 (18%)

Query  23   SVADAHQLVILPNPTF---TVPTKDERWSPLAFLENQGYKTTADFNAYYKS----KGYKS  75
            S+ DAH  V  P   F    +PTK       AF         A+ + + K+      +K+
Sbjct  30   SMVDAHGYVSSPLAEFKDGVMPTKYTATMSPAFQGKFNDNPQANVDTFTKAFQGQSEFKT  89

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT--------GY--THDGPCEV  125
            LR  + D  A         +CG +  + +R+ IP + +          G+  +H GPCE+
Sbjct  90   LRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEI  140

Query  126  WLDNTKVLSGSNCHKDFPGKTHA---MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            WLD+ +V S  NC   F  K  A   + +++CK +C LR+YW+ +     + +WQVYK C
Sbjct  141  WLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLALH----EPTWQVYKNC  196

Query  183  VPL  185
            VPL
Sbjct  197  VPL  199

>PYIR_26867
Length=163

 Score = 78.2 bits (191),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 74/151 (49%), Gaps = 17/151 (11%)

Query  37   TFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFEC  96
            T   PT     S ++F  +    T A F A  K+  YKS+RA +D K  +   S A+ +C
Sbjct  20   TMNGPTTLTAPSGMSFTTDPASNTKA-FTAALKASTYKSVRALVDAKGQFI--SGANKQC  76

Query  97   GYTNKNGARQPIPANF------RTTGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148
            G T+  G +QP+PA +       T G+T  H GPCEVW D+    S  NC  ++P     
Sbjct  77   GVTSPTGDKQPLPAQYVEWAHSSTEGFTPSHQGPCEVWCDDKMAFSDENCATNYPTAPAK  136

Query  149  MSY--AACKGSCTLRWYWMGIRFLKGKHSWQ  177
            + Y  + C G+  L+ YW+ +       +WQ
Sbjct  137  LPYDKSKCTGASMLKIYWLALH----SSTWQ  163

>PYU1_G001519
Length=265

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 80/187 (43%), Gaps = 36/187 (19%)

Query  23   SVADAHQLVILPNPT-------------------FTVPTKDERWSPLAFLENQGYKTTAD  63
            + ADAH  + LP PT                    TVP        ++F  +    T A 
Sbjct  17   ATADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAG------MSFGTDPLSNTNAY  70

Query  64   FNAYYKSKGYKSLRAF-MDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY--THD  120
              A+     YKSL+   M D  A KV S A  ECG+++ NG  QP+P   +   +  +H 
Sbjct  71   LKAFKAQTKYKSLKDLAMSD--AQKVESGATKECGFSDVNGTPQPLPDTVQWDRFDNSHM  128

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQV  178
            GPCEVW D+  V    NC  + P     + Y  A C G   L  +W+ +       +WQ+
Sbjct  129  GPCEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHV----PTWQI  184

Query  179  YKECVPL  185
            Y  C P+
Sbjct  185  YTNCAPI  191

>CCA17179
Length=185

 Score = 78.6 bits (192),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 27/139 (19%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-----  115
            TA F   + S  +++LR F+ DK  Y         CG TN N   +PIPA+         
Sbjct  34   TATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWENPD  84

Query  116  ---GY--THDGPCEVWLDNTKVLSGSNCHKDF---PGKTHAMSYAACKGSCTLRWYWMGI  167
               G+  +H GPCEVWL+  +V    NC + F   P +   + ++ C   C L+++W+ +
Sbjct  85   TKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARI-PIDFSTCTNGCLLQFFWLAL  143

Query  168  RFLKGKHSWQVYKECVPLG  186
                 +  WQVYK C+P+ 
Sbjct  144  H----EPQWQVYKNCIPIA  158

>SDRG_16535
Length=313

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 77/177 (44%), Gaps = 25/177 (14%)

Query  25   ADAHQLVILPNPTFTVPTKDER-----WSPLAFLENQGYK-----TTADFNAYYKSKGYK  74
             + H  +I P PTF     D             L    Y       T  F   +++  ++
Sbjct  15   VNGHGFLINPTPTFNELNGDRTKYCGTIDGPVVLPGSSYNQDPAWNTRQFTMQFRASKFQ  74

Query  75   SLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR----TTGY--THDGPCEVWLD  128
            +L +F+DD       +     CG TN NGA QP+P+  +      G+  +H+GPCEVW D
Sbjct  75   TLASFVDDPSFAPCGT-----CGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWCD  129

Query  129  NTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +T+V    NC  +      ++    C G+  LR  W+ +       SWQVY  CVPL
Sbjct  130  STRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLALH----TPSWQVYINCVPL  182

>PHYSO_484051
Length=285

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 66/133 (50%), Gaps = 26/133 (20%)

Query  69   KSKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTTG-------YTHD  120
            +S GY  +R  +D D   Y        +CG+TN + +    P +  TTG         H 
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDAS----PKDPPTTGDPTFSRCMVHA  123

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTHA-------MSYAACKGS-CTLRWYWMGIRFLKG  172
             PCE+WLD+T VLS  +C   +   T         + Y++C  S C LR+YW+  + +  
Sbjct  124  SPCEIWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  173  KHSWQVYKECVPL  185
            K  WQVYK+CVPL
Sbjct  184  KMVWQVYKDCVPL  196

>PYU1_G005873
Length=214

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 67/139 (48%), Gaps = 25/139 (18%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP----ANFRT  114
            + T  F A +   GYKSL+  MD          A   CGY+  + A   +       F+ 
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMD---------KAVPGCGYSRTDIAPVDVSRMSSMKFQN  116

Query  115  TGY------THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMG  166
              Y      +H GPCE W+DNT+V    +C   FPG   T  MS+ ACKG+C L +YW+ 
Sbjct  117  NEYKEGFLASHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLA  176

Query  167  IRFLKGKHSWQVYKECVPL  185
            +   K    WQ YK CVP+
Sbjct  177  LHSPK----WQAYKSCVPI  191

>PHYCA_112615
Length=196

 Score = 79.0 bits (193),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 79/168 (47%), Gaps = 29/168 (17%)

Query  26   DAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRA  78
            DAH  +++P   F        +   D  W+   +  N+     A F A   +  +K L+ 
Sbjct  22   DAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVDA-FKALKTANNFKDLKT  80

Query  79   FMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSG  135
             MDD   Y        +CG+T+ NG  QPIP++ + T      H GPCE+WLD+TK    
Sbjct  81   LMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWLDDTK----  130

Query  136  SNCHKDFPGKTHAMSYAAC-KGSC-TLRWYWMGIRFLKGKHSWQVYKE  181
             +    FP     + Y++C  G C  +R+YW+  + + GK  WQ Y E
Sbjct  131  -DIKSIFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYIE  172

>PHYKE_6079
Length=302

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 66/135 (49%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA F   + S  Y SL+  ++D     V ++A   CG  + +   QP+P  +       +
Sbjct  67   TAAFTTAFDSSKYTSLKELINDLATITV-TDATLTCGSCDPDETAQPLPETYVEWSHSSS  125

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G+T  H+GPCEVW D+ +V    +C  D+      + Y   AC G+ TL +YW+ +   
Sbjct  126  EGFTSSHEGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH--  183

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  184  --SSTWQVYVNCAPL  196

>H310_05432
Length=301

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 82/177 (46%), Gaps = 28/177 (16%)

Query  27   AHQLVILPNPTF--TVPTKDERWSPL---AFLENQGYKTTADFNA-----YYKSKGYKSL  76
            +H +++ P PT    VP K      +     L  + Y  + ++N       +K   + SL
Sbjct  20   SHGILVDPKPTIRDGVPDKTNYCGTIDGYKALPGEKYDDSPEYNTNAFVRQFKKSSFTSL  79

Query  77   RAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN------FRTTGY--THDGPCEVWLD  128
            +A +  +           ECG T  +G  QP+P +          GY  +H+GPCEVW D
Sbjct  80   KALVHSQP------TTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCD  133

Query  129  NTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
             T+V S  NC ++ P     ++ AACKG+  L + W+ +       SWQVY  CVPL
Sbjct  134  ATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAMH----TSSWQVYINCVPL  186

>H257_11264
Length=282

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 80/181 (44%), Gaps = 36/181 (20%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAF---------LENQGYK-----TTADFNAYYKSKG  72
            AH  ++ P PTF  P  D    P  +         L  + Y       T +F    K   
Sbjct  23   AHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSS  78

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR------TTGY--THDGPCE  124
            + SLRAF+D         N   ECG T  +G  + +P++ +      + G+  +H+GPCE
Sbjct  79   FASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            +W D T+V    NC ++ P     ++ + C+GS  L   W+ +        WQVYK CV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALH----TSQWQVYKNCVR  188

Query  185  L  185
            L
Sbjct  189  L  189

>PPTG_07516
Length=294

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 66/144 (46%), Gaps = 27/144 (19%)

Query  57   GYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-  115
            G      F A  K KG       +D  K        D +CG T +NG  QPIPA+ +   
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK--------DQKCGNTLENGDPQPIPADGKVKW  104

Query  116  ------GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA--------MSYAACKGSCTLR  161
                  G+TH GPCE++LD+  VL G +C  +F G  +         + +++C G C L 
Sbjct  105  HGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLT  164

Query  162  WYWMGIRFLKGKHSWQVYKECVPL  185
             YW+  +  +    WQ Y  CVPL
Sbjct  165  IYWLAFQNAQ----WQTYVNCVPL  184

>PPTG_04619
Length=276

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 18/128 (14%)

Query  70   SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEV  125
            S   K +R  +D D   Y        +CGYTN +   +  P +   T   G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEI  126

Query  126  WLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLKGKHSWQ  177
            WLD+  VL   +C   +   T         + Y++C  G C  R+YW+ ++ L GK  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQ  186

Query  178  VYKECVPL  185
            VYK C+PL
Sbjct  187  VYKNCIPL  194

>PYAP_22462
Length=210

 Score = 79.0 bits (193),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 83/181 (46%), Gaps = 26/181 (14%)

Query  26   DAHQLVILPNPTFTVPTKDERWSPL----AFLENQGYK-------TTADFNAYYKSKGYK  74
            DAH  + LP  ++        ++ +    A+   QG+K        T  F   +++ G+ 
Sbjct  28   DAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGFS  87

Query  75   SLRAFMDDKKAYKVNSNADFE----CGYTNKNGARQPIPANFRTTGYTHDGPCEVWLDNT  130
            SLRA +D       NS  D       G +            F T+   H GPCE W+DNT
Sbjct  88   SLRALLDPAAPGCGNSRTDVAPVDVSGLSVMQFQNDEEGKGFITS---HHGPCEAWIDNT  144

Query  131  KVLSGSNCHKDFPG--KTHAMSYAACKG--SCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
            +V  G +C   F G   T  ++YAAC    +C L +YW+ +     + +WQVYK+CVP+ 
Sbjct  145  RVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLALH----EANWQVYKQCVPIK  200

Query  187  R  187
            R
Sbjct  201  R  201

>PPTG_07520
Length=294

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 66/144 (46%), Gaps = 27/144 (19%)

Query  57   GYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT-  115
            G      F A  K KG       +D  K        D +CG T +NG  QPIPA+ +   
Sbjct  53   GGDQIGKFKAMAKEKGMSVKDVVLDMVK--------DQKCGNTLENGDPQPIPADGKVKW  104

Query  116  ------GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA--------MSYAACKGSCTLR  161
                  G+TH GPCE++LD+  VL G +C  +F G  +         + +++C G C L 
Sbjct  105  HGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLT  164

Query  162  WYWMGIRFLKGKHSWQVYKECVPL  185
             YW+  +  +    WQ Y  CVPL
Sbjct  165  IYWLAFQNAQ----WQTYVNCVPL  184

>PHYSO_246481
Length=318

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 67/135 (50%), Gaps = 15/135 (11%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RT  114
            TA F   +++  Y SL+  ++DK    V ++A   CG  + +   QP+P  +       T
Sbjct  67   TAAFTKAFEASSYTSLKELINDKATITV-TDATLTCGSCDPDETAQPLPDTYVEWSHSST  125

Query  115  TGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFL  170
             G++  H GPCEVW D+ +V    +C  D+      + Y   AC G+ TL +YW+ +   
Sbjct  126  EGFSSSHAGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  183

Query  171  KGKHSWQVYKECVPL  185
                +WQVY  C PL
Sbjct  184  --SSTWQVYINCAPL  196

>PITG_19818
Length=147

 Score = 77.4 bits (189),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)

Query  24  VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            ADAHQ+V+LP P +T   KD +++PLAFLENQG+K   DF A+    GYKSLR FMD  
Sbjct  22  TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81

Query  84  KAYK  87
             ++
Sbjct  82  NLFR  85

>PHYRA_78161
Length=373

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (46%), Gaps = 27/186 (15%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFN--------AYYKSKG--  72
            +V + H  +  P  TFT    D     +A +E+     T  FN        A+ K+ G  
Sbjct  16   TVVNGHGYMTDPKVTFTAQAGDPTQY-IATIESTASGLTGTFNGAPSDNVAAFTKAFGSS  74

Query  73   -YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIP------ANFRTTGYT--HDGPC  123
             Y SL+ F++DK    V + A   CG  +     QP+P      ++  + G+T  H+GPC
Sbjct  75   KYSSLKEFINDKATVTV-TGATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGPC  133

Query  124  EVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKE  181
            EVW D+ +     +C  ++P     + +   AC GS TL +YWM +       +WQVY  
Sbjct  134  EVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH----SSTWQVYVN  189

Query  182  CVPLGR  187
            C PL  
Sbjct  190  CAPLAS  195

>PPTG_03153
Length=314

 Score = 80.5 bits (197),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 63/133 (47%), Gaps = 14/133 (11%)

Query  62   ADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTG  116
            A F   ++S  YKSL+A +DDK A  +   A   CG  +     QP+PA        + G
Sbjct  64   AAFTKAFESSKYKSLKAVIDDK-AKIIVPGATLTCGIADPKATPQPLPAKVEWYHSESEG  122

Query  117  YT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKG  172
            +T  H+GPCEVW D  +V    NC   +      + Y  + C G+  L  YW+ +     
Sbjct  123  FTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMH----  178

Query  173  KHSWQVYKECVPL  185
              SWQVY  C PL
Sbjct  179  GPSWQVYVNCAPL  191

>PYVX_16138
Length=559

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 85/197 (43%), Gaps = 39/197 (20%)

Query  21   CDSVADAHQLVILPNPTFT-------VPTKDERWSPLAFLENQGYKTTADFNAYYKSKGY  73
            C S    H  +++P   F+       +   D +W    +  N    +   + +  + KG 
Sbjct  18   CVSRVQGHGYMLIPESQFSGTATSSWIVQIDPQWESDGWNGNS-QDSVDTYVSLAEEKGV  76

Query  74   KSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNT  130
              +R+ +DD   Y  +      CGYT+ +G  Q IP +   T   G  H GPCE+WLD+T
Sbjct  77   TQIRSLLDDTSIYGAD------CGYTDPDGTAQDIPTDSTATFSRGMVHVGPCEIWLDDT  130

Query  131  KVLSGSNCHKDFPGKTHA------MSYAAC--KGSCTLRWYWMGIRFLKGKHSWQVY---  179
             VL   +C+  + G          + Y++C   G   +R+YW+  + +  +  WQVY   
Sbjct  131  MVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETVWQVYSVM  190

Query  180  -----------KECVPL  185
                       ++C+PL
Sbjct  191  SAQLTAMRDFTEDCIPL  207

>PHYRA_73583
Length=630

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 63/128 (49%), Gaps = 18/128 (14%)

Query  70   SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEV  125
            S   K +R  +D D   Y  N      CGYTN + + +  P+    T   G  H GPCE+
Sbjct  73   SNNAKDIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEI  126

Query  126  WLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLKGKHSWQ  177
            WLD+  VL   +C   +   T         + Y++C  G C  R+YW+ ++ L GK  WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQ  186

Query  178  VYKECVPL  185
            VYK C+PL
Sbjct  187  VYKNCIPL  194

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 61/128 (48%), Gaps = 18/128 (14%)

Query  70   SKGYKSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEV  125
            S   K +R  +D D K Y  +      CG+T+     +  P+    T   G  H GPCEV
Sbjct  374  SNNIKDIRTMIDSDTKLYGAD------CGFTDPKATPKDPPSTGDATFSRGMVHAGPCEV  427

Query  126  WLDNTKVLSGSNCHKDFPGKTHA-------MSYAAC-KGSCTLRWYWMGIRFLKGKHSWQ  177
            WLD+  VL   +C   +   T A       + Y++C  G C  R++W+ ++    K  WQ
Sbjct  428  WLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQ  487

Query  178  VYKECVPL  185
            VYK CVPL
Sbjct  488  VYKNCVPL  495

>PPTG_18166
Length=445

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 85/183 (46%), Gaps = 35/183 (19%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLEN-----QGYKTTADFNAYYKSKGYKSLR  77
            S ADAH  +  P P +   + +  W  +  ++N      G      F    K KG     
Sbjct  17   SRADAHGYLKQPEPDWKD-SPNPGW--ITMVDNYWDIGSGGDQVGKFKTMAKEKGMSVKD  73

Query  78   AFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN-------FRTTGYTHDGPCEVWLDNT  130
              +D  K        D +CG T +NG+ +PIP++        R  G+TH GPCE++LD+ 
Sbjct  74   VVLDMVK--------DQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDK  125

Query  131  KVLSGSNCHKDFPGKTHA--------MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
             VL G +C +++PG +          + +++C G CTL  YW+  +  +    WQ Y  C
Sbjct  126  MVLHGDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ----WQTYVNC  181

Query  183  VPL  185
            VPL
Sbjct  182  VPL  184

>PHYKE_3913
Length=321

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 60/124 (48%), Gaps = 18/124 (15%)

Query  74   KSLRAFMD-DKKAYKVNSNADFECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDN  129
            K +R   D D   Y  N      CG+TN +   +  P +   T   G  H GPCE+WLD+
Sbjct  104  KDIRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDD  157

Query  130  TKVLSGSNCHKDFPGKTHA-------MSYAACK-GSCTLRWYWMGIRFLKGKHSWQVYKE  181
              VL   +C   +   T         + Y++C  G C  R+YWM ++ L GK  WQVYK 
Sbjct  158  KMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKN  217

Query  182  CVPL  185
            CVPL
Sbjct  218  CVPL  221

>PYU1_G001520
Length=379

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 78/180 (43%), Gaps = 29/180 (16%)

Query  28   HQLVILPNPTFTVPTKDERW------------SPLAFLENQGYKTTADFNAYYKSKGYKS  75
            H  + +P PTF +     ++            S ++F  +    T A F A  K+  YKS
Sbjct  27   HGSMSVPKPTFAIQGDTTQFGLTVDSTALTAPSGMSFTTDPESNTKA-FTAALKASSYKS  85

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCEVWL  127
            ++  +  K      +N   ECG T   G +QP+P  F         G+T  H GPCEVW 
Sbjct  86   VKDLIAAKGVPIAGANK--ECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVWC  143

Query  128  DNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            DNT V S  NC K++P     + Y  + C G   L+  W+ +       +WQ Y  C  L
Sbjct  144  DNTLVFSDDNCAKNYPAAPAQLPYEKSKCVGKSVLKTVWLALH----SPTWQAYISCAAL  199

>PHYKE_7717
Length=568

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 0/44 (0%)

Query  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            FPGK + + Y+ACKG+CTLRWYW+G+RFLK  +SWQVYK C+PL
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  45

>PITG_11942
Length=271

 Score = 79.3 bits (194),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 78/159 (49%), Gaps = 17/159 (11%)

Query  31   VILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNS  90
            +I P+    VP      S +++  + G  T A + A+  SK YKSL+    D +  K+  
Sbjct  46   IIDPSDVLPVP------SGMSYTTDPGSNTKAYWTAFNASK-YKSLKELSWDSQ--KLEG  96

Query  91   NADFECGYTNKNGARQPIPANFRTTGYT--HDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148
            +A  ECG++  +G  + +P   +   +T  H GPCEVW D+T V    NC  D+P     
Sbjct  97   SASNECGFSLVDGTPRDLPDEVQWDFFTASHQGPCEVWCDDTLVFENWNCAVDYPETPAN  156

Query  149  MSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            + Y  A CKG+  L  YW+ +        WQVY  C PL
Sbjct  157  LPYDKAKCKGAAMLTSYWIALHTTP----WQVYTNCAPL  191

>SPRG_07826
Length=371

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 85/179 (47%), Gaps = 28/179 (16%)

Query  27   AHQLVILPNPTFTVPTKDE-----------RWSPLAFLENQGYKTTADFNAYYKSKGYKS  75
            AH  +  P PTF  P  D                 A+ ++ GY   A F A +K+  YK+
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNA-AQFAANFKTSKYKT  77

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGAR-QPIPANFR-----TTGYT--HDGPCEVWL  127
            L+AF+D   A+  ++    +CG T  + A  QP+P+  +       G+T  H+GPCE+W 
Sbjct  78   LKAFLD---AWDTSAQCG-QCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWC  133

Query  128  DNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
            D T+V    +C K+ P  +  +  + C G+  L   WM +   +    WQ YK CV +G
Sbjct  134  DETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCVAIG  188

>PHYKE_10295
Length=292

 Score = 79.7 bits (195),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 68/139 (49%), Gaps = 25/139 (18%)

Query  59   KTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPA--------  110
            K TA F + +    +K+LRA MD             +CG T   G+   + A        
Sbjct  61   KNTATFTSSFPKSQFKTLRALMDTVAP---------DCGNTALTGSPVDVSALSSMKWQN  111

Query  111  NFRTTGY--THDGPCEVWLDNTKVLSGSNCHKDFPG--KTHAMSYAACKGSCTLRWYWMG  166
            +    G+  +H GPCE W+D+T+V+   +C  D+P       + Y++C G CT  +YWM 
Sbjct  112  DQEQKGFIDSHHGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMA  171

Query  167  IRFLKGKHSWQVYKECVPL  185
            +     + +WQVYK+C P+
Sbjct  172  LH----EPNWQVYKQCAPI  186

>PHYRA_83500
Length=394

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 57/105 (54%), Gaps = 19/105 (18%)

Query  96   CGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG----  144
            CG T+ + + QPIP++ +         G+TH GPCE++LD+T VL   NC  D+PG    
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  --KTHAM--SYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              +T  M   Y++C G CTL  YW+  +  +    WQ Y  C PL
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPL  186

>PYAR_18165
Length=261

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 9/97 (9%)

Query  95   ECGYTNKNGARQPIPANFRTT---GYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY  151
            +CG TN N A QP P++          H GPCE+WLD+TKV+S ++C K FP K   + +
Sbjct  68   KCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLDDTKVVSATDCWKQFPDKRIPVDF  127

Query  152  AAC--KGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
            + C  K SC LRW WM          W+ Y  CV +G
Sbjct  128  SKCANKASCELRWIWMATH----TSPWEFYDNCVRVG  160

>PYIR_19612
Length=260

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 74/139 (53%), Gaps = 22/139 (16%)

Query  58   YKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR---T  114
            +K   +F    K KG+ +LR++++DK A          CG+T+ N A + IPA+ +   +
Sbjct  57   WKDPKNFATAAKEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFS  107

Query  115  TGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA--MSYAACKGSCTLRWYWMGIRFLKG  172
               +H GPCE+W+D+ +V    +C   F G   +  + +A C G C +R+YW+ ++    
Sbjct  108  RDISHPGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGT  167

Query  173  KHSWQVYKE------CVPL  185
            +  WQVY+       CVP+
Sbjct  168  R--WQVYRSELTRDLCVPV  184

>PHYRA_83494
Length=224

 Score = 78.2 bits (191),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 19/108 (18%)

Query  93   DFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGSNCHKDFPG-  144
            D +CG T+ + A Q +P + +         G+TH GPCE+++D+  VL G NC  D+PG 
Sbjct  20   DKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGG  79

Query  145  -------KTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
                       + Y++C G CT   YW+  +  +    WQ Y  CVPL
Sbjct  80   DVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPL  123

>PYIW_24287
Length=325

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 83/183 (45%), Gaps = 29/183 (16%)

Query  26   DAHQLVILPNPTFTV---PTK--DERWSPLAFLENQGYKTTAD-------FNAYYKSKG-  72
            + H  + +P  TF +   PT+     + P       G   + D       F+  +K++  
Sbjct  23   EGHGYLSVPKATFAINGDPTQFCATMFGPSTLTAPAGKSFSGDPSSNALAFSTAFKAQTK  82

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANF------RTTGYT--HDGPCE  124
            Y SL+A +D     K  S A  ECG T+  GA+QP+PA +         G+T  H GPCE
Sbjct  83   YASLKALIDANG--KFISGASKECGVTSATGAKQPLPATYVEWAHSNEEGFTPSHQGPCE  140

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
            VW D     S  NC K++      + Y  + C G+  L++YW+ +       +WQ Y  C
Sbjct  141  VWCDGKVAFSNDNCPKNYATAPAKLPYDKSKCTGASMLKFYWLALH----SDTWQAYIAC  196

Query  183  VPL  185
             PL
Sbjct  197  APL  199

>H257_11265
Length=282

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 79/181 (44%), Gaps = 36/181 (20%)

Query  27   AHQLVILPNPTFTVPTKDERWSPLAF---------LENQGYK-----TTADFNAYYKSKG  72
            AH  ++ P PTF  P  D    P  +         L  + Y       T  F    K   
Sbjct  23   AHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSS  78

Query  73   YKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR------TTGY--THDGPCE  124
            + SLRAF+D         N   ECG T  +G  + +P++ +      + G+  +H+GPCE
Sbjct  79   FASLRAFID------AQGNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCE  132

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVP  184
            +W D T+V    NC ++ P     ++ + C+GS  L   W+ +        WQVYK CV 
Sbjct  133  LWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALH----TSQWQVYKNCVR  188

Query  185  L  185
            L
Sbjct  189  L  189

>SPRG_07825
Length=337

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 85/179 (47%), Gaps = 28/179 (16%)

Query  27   AHQLVILPNPTFTVPTKDE-----------RWSPLAFLENQGYKTTADFNAYYKSKGYKS  75
            AH  +  P PTF  P  D                 A+ ++ GY   A F A +K+  YK+
Sbjct  19   AHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNA-AQFAANFKTSKYKT  77

Query  76   LRAFMDDKKAYKVNSNADFECGYTNKNGAR-QPIPANFR-----TTGYT--HDGPCEVWL  127
            L+AF+D   A+  ++    +CG T  + A  QP+P+  +       G+T  H+GPCE+W 
Sbjct  78   LKAFLD---AWDTSAQCG-QCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPCELWC  133

Query  128  DNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPLG  186
            D T+V    +C K+ P  +  +  + C G+  L   WM +   +    WQ YK CV +G
Sbjct  134  DETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNCVAIG  188

>PHYSO_318683
Length=352

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 83/183 (45%), Gaps = 27/183 (15%)

Query  23   SVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGY-----------KTTADFNAYYKSK  71
            S  +AH  + LP  TF  P   ++   +A +E+              + TA F   + S 
Sbjct  14   SNVNAHGYLGLPAVTF--PNDVDKTQFIATIESSASGFSGSFSGSPAENTAAFWTAFNSS  71

Query  72   GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFR-----TTGYT--HDGPCE  124
             Y S++ F+ D      N  A+ ECG T+ +   QP+P         T G+T  H+GPCE
Sbjct  72   QYSSIKEFVTDLGQIVAN-GANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGPCE  130

Query  125  VWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYKEC  182
             W DNT+V   ++C   +      M Y  A C G+  L +YW+ +       +WQVY +C
Sbjct  131  AWCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYVDC  186

Query  183  VPL  185
              L
Sbjct  187  AAL  189

>PYAP_18221
Length=226

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 85/189 (45%), Gaps = 44/189 (23%)

Query  25   ADAHQLVILPNPTFTVPTK---------DERWSPLAFLENQGY-----KTTADFNAYYKS  70
            A+AH  +  P P F VP K           + + +A  + + +     + T  F   +K 
Sbjct  20   AEAHGYISNPRPDF-VPGKMYTDFNAEFTAQQTGIAAFQGKPFNRSPEQNTQVFTDAFKQ  78

Query  71   KGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY-----------TH  119
             G KSLR  MD              CG TN N   + +    +T  Y           +H
Sbjct  79   SGLKSLRELMDKYVP---------GCGNTNPNTTPRDV-TKLKTMTYQNNEYKEGFLNSH  128

Query  120  DGPCEVWLDNTKVLSGSNC---HKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSW  176
             GPCEVW+DNT+V   ++C   +K +P     + Y+ CKG+C L +YW+ +   K    W
Sbjct  129  HGPCEVWIDNTRVFQNNDCAANYKSYPAAL-PVDYSKCKGTCRLTFYWLALHSQK----W  183

Query  177  QVYKECVPL  185
            Q YK+CVP+
Sbjct  184  QAYKQCVPI  192

>PYIW_25573
Length=279

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 73/156 (47%), Gaps = 11/156 (7%)

Query  34   PNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNSNAD  93
            P+ T   P+  +  S ++F  +    T A F A  K+  Y SL+A     +  K  S A 
Sbjct  44   PSGTIDGPSALKAPSGMSFSTDPTSNTKA-FTAALKASSYGSLKALAFATQ--KTESGAS  100

Query  94   FECGYTNKNGARQPIP--ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSY  151
             ECG++   GA QP+P    +     +H+GPCEVW DNT    G NC K +      + Y
Sbjct  101  KECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAFHGDNCAKTYTSSPAKLPY  160

Query  152  --AACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
              + C G+  L   W+ +       +WQVY  C P+
Sbjct  161  DKSKCSGAKMLMSIWLALH----TPTWQVYTNCAPI  192

>PHYRA_80631
Length=320

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 9/124 (7%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTN-KNGARQPIPANFRT-TGYTHDG  121
            F A +  KGY SL AF+  K     +S  D +CG T  K+ AR  +PA+  T +G+TH G
Sbjct  70   FKATFPDKGYDSLGAFIA-KNQELYSSKTDPDCGLTVYKDSARSELPASKLTYSGFTHTG  128

Query  122  PCEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVY  179
            PCEVW D+TKVL   +C   +P     + Y  + C  +  L  YW+G+        WQVY
Sbjct  129  PCEVWCDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLH----GDPWQVY  184

Query  180  KECV  183
             +CV
Sbjct  185  TDCV  188

>PYU1_G005866
Length=194

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 69/131 (53%), Gaps = 11/131 (8%)

Query  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPANFRTTGY--T  118
            T  F A +K  GY SL+  +D K     NS  DF    T K         ++   G+  +
Sbjct  68   TKTFTAAFKKSGYTSLKQMLDKKVPGCQNSRTDFTPIKT-KTYKTMEWQNDWEHKGFIDS  126

Query  119  HDGPCEVWLDNTKVLSGSNC---HKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHS  175
            H GPCE+WL+NT+VL   +C   +  +P     ++Y+ CKG+C L +YW+ +     + +
Sbjct  127  HHGPCEIWLNNTRVLHNDDCVATYTTYPA-VLPVNYSVCKGNCILTFYWLALH----EPN  181

Query  176  WQVYKECVPLG  186
            WQ+YK CVP+ 
Sbjct  182  WQIYKHCVPVN  192

>PHYCA_123476
Length=301

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 85/185 (46%), Gaps = 33/185 (18%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLEN---------QGYK------TTADFNAYYK  69
            ADAH  + LP PT+    +D   SP   ++           GY+      T A + A+  
Sbjct  19   ADAHSKMSLPKPTWVY--EDGTNSPAGTIDGASVLPAPTGMGYEGDPLSNTKAYWTAFNA  76

Query  70   SKGYKSLRAFMDDKKAYKVNS---NADFECGYTNKNGARQPIPANFR----TTGYTHDGP  122
            SK Y SL+  +   +    +S    A  ECGY+  NG  + +P   +    TTG  HDGP
Sbjct  77   SK-YTSLKELVWKNEVVNTDSLYGTATIECGYSWTNGTARDLPDEVQWDKLTTG--HDGP  133

Query  123  CEVWLDNTKVLSGSNCHKDFPGKTHAMSY--AACKGSCTLRWYWMGIRFLKGKHSWQVYK  180
            CE+W D+T V S  NC  ++P    +  Y  AAC+G   L   W+ +        WQV+ 
Sbjct  134  CEIWCDDTLVFSDQNCAVNYPDSPASFPYDKAACEGKSMLTTIWLALH----SPPWQVFT  189

Query  181  ECVPL  185
             C PL
Sbjct  190  NCAPL  194

>PHYSO_426658
Length=210

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 64/136 (47%), Gaps = 12/136 (9%)

Query  59   KTTADFNAYYKSKGYKSLRAFM---DDKKAYKVNSNADFECGYTNK-NGARQPIPANFR-  113
            K TA F+   K+  YKSL+ FM    D    + N     ECG+T+  +GA QP+P     
Sbjct  67   KNTAAFDRALKASQYKSLKEFMYSTQDMTKGRFNLPKTAECGFTDPVDGAVQPLPDQVEW  126

Query  114  -TTGYTHDGPCEVWLDNTKVLSGS-NCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLK  171
               G  HDGPCE+W D+   +  + NC   +P        A C+G   L  YW+G     
Sbjct  127  YGGGMIHDGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYEKAKCEGKKRLTMYWLGTLL--  184

Query  172  GKHSWQVYKECVPLGR  187
                WQVY +C  +G 
Sbjct  185  ---EWQVYIDCAKIGE  197

>PYU1_G005867
Length=200

 Score = 77.0 bits (188),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 71/133 (53%), Gaps = 14/133 (11%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGARQPIPAN-FRTTGY--THD  120
            F A +K  GY SLR  +D K     NS  D      N  GA      N +   G+  +H 
Sbjct  71   FTAAFKKSGYTSLRQMLDKKVPGCQNSRTDITP--VNVKGATSMKWQNDWEHKGFIDSHH  128

Query  121  GPCEVWLDNTKVLSGSNC---HKDFPGKTHAMSYAACKGS-CTLRWYWMGIRFLKGKHSW  176
            GPCEVW+DNT+V   ++C   +K +P     ++YAACK S CTL +YW+ +     + +W
Sbjct  129  GPCEVWIDNTRVFHHNDCVAAYKTYPA-VLPINYAACKTSKCTLTFYWLALH----EPNW  183

Query  177  QVYKECVPLGRKR  189
            Q+YK CVP+   +
Sbjct  184  QIYKHCVPITNSK  196

>PHYKE_8104
Length=86

 Score = 73.9 bits (180),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)

Query  24  VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83
            ADAHQ+V+LP PT+T   KD +++PLAFLE +G+    DF A+ +  GYKSLR FMD+ 
Sbjct  24  TADAHQIVLLPEPTWTTNDKDTKYNPLAFLEGEGFTPQEDFKAWREENGYKSLRDFMDNA  83

Query  84  K  84
           K
Sbjct  84  K  84

>PHYRA_83499
Length=473

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 83/177 (47%), Gaps = 26/177 (15%)

Query  25   ADAHQLVILPNPTFTVPTKDERWSPLAFLENQ-GYKTTADFNAYYKSKGYKSLRAFMDDK  83
            ADAH  +  P  TF        W  +  ++N     +  D    YK+   +   +  D  
Sbjct  20   ADAHGNLKEPEATFEDGAPTVEW--VTLIDNYWDIGSGGDQVGKYKTMAAEKKMSVRD--  75

Query  84   KAYKVNSNADFECGYTNKNGARQPIPANFRTT-------GYTHDGPCEVWLDNTKVLSGS  136
                ++   D +CGYT  +   QPIP + +         G+TH GPCE+++D+T VL G 
Sbjct  76   --VVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGD  133

Query  137  NCHKDFPG---KTHAMS-----YAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185
            +C +++PG    ++ MS     Y++C G CTL  YW+  +  +    WQ Y  CV L
Sbjct  134  DCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSL  186

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 12/67 (18%)

Query  121  GPCEVWLDNTKVLSGSNCHKDFPGKTH--------AMSYAACKGSCTLRWYWMGIRFLKG  172
            GPCE++LD+T +L G NC  ++ G            + Y++C G+CTL  YW+G +    
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQ----  406

Query  173  KHSWQVY  179
               WQ Y
Sbjct  407  NEQWQAY  413

>SDRG_00972
Length=333

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 86/183 (47%), Gaps = 28/183 (15%)

Query  23   SVADAHQLVILPNPTFTVPTKDE-----------RWSPLAFLENQGYKTTADFNAYYKSK  71
            S   AH  +  P PTF  P  D                 A+ ++ GY   A F A +K+ 
Sbjct  14   SQVAAHGGLFDPKPTFIEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNA-AQFAANFKAS  72

Query  72   GYKSLRAFMDDKKAYKVNSNADFECGYTNKNGAR-QPIPANFR-----TTGYT--HDGPC  123
             YK+L+AF+D   A+  ++    +CG T  + A  QP+P+  +       G+T  H+GPC
Sbjct  73   KYKTLKAFLD---AWDTSAQCG-QCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGPC  128

Query  124  EVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECV  183
            E+W D T++    +C K+ P  +  +  + C G+  L   WM +   +    WQ YK CV
Sbjct  129  ELWCDETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTMLWMALHTPQ----WQAYKNCV  184

Query  184  PLG  186
             +G
Sbjct  185  AIG  187

>PYAP_16994
Length=264

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 7/125 (6%)

Query  64   FNAYYKSKGYKSLRAFMDDKKAYKVNSNADFECGYTNKNGA-RQPIPANFRTTGYTHDGP  122
            F A +    YKSL+  +  K+       +D ECG T K+ A R  +P+  + TG++H GP
Sbjct  70   FEANFPKSQYKSLKDLILAKQNVLTQYGSDAECGMTTKDEAKRAELPSTIKYTGFSHPGP  129

Query  123  CEVWLDNTKVLSGSNCHKDFPGKTHAMSYAA--CKGSCTLRWYWMGIRFLKGKHSWQVYK  180
            CEVW D TK+    +C K +  +   +   A  C G+  L  YW+G+        WQVY 
Sbjct  130  CEVWCDKTKLAYAVDCQKTYGSQDAKIPIDASKCAGADRLTLYWIGVH----GDPWQVYT  185

Query  181  ECVPL  185
             CV L
Sbjct  186  NCVYL  190

Lambda      K        H        a         alpha
   0.319    0.133    0.443    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9640586016

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40