Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0017399320326626611514e-160
PYU1_G001738534612261866613e-86
PYIR_26626147522121886048e-78
PYU1_G001740147522061645951e-76
PYIR_25089854042621885913e-75
PYIW_18788932032441675833e-74
PHYRA_85631109792281885762e-73
PYU1_G001741854041991865715e-73
PPTG_10636109792461885722e-72
PHYCA_14369109792481885703e-72
PPTG_10643457052501775687e-72
PYU1_G001742932042131635641e-71
PHYRA_82864231281931885611e-71
PPTG_10635528561991655602e-71
PHYRA_84190720132061655577e-71
PYVX_18173449665001635801e-70
PHYSO_341599109791851715522e-70
PYU1_G001744568762131635552e-70
PPTG_10634720132081875533e-70
PHYCA_102624720131951885523e-70
PPTG_15264231281941875515e-70
PPTG_17366239131941875515e-70
PPTG_17122147522041885491e-69
PYIW_18791854041941655444e-69
PHYSO_536424606911971645438e-69
PHYSO_507031586531971645438e-69
PHYCA_129425147522041905431e-68
PHYCA_102550457052681885491e-68
PHYCA_102852242061951885402e-68
PHALS_00498109791991885377e-68
PPTG_17123147532011605325e-67
PHYKE_3446231281991885282e-66
PHYKE_8389147522041885272e-66
PHYRA_81105534612011595264e-66
PHYCA_537323449662001595255e-66
PHYKE_7718109792201795275e-66
PHYSO_284086147522041655246e-66
PHYKE_8388568762051885221e-65
PHYRA_81107568762021855152e-64
PPTG_10048213141901875132e-64
PYAP_22273932032681845202e-64
PHYSO_477820568762021855134e-64
PITG_18452147538561625482e-63
PITG_18450147522031884994e-62
PHYRA_81106147522021654994e-62
PPTG_17121568762021854961e-61
PHYCA_511409568762041854961e-61
PHALS_03284309411881764942e-61
PHYSO_353401534611461394753e-59
HYAP_07096534612511634834e-59
PPTG_0882086622501934783e-58
PYIR_26546866052391774763e-58
PYAR_24096932032271654693e-57
PYVX_18176568762011664673e-57
PYAP_22278932042891694711e-56
PHYSO_499978231281741754418e-54
PHYSO_501575820771741754418e-54
PYAP_22279854042231654442e-53
PYVX_18174854042041894395e-53
PITG_13520109791711574244e-51
PHYCA_510817445761881854202e-50
PITG_1049986623231634287e-50
PPTG_14255469372681864221e-49
PPTG_14254445761881884123e-49
PHYSO_417649445761851854054e-48
PHYKE_9185445762811894125e-48
PHYSO_262732469371881864046e-48
PHYCA_53693413059831804324e-47
PHYSO_343376532371721383843e-45
PHYSO_254168462841701863697e-43
PHYSO_527908600641741723636e-42
PHYSO_341596528562311363591e-40
PHYCA_14368528562191883302e-36
PHYSO_342364529831941903063e-33
PHYSO_340369526762001882942e-31
PHYKE_839053461130972864e-31
PYIW_18792932041251232847e-31
PYAP_18131991722261142902e-30
PHYSO_246676457051871712741e-28
PHYCA_12727044782791782741e-27
PYIR_1643542333041882742e-27
PYU1_G007476539131951352629e-27
PITG_0527144782781852671e-26
PHYSO_533903604652081802602e-26
PHYSO_438103557212381792598e-26
PHYKE_600144782891782611e-25
PHYSO_34033244782951782602e-25
PHYRA_74651699693442022612e-25
PHYSO_340333526712841782583e-25
PHYRA_7868968382961782583e-25
PHYKE_6002526711971742497e-25
PYU1_G005323943552511332537e-25
PYVX_14662510865401922638e-25
PYIW_27477823991801232479e-25
PHALS_03177526712591982521e-24
PPTG_04622696962731302522e-24
PHALS_0317644782071982472e-24
PYIR_1644442341821882443e-24
PPTG_1422144782751782494e-24
PYAP_18709943552351322474e-24
PHYSO_533682604462781302494e-24
PHYCA_534473423310501342585e-24
PYIR_16443823992751262485e-24
PHYCA_534296526713091722497e-24
PYAP_18711943562101312439e-24
PHYRA_7358442332872032471e-23
PYIW_19151831912481952441e-23
PPTG_04647194343271302463e-23
PHYKE_10578778802391892413e-23
PHYSO_533747604512061742384e-23
PHYCA_13036542352662002415e-23
PYVX_16138786195591852496e-23
PHYRA_73606571983661952456e-23
PHYRA_73607194343431342448e-23
PHYCA_12942213313531722431e-22
PPTG_0313997753201932411e-22
PHYSO_48395542353201962411e-22
PHYRA_83499204334731862452e-22
PHYRA_86752732363001862382e-22
PYAR_14256943551991292322e-22
PHYSO_48552442342782062372e-22
PYU1_G01469042342951302373e-22
PHYCA_69583463492242102334e-22
PHYKE_2937571983661302394e-22
PYAP_246891014392521352335e-22
H310_0636217301971422305e-22
PHYRA_86016727462361062319e-22
PHYKE_1913732362801882339e-22
PITG_0494842342321242291e-21
PPTG_0461942342762022311e-21
PITG_0494942353371312342e-21
PPTG_07509718142991932322e-21
PYIR_23585845342401842273e-21
PHYCA_97965401872882022303e-21
PHYRA_78175764333191912304e-21
PYU1_G005324845341911832234e-21
PYU1_G005326463491911832234e-21
PYU1_G00532842331911832234e-21
PPTG_0750738072991932295e-21
PHYCA_98479819502761062285e-21
PHYRA_86241728921951922227e-21
PHYRA_7358242353261932297e-21
PYIR_2213497753001842278e-21
PHYCA_531163194343141302288e-21
PHYSO_484051571982851342269e-21
PYU1_G005325943562071802211e-20
PHALS_03179308833721982291e-20
PHYSO_255056463492691922241e-20
PPTG_0461842353261312271e-20
PYAP_1871342341841332191e-20
PITG_1193697753331952272e-20
PHYKE_6076764332721942242e-20
PHYSO_24648197753181992262e-20
PYIW_242891643031961912192e-20
H257_1355017302661522232e-20
PYAR_206171040482541802222e-20
PHYRA_85794726192301892212e-20
PHYSO_459106194342231322202e-20
PHYRA_77971705552301892202e-20
PHYRA_7914038074241072283e-20
PYU1_G007364851643161902243e-20
PHYCA_112615308831961722173e-20
PITG_0820268381911872174e-20
PHYSO_524101597733081832234e-20
PHYKE_2809752822911242224e-20
PHYCA_12943369712871982206e-20
PHYKE_2454751493741962246e-20
SDRG_081371363342821972207e-20
PHYRA_78161375713731992237e-20
PITG_0494742332981312207e-20
PYAP_18138991732681842198e-20
PYAR_14260845342121302168e-20
PHYRA_83494464352241072151e-19
PHYRA_78174188562791972181e-19
PHYRA_83500718143941072221e-19
PHYRA_73581696932932062181e-19
PHYRA_78625541464341672231e-19
PHYCA_1961197755311832232e-19
SDRG_075651244122781442172e-19
PHYRA_78626578954731672232e-19
PPTG_0462042333421322192e-19
PHYRA_7358342346301242232e-19
PYIW_1552617302561422152e-19
PYU1_G001517839893111952182e-19
PPTG_03138188562941962163e-19
PHYKE_391342343211242173e-19
PHYRA_78176597733121382173e-19
PYIW_21963839893261982164e-19
PHYRA_8075044782751742144e-19
PHYKE_607897753172012164e-19
SDRG_081291363312181972115e-19
PYIR_24743851643571472175e-19
PYAR_2481897821981982095e-19
PYAR_18165995792611792127e-19
PPTG_07521450302811902128e-19
PHYSO_324715696932741832111e-18
PHALS_0539242353671252141e-18
PYU1_G00152797792781272102e-18
PYU1_G00152397762781272102e-18
PHYCA_1865738072951892102e-18
PHYRA_93650463492311802072e-18
PYIW_2196497752652052082e-18
PHYCA_19598375713901942122e-18
PHYCA_19612188566101862143e-18
PHYKE_6079597733022002093e-18
PYAP_18221944962262042054e-18
PYVX_2129779880263952065e-18
PHALS_0539442342881972075e-18
PYU1_G001528861322742092066e-18
PYIR_19612831912601232056e-18
PHYKE_6077188563221922077e-18
PPTG_18166242064451932107e-18
PHYKE_574938073001962068e-18
PYU1_G00152697803341272061e-17
PYU1_G00151997822651892041e-17
SDRG_17317161731221081941e-17
PPTG_0752038142941822041e-17
PPTG_07516464352941822041e-17
SPRG_19916161733051542042e-17
PYU1_G005871944962841312032e-17
PYIR_14463819503691432052e-17
PYU1_G005872161732971312032e-17
CCA1717917291851441972e-17
PYIW_242871643013251972033e-17
PHYSO_26284417292761972013e-17
PYIR_25999861323442052033e-17
PYIW_242881643022012071973e-17
PHYKE_771752856568452063e-17
SPRG_199171339462411341984e-17
PYIR_16375823732621181985e-17
PYU1_G00152597813121882006e-17
PYU1_G001514188574692042036e-17
PHYRA_86751732351631011927e-17
PYAP_1970799579241951968e-17
PHYRA_7729317293021981989e-17
PHYCA_1047197823091921999e-17
PYAP_222571003612471391961e-16
PYU1_G001524930993001771972e-16
SPRG_046791244122261531932e-16
PHYSO_48892157461296731962e-16
PPTG_10073213311861871902e-16
H310_054321431863011941962e-16
PYVX_211747985295741832e-16
H257_112651431862821971942e-16
PPTG_04617696934961961983e-16
PHYKE_391242332521871933e-16
PHYSO_32929351032310731953e-16
PHYRA_7816297874782011983e-16
PYVX_19277793613311951953e-16
PHYCA_13225543468128981844e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001739

Length=266
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001739                                                          447        4e-160
PYU1_G001738                                                          259        3e-86 
PYIR_26626                                                            237        8e-78 
PYU1_G001740                                                          233        1e-76 
PYIR_25089                                                            232        3e-75 
PYIW_18788                                                            229        3e-74 
PHYRA_85631                                                           226        2e-73 
PYU1_G001741                                                          224        5e-73 
PPTG_10636                                                            224        2e-72 
PHYCA_14369                                                           224        3e-72 
PPTG_10643                                                            223        7e-72 
PYU1_G001742                                                          221        1e-71 
PHYRA_82864                                                           220        1e-71 
PPTG_10635                                                            220        2e-71 
PHYRA_84190                                                           219        7e-71 
PYVX_18173                                                            228        1e-70 
PHYSO_341599                                                          217        2e-70 
PYU1_G001744                                                          218        2e-70 
PPTG_10634                                                            217        3e-70 
PHYCA_102624                                                          217        3e-70 
PPTG_15264                                                            216        5e-70 
PPTG_17366                                                            216        5e-70 
PPTG_17122                                                            216        1e-69 
PYIW_18791                                                            214        4e-69 
PHYSO_536424                                                          213        8e-69 
PHYSO_507031                                                          213        8e-69 
PHYCA_129425                                                          213        1e-68 
PHYCA_102550                                                          216        1e-68 
PHYCA_102852                                                          212        2e-68 
PHALS_00498                                                           211        7e-68 
PPTG_17123                                                            209        5e-67 
PHYKE_3446                                                            207        2e-66 
PHYKE_8389                                                            207        2e-66 
PHYRA_81105                                                           207        4e-66 
PHYCA_537323                                                          206        5e-66 
PHYKE_7718                                                            207        5e-66 
PHYSO_284086                                                          206        6e-66 
PHYKE_8388                                                            205        1e-65 
PHYRA_81107                                                           202        2e-64 
PPTG_10048                                                            202        2e-64 
PYAP_22273                                                            204        2e-64 
PHYSO_477820                                                          202        4e-64 
PITG_18452                                                            215        2e-63 
PITG_18450                                                            196        4e-62 
PHYRA_81106                                                           196        4e-62 
PPTG_17121                                                            195        1e-61 
PHYCA_511409                                                          195        1e-61 
PHALS_03284                                                           194        2e-61 
PHYSO_353401                                                          187        3e-59 
HYAP_07096                                                            190        4e-59 
PPTG_08820                                                            188        3e-58 
PYIR_26546                                                            187        3e-58 
PYAR_24096                                                            185        3e-57 
PYVX_18176                                                            184        3e-57 
PYAP_22278                                                            186        1e-56 
PHYSO_499978                                                          174        8e-54 
PHYSO_501575                                                          174        8e-54 
PYAP_22279                                                            175        2e-53 
PYVX_18174                                                            173        5e-53 
PITG_13520                                                            167        4e-51 
PHYCA_510817                                                          166        2e-50 
PITG_10499                                                            169        7e-50 
PPTG_14255                                                            167        1e-49 
PPTG_14254                                                            163        3e-49 
PHYSO_417649                                                          160        4e-48 
PHYKE_9185                                                            163        5e-48 
PHYSO_262732                                                          160        6e-48 
PHYCA_536934                                                          171        4e-47 
PHYSO_343376                                                          152        3e-45 
PHYSO_254168                                                          146        7e-43 
PHYSO_527908                                                          144        6e-42 
PHYSO_341596                                                          142        1e-40 
PHYCA_14368                                                           131        2e-36 
PHYSO_342364                                                          122        3e-33 
PHYSO_340369                                                          117        2e-31 
PHYKE_8390                                                            114        4e-31 
PYIW_18792                                                            114        7e-31 
PYAP_18131                                                            116        2e-30 
PHYSO_246676                                                          110        1e-28 
PHYCA_127270                                                          110        1e-27 
PYIR_16435                                                            110        2e-27 
PYU1_G007476                                                          105        9e-27 
PITG_05271                                                            107        1e-26 
PHYSO_533903                                                          104        2e-26 
PHYSO_438103                                                          104        8e-26 
PHYKE_6001                                                            105        1e-25 
PHYSO_340332                                                          104        2e-25 
PHYRA_74651                                                           105        2e-25 
PHYSO_340333                                                          103        3e-25 
PHYRA_78689                                                           103        3e-25 
PHYKE_6002                                                            100        7e-25 
PYU1_G005323                                                          102        7e-25 
PYVX_14662                                                            105        8e-25 
PYIW_27477                                                            99.8       9e-25 
PHALS_03177                                                           101        1e-24 
PPTG_04622                                                            101        2e-24 
PHALS_03176                                                           99.8       2e-24 
PYIR_16444                                                            98.6       3e-24 
PPTG_14221                                                            100        4e-24 
PYAP_18709                                                            99.8       4e-24 
PHYSO_533682                                                          100        4e-24 
PHYCA_534473                                                          103        5e-24 
PYIR_16443                                                            100        5e-24 
PHYCA_534296                                                          100        7e-24 
PYAP_18711                                                            98.2       9e-24 
PHYRA_73584                                                           99.8       1e-23 
PYIW_19151                                                            98.6       1e-23 
PPTG_04647                                                            99.4       3e-23 
PHYKE_10578                                                           97.4       3e-23 
PHYSO_533747                                                          96.3       4e-23 
PHYCA_130365                                                          97.4       5e-23 
PYVX_16138                                                            100        6e-23 
PHYRA_73606                                                           99.0       6e-23 
PHYRA_73607                                                           98.6       8e-23 
PHYCA_12942                                                           98.2       1e-22 
PPTG_03139                                                            97.4       1e-22 
PHYSO_483955                                                          97.4       1e-22 
PHYRA_83499                                                           99.0       2e-22 
PHYRA_86752                                                           96.3       2e-22 
PYAR_14256                                                            94.0       2e-22 
PHYSO_485524                                                          95.9       2e-22 
PYU1_G014690                                                          95.9       3e-22 
PHYCA_69583                                                           94.4       4e-22 
PHYKE_2937                                                            96.7       4e-22 
PYAP_24689                                                            94.4       5e-22 
H310_06362                                                            93.2       5e-22 
PHYRA_86016                                                           93.6       9e-22 
PHYKE_1913                                                            94.4       9e-22 
PITG_04948                                                            92.8       1e-21 
PPTG_04619                                                            93.6       1e-21 
PITG_04949                                                            94.7       2e-21 
PPTG_07509                                                            94.0       2e-21 
PYIR_23585                                                            92.0       3e-21 
PHYCA_97965                                                           93.2       3e-21 
PHYRA_78175                                                           93.2       4e-21 
PYU1_G005324                                                          90.5       4e-21 
PYU1_G005326                                                          90.5       4e-21 
PYU1_G005328                                                          90.5       4e-21 
PPTG_07507                                                            92.8       5e-21 
PHYCA_98479                                                           92.4       5e-21 
PHYRA_86241                                                           90.1       7e-21 
PHYRA_73582                                                           92.8       7e-21 
PYIR_22134                                                            92.0       8e-21 
PHYCA_531163                                                          92.4       8e-21 
PHYSO_484051                                                          91.7       9e-21 
PYU1_G005325                                                          89.7       1e-20 
PHALS_03179                                                           92.8       1e-20 
PHYSO_255056                                                          90.9       1e-20 
PPTG_04618                                                            92.0       1e-20 
PYAP_18713                                                            89.0       1e-20 
PITG_11936                                                            92.0       2e-20 
PHYKE_6076                                                            90.9       2e-20 
PHYSO_246481                                                          91.7       2e-20 
PYIW_24289                                                            89.0       2e-20 
H257_13550                                                            90.5       2e-20 
PYAR_20617                                                            90.1       2e-20 
PHYRA_85794                                                           89.7       2e-20 
PHYSO_459106                                                          89.4       2e-20 
PHYRA_77971                                                           89.4       2e-20 
PHYRA_79140                                                           92.4       3e-20 
PYU1_G007364                                                          90.9       3e-20 
PHYCA_112615                                                          88.2       3e-20 
PITG_08202                                                            88.2       4e-20 
PHYSO_524101                                                          90.5       4e-20 
PHYKE_2809                                                            90.1       4e-20 
PHYCA_12943                                                           89.4       6e-20 
PHYKE_2454                                                            90.9       6e-20 
SDRG_08137                                                            89.4       7e-20 
PHYRA_78161                                                           90.5       7e-20 
PITG_04947                                                            89.4       7e-20 
PYAP_18138                                                            89.0       8e-20 
PYAR_14260                                                            87.8       8e-20 
PHYRA_83494                                                           87.4       1e-19 
PHYRA_78174                                                           88.6       1e-19 
PHYRA_83500                                                           90.1       1e-19 
PHYRA_73581                                                           88.6       1e-19 
PHYRA_78625                                                           90.5       1e-19 
PHYCA_19611                                                           90.5       2e-19 
SDRG_07565                                                            88.2       2e-19 
PHYRA_78626                                                           90.5       2e-19 
PPTG_04620                                                            89.0       2e-19 
PHYRA_73583                                                           90.5       2e-19 
PYIW_15526                                                            87.4       2e-19 
PYU1_G001517                                                          88.6       2e-19 
PPTG_03138                                                            87.8       3e-19 
PHYKE_3913                                                            88.2       3e-19 
PHYRA_78176                                                           88.2       3e-19 
PYIW_21963                                                            87.8       4e-19 
PHYRA_80750                                                           87.0       4e-19 
PHYKE_6078                                                            87.8       4e-19 
SDRG_08129                                                            85.9       5e-19 
PYIR_24743                                                            88.2       5e-19 
PYAR_24818                                                            85.1       5e-19 
PYAR_18165                                                            86.3       7e-19 
PPTG_07521                                                            86.3       8e-19 
PHYSO_324715                                                          85.9       1e-18 
PHALS_05392                                                           87.0       1e-18 
PYU1_G001527                                                          85.5       2e-18 
PYU1_G001523                                                          85.5       2e-18 
PHYCA_18657                                                           85.5       2e-18 
PHYRA_93650                                                           84.3       2e-18 
PYIW_21964                                                            84.7       2e-18 
PHYCA_19598                                                           86.3       2e-18 
PHYCA_19612                                                           87.0       3e-18 
PHYKE_6079                                                            85.1       3e-18 
PYAP_18221                                                            83.6       4e-18 
PYVX_21297                                                            84.0       5e-18 
PHALS_05394                                                           84.3       5e-18 
PYU1_G001528                                                          84.0       6e-18 
PYIR_19612                                                            83.6       6e-18 
PHYKE_6077                                                            84.3       7e-18 
PPTG_18166                                                            85.5       7e-18 
PHYKE_5749                                                            84.0       8e-18 
PYU1_G001526                                                          84.0       1e-17 
PYU1_G001519                                                          83.2       1e-17 
SDRG_17317                                                            79.3       1e-17 
PPTG_07520                                                            83.2       1e-17 
PPTG_07516                                                            83.2       1e-17 
SPRG_19916                                                            83.2       2e-17 
PYU1_G005871                                                          82.8       2e-17 
PYIR_14463                                                            83.6       2e-17 
PYU1_G005872                                                          82.8       2e-17 
CCA17179                                                              80.5       2e-17 
PYIW_24287                                                            82.8       3e-17 
PHYSO_262844                                                          82.0       3e-17 
PYIR_25999                                                            82.8       3e-17 
PYIW_24288                                                            80.5       3e-17 
PHYKE_7717                                                            84.0       3e-17 
SPRG_19917                                                            80.9       4e-17 
PYIR_16375                                                            80.9       5e-17 
PYU1_G001525                                                          81.6       6e-17 
PYU1_G001514                                                          82.8       6e-17 
PHYRA_86751                                                           78.6       7e-17 
PYAP_19707                                                            80.1       8e-17 
PHYRA_77293                                                           80.9       9e-17 
PHYCA_10471                                                           81.3       9e-17 
PYAP_22257                                                            80.1       1e-16 
PYU1_G001524                                                          80.5       2e-16 
SPRG_04679                                                            79.0       2e-16 
PHYSO_488921                                                          80.1       2e-16 
PPTG_10073                                                            77.8       2e-16 
H310_05432                                                            80.1       2e-16 
PYVX_21174                                                            75.1       2e-16 
H257_11265                                                            79.3       2e-16 
PPTG_04617                                                            80.9       3e-16 
PHYKE_3912                                                            79.0       3e-16 
PHYSO_329293                                                          79.7       3e-16 
PHYRA_78162                                                           80.9       3e-16 
PYVX_19277                                                            79.7       3e-16 
PHYCA_132255                                                          75.5       4e-16 
SPRG_22161                                                            79.3       4e-16 
PHYCA_103479                                                          79.3       4e-16 
CCI47381                                                              77.4       4e-16 
PHYRA_84947                                                           78.6       5e-16 
PHYCA_120062                                                          77.4       5e-16 
SDRG_17318                                                            78.2       5e-16 
PPTG_03160                                                            79.7       5e-16 
PHYKE_10295                                                           78.6       5e-16 
H257_11264                                                            78.6       6e-16 
SDRG_15426                                                            80.1       6e-16 
PYU1_G005985                                                          76.6       7e-16 
PYIR_20481                                                            78.2       7e-16 
PYIW_18065                                                            78.6       7e-16 
PHYSO_374518                                                          74.3       1e-15 
PHYSO_525076                                                          79.0       1e-15 
PYAR_15391                                                            75.9       1e-15 
PYAP_19712                                                            77.8       1e-15 
PYIR_16437                                                            77.8       1e-15 
PHALS_04411                                                           77.4       1e-15 
PPTG_03143                                                            78.6       1e-15 
PHYSO_426658                                                          76.3       1e-15 
PHALS_10635                                                           77.4       1e-15 
PHYRA_78177                                                           77.8       1e-15 
PYIR_22136                                                            77.8       1e-15 
PYIW_16810                                                            75.9       2e-15 
PYU1_G001475                                                          77.0       2e-15 
PHYCA_122958                                                          76.6       2e-15 
PYU1_G005868                                                          76.6       2e-15 
PHYCA_14560                                                           76.6       3e-15 
PYAP_24691                                                            73.6       3e-15 
PHYKE_7445                                                            77.4       3e-15 
PYVX_20783                                                            76.3       3e-15 
PYIW_25573                                                            76.3       4e-15 
PHYCA_12944                                                           73.9       5e-15 
PHYCA_562062                                                          75.1       5e-15 
HYAP_01683                                                            76.3       5e-15 
PYVX_22510                                                            77.4       5e-15 
PYAP_16338                                                            75.5       6e-15 
PITG_08892                                                            75.9       6e-15 
PHYSO_318693                                                          77.0       6e-15 
SDRG_08782                                                            77.0       6e-15 
PHYSO_255975                                                          73.9       6e-15 
PPTG_06256                                                            75.9       7e-15 
PYIR_24421                                                            74.3       7e-15 
PYAR_25093                                                            73.9       7e-15 
PHYRA_77290                                                           75.9       7e-15 
PPTG_04803                                                            75.1       7e-15 
PYVX_20789                                                            75.5       7e-15 
PHYCA_123476                                                          75.5       8e-15 
PYVX_24563                                                            75.1       8e-15 
PYU1_G005866                                                          73.6       8e-15 
PHYCA_123316                                                          75.5       8e-15 
SPRG_07627                                                            76.6       9e-15 
PYIW_18790                                                            70.5       9e-15 
PYIR_15187                                                            73.9       9e-15 
PYAP_18584                                                            73.9       9e-15 
PPTG_01153                                                            75.5       1e-14 
PYIR_20483                                                            74.7       1e-14 
PYIR_26867                                                            72.4       1e-14 
PYU1_G005867                                                          73.2       1e-14 
PPTG_01148                                                            74.7       2e-14 
PPTG_04801                                                            74.3       2e-14 
PYAR_16493                                                            73.9       2e-14 
PYAP_18226                                                            73.6       2e-14 
PYVX_18175                                                            71.6       2e-14 
PHYKE_10296                                                           75.5       2e-14 
PYVX_18179                                                            71.2       2e-14 
PYIR_25334                                                            73.9       2e-14 
PYU1_G005869                                                          73.2       3e-14 
PYIW_25463                                                            72.4       3e-14 
PYU1_G006404                                                          73.2       4e-14 
PHYSO_375794                                                          70.1       4e-14 
PHYRA_78165                                                           73.6       4e-14 
PYIR_20482                                                            70.9       4e-14 
PPTG_03153                                                            73.6       4e-14 
PPTG_20376                                                            71.2       5e-14 
PHYRA_84732                                                           72.8       5e-14 
PYIR_22549                                                            72.4       5e-14 
PHYCA_6388                                                            73.2       5e-14 
PHYSO_256017                                                          70.1       6e-14 
PHYSO_488139                                                          72.4       7e-14 
PYIR_22634                                                            72.4       7e-14 
PHYSO_476077                                                          72.4       8e-14 
PHYSO_472009                                                          72.4       8e-14 
PYAR_17163                                                            68.9       8e-14 
PHALS_06480                                                           70.1       8e-14 
PHYCA_18729                                                           73.2       9e-14 
PHYCA_15124                                                           72.4       9e-14 
PHYRA_78169                                                           73.2       9e-14 
PYAR_17166                                                            68.6       9e-14 
PYAP_22462                                                            71.2       9e-14 
SDRG_17448                                                            72.0       9e-14 
HYAP_11923                                                            73.6       1e-13 
PITG_01966                                                            72.8       1e-13 
PPTG_03145                                                            72.4       1e-13 
PPTG_18176                                                            72.0       1e-13 
PYU1_G001516                                                          72.4       1e-13 
PYVX_22508                                                            72.4       1e-13 
PPTG_03156                                                            72.8       1e-13 
PHYCA_15126                                                           72.4       1e-13 
PITG_11937                                                            72.0       2e-13 
SDRG_00972                                                            71.6       2e-13 
PHYKE_2379                                                            71.2       2e-13 
SPRG_07825                                                            71.6       2e-13 
PYU1_G001518                                                          71.6       3e-13 
PYAP_23672                                                            70.9       3e-13 
PYIW_16208                                                            70.5       3e-13 
SPRG_07795                                                            71.6       3e-13 
PYU1_G005873                                                          69.7       3e-13 
SDRG_00948                                                            71.6       3e-13 
SPRG_07826                                                            71.6       3e-13 
PHYSO_374025                                                          70.9       3e-13 
PYAR_21940                                                            70.5       3e-13 
PPTG_03161                                                            71.6       4e-13 
H257_11258                                                            71.2       4e-13 
PYAP_20456                                                            70.9       4e-13 
PHYCA_552912                                                          71.2       5e-13 
PYU1_G001520                                                          70.9       6e-13 
PHYRA_78167                                                           70.1       6e-13 
PHYRA_80631                                                           70.5       6e-13 
PYIW_18794                                                            69.3       6e-13 
PPTG_10186                                                            69.7       8e-13 
PYIR_24867                                                            70.1       8e-13 
PYIR_22133                                                            70.5       8e-13 
PHYRA_80632                                                           69.7       1e-12 
PHYRA_77291                                                           68.9       1e-12 
SDRG_16534                                                            69.7       1e-12 
HYAP_14170                                                            68.9       1e-12 
PHYRA_78172                                                           69.7       1e-12 
PYIW_15528                                                            69.3       1e-12 
SPRG_07797                                                            69.3       1e-12 
PHYSO_318683                                                          69.3       2e-12 
PPTG_06249                                                            68.9       2e-12 
PPTG_07511                                                            67.0       2e-12 
PPTG_06253                                                            68.9       2e-12 
PHYCA_15125                                                           68.9       2e-12 
H257_11271                                                            69.3       2e-12 
PHYKE_2539                                                            68.2       2e-12 
PYIR_17978                                                            67.8       3e-12 
PHYCA_19599                                                           68.9       3e-12 
PHYKE_9024                                                            68.2       3e-12 
PYU1_G006405                                                          68.2       3e-12 
PITG_20312                                                            67.8       3e-12 
PHYSO_337515                                                          68.2       3e-12 
PITG_20631                                                            67.8       3e-12 
PYAP_24338                                                            67.8       3e-12 
PITG_11957                                                            68.2       3e-12 
PPTG_03147                                                            67.8       3e-12 
SPRG_07799                                                            68.2       4e-12 
PYAR_21271                                                            67.0       4e-12 
PITG_19818                                                            65.1       4e-12 
H310_05438                                                            68.2       4e-12 
PPTG_06106                                                            67.4       5e-12 
PITG_11944                                                            67.4       6e-12 
PYU1_G006403                                                          66.6       6e-12 
PYAR_24113                                                            65.9       6e-12 
PYVX_21643                                                            67.0       6e-12 
PHYSO_454780                                                          65.5       7e-12 
PHALS_01293                                                           67.8       7e-12 
SPRG_07796                                                            67.4       7e-12 
PPTG_03148                                                            67.0       8e-12 
PYIW_23030                                                            66.2       8e-12 
PITG_11942                                                            66.6       9e-12 
H310_05433                                                            66.6       1e-11 
PHYSO_339832                                                          65.9       1e-11 
PHYRA_75781                                                           65.5       1e-11 
PHALS_02044                                                           65.5       1e-11 
PYVX_22511                                                            66.2       2e-11 
SDRG_16535                                                            66.2       2e-11 
PPTG_01147                                                            65.5       2e-11 
PPTG_03140                                                            66.2       2e-11 
PYAP_14265                                                            65.9       2e-11 
PYAP_16347                                                            63.9       2e-11 
PYVX_21438                                                            65.5       2e-11 
PHYCA_14559                                                           65.1       3e-11 
PYAP_16994                                                            65.1       3e-11 
PHALS_08575                                                           65.1       3e-11 
PPTG_01152                                                            64.7       4e-11 
PHYSO_525121                                                          63.9       4e-11 
PYIR_23689                                                            63.9       4e-11 
PITG_11943                                                            63.2       4e-11 
PYU1_G006672                                                          59.7       4e-11 
PYIW_19601                                                            64.3       4e-11 
PHYKE_8104                                                            60.8       4e-11 
PYVX_23997                                                            63.2       4e-11 
PITG_08895                                                            63.5       4e-11 
PHYRA_79881                                                           64.3       5e-11 
PITG_21641                                                            65.1       5e-11 
PHYCA_558591                                                          61.2       5e-11 
PHYKE_6069                                                            64.3       6e-11 
PYU1_G005862                                                          62.8       6e-11 
PYVX_16673                                                            65.1       8e-11 
PHYKE_7446                                                            64.3       9e-11 
PHYKE_9023                                                            63.5       9e-11 
PPTG_03144                                                            63.9       9e-11 
PYAP_23673                                                            63.9       1e-10 
PITG_01969                                                            63.2       1e-10 
PHYSO_342361                                                          60.8       2e-10 
PHYRA_78168                                                           62.4       3e-10 
PYAR_22058                                                            61.2       3e-10 
PITG_04404                                                            61.2       3e-10 
PYU1_G007250                                                          60.8       3e-10 
PPTG_13879                                                            62.4       4e-10 
PPTG_09880                                                            60.8       4e-10 
PYIW_17867                                                            62.4       4e-10 
PHALS_05110                                                           60.5       4e-10 
PYAP_16337                                                            61.2       5e-10 
PHALS_02037                                                           62.0       5e-10 
PHALS_02041                                                           61.2       6e-10 
PYIR_22135                                                            61.6       7e-10 
PYAR_15784                                                            59.7       7e-10 
PYAP_23455                                                            61.6       7e-10 
PYAR_14261                                                            58.9       7e-10 
PHALS_01460                                                           61.2       8e-10 
PYU1_G007242                                                          60.5       1e-09 
PYVX_21644                                                            59.7       1e-09 
PHALS_02296                                                           60.5       1e-09 
HYAP_01682                                                            60.8       1e-09 
PHYRA_86151                                                           58.9       1e-09 
PYU1_G005878                                                          56.2       1e-09 
PHYRA_87941                                                           58.5       1e-09 
PYIR_25571                                                            60.5       1e-09 
PYU1_G007254                                                          58.9       1e-09 
PHYRA_77292                                                           59.3       2e-09 
PHYCA_559281                                                          57.8       2e-09 
PHYKE_7443                                                            60.5       2e-09 
PYAR_22574                                                            56.2       2e-09 
PHYCA_19608                                                           59.7       2e-09 
PHYRA_86201                                                           59.7       2e-09 
PYAR_15390                                                            58.2       2e-09 
PYAR_23252                                                            58.9       3e-09 
PHYCA_538650                                                          59.7       3e-09 
PYAR_24939                                                            57.8       3e-09 
PYAR_17307                                                            58.5       3e-09 
PHYRA_95184                                                           60.1       4e-09 
PHYSO_525490                                                          59.3       4e-09 
H257_11306                                                            59.3       5e-09 
PYIR_24935                                                            58.5       5e-09 
PYIW_13243                                                            58.5       6e-09 
PHYRA_78164                                                           58.5       6e-09 
PHYCA_122138                                                          57.0       8e-09 
PHYKE_6066                                                            57.8       9e-09 
PHALS_05395                                                           56.6       1e-08 
PHYSO_489485                                                          55.8       1e-08 
PHYCA_97699                                                           57.4       1e-08 
PHYCA_10470                                                           57.8       1e-08 
PITG_11951                                                            55.8       1e-08 
PHYKE_6067                                                            57.4       2e-08 
PYIR_20850                                                            56.2       2e-08 
PHYSO_341657                                                          57.0       2e-08 

>PYU1_G001739
Length=266

 Score = 447 bits (1151),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%), Gaps = 0/266 (0%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60
            MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV
Sbjct  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60

Query  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120
            AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP
Sbjct  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120

Query  121  CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
            CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC
Sbjct  121  CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180

Query  181  VSLSDNasgsasastpatttkvpvkatktpapttetpaptsaDPVSSGSVGQEGSYDGGE  240
            VSLSDNASGSASASTPATTTKVPVKATKTPAPTTETPAPTSADPVSSGSVGQEGSYDGGE
Sbjct  181  VSLSDNASGSASASTPATTTKVPVKATKTPAPTTETPAPTSADPVSSGSVGQEGSYDGGE  240

Query  241  GSNDapaaastipptipKCSVKKSRN  266
            GSNDAPAAASTIPPTIPKCSVKKSRN
Sbjct  241  GSNDAPAAASTIPPTIPKCSVKKSRN  266

>PYU1_G001738
Length=226

 Score = 259 bits (661),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 143/186 (77%), Gaps = 2/186 (1%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60
            MAP F PT+A+  L A  V V A   +++PEPF+LVDG +AQ  P+A LE QG+ TSADV
Sbjct  1    MAPWFHPTVALALLSA--VAVHAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADV  58

Query  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120
            + FMKQKGYANLRA++DD+KLY VN DAL ECGYTDPT ESQPIP T    STGY  +GP
Sbjct  59   SDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118

Query  121  CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
            CEVWLDD+KVMS  NCH K+PG  F LDYSSCKGSC LRWYWLG++ + + YSWQ+YK C
Sbjct  119  CEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178

Query  181  VSLSDN  186
            VSL  N
Sbjct  179  VSLRGN  184

>PYIR_26626
Length=212

 Score = 237 bits (604),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 140/188 (74%), Gaps = 6/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVV----VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS + +LA+ A+ +++ +    VDAHQ +I P P F    K+  W PLAFLENQG  T
Sbjct  1    MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNT-DALFECGYTDPTYESQPIPTTGTIRSTGY  115
            +AD  G++K KGY  LRA MDD+K Y+V+   A FECGYT+   + QPIP  GTIRSTGY
Sbjct  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGY  119

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            THDGPCEVWLD+ KVMSG NC+  FPGKT  + Y+SCKGSCTLRWYW+G+R+LK ++SWQ
Sbjct  120  THDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQ  179

Query  176  IYKECVSL  183
            +YKECV +
Sbjct  180  VYKECVPI  187

>PYU1_G001740
Length=206

 Score = 233 bits (595),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 2/164 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
            V DAHQ++I P P F V  KD +W PLAFLENQG  T+AD   + K KGY +LRA MDD+
Sbjct  24   VADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDK  83

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            K Y+VN++A FECGYT+     QPIP     R+TGYTHDGPCEVWLD+ KV+SG NCH  
Sbjct  84   KAYKVNSNADFECGYTNKNGARQPIP--ANFRTTGYTHDGPCEVWLDNTKVLSGSNCHKD  141

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            FPGKT  + Y++CKGSCTLRWYW+G+R+LK ++SWQ+YKECV L
Sbjct  142  FPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PYIR_25089
Length=262

 Score = 232 bits (591),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 4/188 (2%)

Query  1    MAPSFLPTLAVTALGAASVV----VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MA S   +LA+ A+ +++ +    VDAHQ +I P P F V  +  Q+ PLAFLENQG  T
Sbjct  1    MASSVTKSLALAAIVSSAALYDTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
            +AD   + K KGY  LRA MDD+  Y+V   A FECG+T      QPIP+  T+RSTGYT
Sbjct  61   TADFDAYYKAKGYKTLRAFMDDKSAYKVADGADFECGWTKLAGTPQPIPSASTVRSTGYT  120

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD  +V+ G NCH +FPG TF +DYSSCKGSC LRWYW+G+R+LK +YSWQ+
Sbjct  121  HDGPCEVWLDKTRVLKGTNCHSEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQV  180

Query  177  YKECVSLS  184
            YK CV ++
Sbjct  181  YKNCVPVT  188

>PYIW_18788
Length=244

 Score = 229 bits (583),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 128/167 (77%), Gaps = 1/167 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
            VV A+  + +PEPFFL+DG       +A LE+Q V TSADVAGF+KQKGYA+LRA++DDE
Sbjct  23   VVVANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDE  82

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
             LY+VN D++FECGYTDPTYESQPIPT G +R TGY  DGPCE+W+DD+K++S  NC   
Sbjct  83   TLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKD  142

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGV-RYLKKRYSWQIYKECVSLSD  185
            FPG +  LDYSSCKG CTLRWY L V +     YSW++YK CV+LSD
Sbjct  143  FPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSD  189

>PHYRA_85631
Length=228

 Score = 226 bits (576),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 133/188 (71%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M    +PTLAV ++ ++  ++    DAHQ+++ PEP +  D KD ++ PLAFLEN+G  T
Sbjct  1    MVHPIVPTLAVASVLSSMALLAPTADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D A +  + GY +LR  MD+ K Y V   A F CG+TDP    QPIP    +RSTGYT
Sbjct  61   QEDFASWRDENGYKSLRDFMDNAK-YNVADGADFSCGFTDPKGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  V+ GDNCH+KFPGK + +DYSSCKG+CTLRWYWLG+R+LK  YSWQ+
Sbjct  120  HDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQV  179

Query  177  YKECVSLS  184
            YKEC+ L+
Sbjct  180  YKECIPLT  187

>PYU1_G001741
Length=199

 Score = 224 bits (571),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 128/186 (69%), Gaps = 4/186 (2%)

Query  1    MAPSFLPTLAVTALGAASVV---VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTS  57
            MAPS   +L   AL +++ +    DAHQ ++ P P F V  +  Q+ PLAFLENQG  T+
Sbjct  1    MAPSITKSLVFGALVSSATLYNTADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETT  60

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTH  117
            AD   + K KGY  LRA MDD+K Y V + A FECG+T      Q IP  GTIRSTGYTH
Sbjct  61   ADFNAYYKAKGYKTLRAFMDDKKAYTVASGADFECGWTKLDGTRQSIPA-GTIRSTGYTH  119

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            DGPCEVWLD  +VM G+NCH +F G T  +DYSSCKGSCTLRWYW+G+R+LK  YSWQ+Y
Sbjct  120  DGPCEVWLDSTRVMKGNNCHTEFTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVY  179

Query  178  KECVSL  183
            K CV +
Sbjct  180  KNCVPI  185

>PPTG_10636
Length=246

 Score = 224 bits (572),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 132/188 (70%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S +P LAV    +++   + + DAHQ+++ PEP +  + KD ++ PLAFLENQG  T
Sbjct  1    MVHSVVPALAVATTLSSMALLAPMADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  +  Y +LR  MD+ K YEV + A F CG+TDP    QPIP    +RSTGYT
Sbjct  61   QEDFLSWRNENNYKSLRDFMDNAK-YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  V+ G+NCH+KFPGK + +DYSSCKG+CTLRWYWLG+R+LK +YSWQ+
Sbjct  120  HDGPCEVWLDDTMVLDGENCHEKFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQV  179

Query  177  YKECVSLS  184
            YK C+ LS
Sbjct  180  YKACIPLS  187

>PHYCA_14369
Length=248

 Score = 224 bits (570),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 128/188 (68%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TLAV    +++   +   DAHQ+++ PEP +  + KD ++ PLAFLENQG  T
Sbjct  1    MVSSLVSTLAVVSTLSSIAFLAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY +LR  MD  K Y V   A F CG+TDP    QPIP    +RSTGYT
Sbjct  61   QQDFTAWRNENGYKSLRDFMDRAK-YTVTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  V+ GDNCH+KFPGK + +DYSSCKG+CTLRWYWLGVR+LK  YSWQ+
Sbjct  120  HDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQV  179

Query  177  YKECVSLS  184
            YK C+ L+
Sbjct  180  YKACIPLA  187

>PPTG_10643
Length=250

 Score = 223 bits (568),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 3/177 (2%)

Query  9    LAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQ  66
            +A T  G A V+   DAHQ+++ PEP +  + KD ++ PLAFLENQG     D A + K+
Sbjct  11   VAATLSGMALVLPTTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKE  70

Query  67   KGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLD  126
             GY +LR  MD  K YEV   A F CG+T+P    QPIP  G +RSTGYTHDGPCEV+LD
Sbjct  71   NGYKSLRDFMDRAK-YEVTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLD  129

Query  127  DVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            D  V+ GDNCH+KFPGK  P+DYSSCKG+CTLRWYWLG+R+LK  YSWQ+YKEC+ L
Sbjct  130  DTLVLQGDNCHEKFPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PYU1_G001742
Length=213

 Score = 221 bits (564),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 119/163 (73%), Gaps = 1/163 (1%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
             DAHQ ++ P P F V  +  Q+ PLAFLENQG  T+ D   + K KGY  LRA MDD K
Sbjct  25   ADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPK  84

Query  81   LYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF  140
             Y+V   A F+CG+T    + QPIP  GTIRSTGYTHDGPCEVWLD  +VM G+NCH +F
Sbjct  85   AYKVAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEF  143

Query  141  PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            PG TF +DYSSCKGSCTLRWYW+G+R+LK +YSWQ+YK CV +
Sbjct  144  PGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PHYRA_82864
Length=193

 Score = 220 bits (561),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 133/188 (71%), Gaps = 6/188 (3%)

Query  1    MAPSFLPTLAV-TALGAASVVV---DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S +PTLAV T L +A+++    DAHQ+++ PEP +  D KD ++ PLAFLE QG  T
Sbjct  1    MTLSLVPTLAVATGLASAALLAPTADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFAT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   + +  GY  LR  MD  K Y V   A + CG+TDP    QPIP  G +RSTGYT
Sbjct  61   QGDFNAWRRDNGYKTLRDFMDRAK-YTVTEGADYFCGWTDPNGTPQPIPA-GNMRSTGYT  118

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD+ +V+ GDNCH++FP K +P+DYSSCKG+CTL WYW+GVR+LK  YSWQ+
Sbjct  119  HDGPCEVWLDNTRVLQGDNCHEQFPDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQV  178

Query  177  YKECVSLS  184
            YKEC+SL+
Sbjct  179  YKECISLT  186

>PPTG_10635
Length=199

 Score = 220 bits (560),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 120/165 (73%), Gaps = 1/165 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
            + DAHQ+++ PEP +  + KD ++ PLAFLENQG  T  D   +  + GY +LR  MD  
Sbjct  7    MADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRA  66

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            K YEV + A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD  V+ GDNCH+K
Sbjct  67   K-YEVTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            FPGK + +DYSSCKGSCTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLT  170

>PHYRA_84190
Length=206

 Score = 219 bits (557),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 120/165 (73%), Gaps = 1/165 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
              DAHQ+++ PEP +  D KD ++ PLAFLEN+G  T  D   +  + GY +LR  MD+ 
Sbjct  7    TADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNA  66

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            K Y V   A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD  V+ G+NCH+K
Sbjct  67   K-YSVTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  125

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            FPGK + +DYSSCKG+CTLRWYW+GVR+LK+ YSWQ+YKEC+ L+
Sbjct  126  FPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLT  170

>PYVX_18173
Length=500

 Score = 228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 122/163 (75%), Gaps = 1/163 (1%)

Query  23   AHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLY  82
            AHQ++I P P + V+GKD +WKPLAFLE Q  +T+ D  G++   G+ +LRA MDD+ LY
Sbjct  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

Query  83   EVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG  142
             VN  A F CG+TDP    QPIP  G +RSTGYTHDGPCEVWLDD +V+  DNCH+   G
Sbjct  294  SVNASADFRCGFTDPDAAPQPIPD-GIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352

Query  143  KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSD  185
            KT+ LDYS+C GSCTL WYWLGVRYLK+ YSWQ+YK CV +SD
Sbjct  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPISD  395

 Score = 195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 117/160 (73%), Gaps = 0/160 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q++++P PFF+VDG D +  P+A+LE QGV+T+ +   ++ ++GYA LRALMDD+ LY V
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
              + LF+CG T P  E+QPIPT G+  ++GYT DGPCE+W+D+   ++G NCH +FP   
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
              +DYS C  SC + W+WLG++Y  +RYSWQ++K C++LS
Sbjct  158  HTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197

>PHYSO_341599
Length=185

 Score = 217 bits (552),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 122/171 (71%), Gaps = 1/171 (1%)

Query  14   LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLR  73
            +   +   DAHQ+++ PEP +  + K+ ++ PLAFLENQG  T  D   + K+ GY +LR
Sbjct  1    MAMLAPTADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLR  60

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSG  133
              MD  K Y+V + A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD  V+ G
Sbjct  61   DFMDRAK-YDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDG  119

Query  134  DNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            DNCH+KFPGK + +DYSSCKG+CTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  120  DNCHEKFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  170

>PYU1_G001744
Length=213

 Score = 218 bits (555),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 120/163 (74%), Gaps = 1/163 (1%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
             DAHQ ++ P P F V  +  Q+ PLAFLENQG  T+AD   + K KGY +LRA MDD+K
Sbjct  25   ADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKK  84

Query  81   LYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF  140
             Y+V   A F+CG+T    + QPIP  GTIRSTGYTHDGPCEVWLD+  VM G+NCH +F
Sbjct  85   AYKVAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEF  143

Query  141  PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            PG T  + Y+SCKGSCTLRWYW+G+R+LK +YSWQ+YK CV +
Sbjct  144  PGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PPTG_10634
Length=208

 Score = 217 bits (553),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (69%), Gaps = 5/187 (3%)

Query  1    MAPSFLPTLAVTA----LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TL V A    +   ++ VDAHQ+++ PEP +  + K+ ++ PLAFLEN+G  T
Sbjct  1    MVYSLVSTLGVAATLSSMALLALTVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   + K+ GY +LR  +D+ K Y V   A F+CG+TDP    QPIP    +RSTGYT
Sbjct  61   QEDFTAWRKENGYKSLRDFLDNAK-YPVTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  V+ GDNCH+KFPGK + +DYSSCKG+CTL WYWLGVR+LK  YSWQ+
Sbjct  120  HDGPCEVWLDDTMVLDGDNCHEKFPGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQV  179

Query  177  YKECVSL  183
            YK C+ L
Sbjct  180  YKACIPL  186

>PHYCA_102624
Length=195

 Score = 217 bits (552),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 127/188 (68%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TL V    +++   +    AHQ+++ P+P +  D +D Q KPL FLE  G  T
Sbjct  1    MVSSLVSTLVVASTLSSMALLAPTATAHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
             AD   + K+ GY +LR  MD+ K Y V+  A F+CG+TDP    QPIP    +RSTGYT
Sbjct  61   QADFTAWRKENGYKSLRDFMDNAK-YPVSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVW+DD  VM GDNCH+KFPGK + +DYS CKG CTL WYWLGVR+LK RYSWQ+
Sbjct  120  HDGPCEVWIDDTMVMEGDNCHEKFPGKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQV  179

Query  177  YKECVSLS  184
            YKEC+ L+
Sbjct  180  YKECIPLT  187

>PPTG_15264
Length=194

 Score = 216 bits (551),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 4/187 (2%)

Query  1    MAPSFLPTLAVTA-LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            M PS + TLAV A L  A +  DAHQ+++ PEP +  D KD ++ PLAFLE QG  T  D
Sbjct  1    MTPSLVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               + +  GY  LR  MD  K Y V   A + CG+TDP    QPIP  G +RSTGYTHDG
Sbjct  61   FNAWRRDNGYKTLRDFMDRAK-YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSC--KGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVWLDDV+V+ G NCH+  PGK + +DYSSC  KG C LRWYWLGVR+LK  YSWQ+Y
Sbjct  120  PCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVY  179

Query  178  KECVSLS  184
            KEC+ L+
Sbjct  180  KECIPLT  186

>PPTG_17366
Length=194

 Score = 216 bits (551),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 126/187 (67%), Gaps = 4/187 (2%)

Query  1    MAPSFLPTLAVTA-LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            M PS + TLAV A L  A +  DAHQ+++ PEP +  D KD ++ PLAFLE QG  T  D
Sbjct  1    MTPSLVSTLAVAATLSCAVLSTDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               + +  GY  LR  MD  K Y V   A + CG+TDP    QPIP  G +RSTGYTHDG
Sbjct  61   FNAWRRDNGYKTLRDFMDRAK-YTVTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSC--KGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVWLDDV+V+ G NCH+  PGK + +DYSSC  KG C LRWYWLGVR+LK  YSWQ+Y
Sbjct  120  PCEVWLDDVRVLEGGNCHESIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVY  179

Query  178  KECVSLS  184
            KEC+ L+
Sbjct  180  KECIPLT  186

>PPTG_17122
Length=204

 Score = 216 bits (549),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 6/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS L +L+V A+ +++ ++    +AHQ+++ P P +  D KD ++ PLAFLENQG  T
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D  G+ +  GY  LR  MD  K Y V   A + CG+T+     QPIP  GT+RSTGYT
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAK-YTVTDGADYYCGFTNVNAAPQPIPD-GTMRSTGYT  118

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD  +V+  DNCH+   GKT+ LDYSSC G+CTLRWYWLGVRYLK  YSWQI
Sbjct  119  HDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQI  178

Query  177  YKECVSLS  184
            YK C+ LS
Sbjct  179  YKACIPLS  186

>PYIW_18791
Length=194

 Score = 214 bits (544),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 124/165 (75%), Gaps = 2/165 (1%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
             DAHQ +  P+P + V  K   W PL+FLE  GV TS  V GFMK KGY+ LRALMDD K
Sbjct  19   ADAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSK  78

Query  81   LYEVNTDA-LFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            LY+ N++A  F CGYTDP+  SQ IP   T+R+TGYTH GPCEVW+DD +V++GDNCH++
Sbjct  79   LYKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQ  138

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
                T  +DYS+CKG CT+RWYWLG+RYLKK++SWQ+YK C++L+
Sbjct  139  VSNTT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHYSO_536424
Length=197

 Score = 213 bits (543),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 1/164 (1%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
            +  HQ+++ PEP +  + K+ ++ PLAFLEN+G  T  D   + K+ GY +LR  MD  K
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK  79

Query  81   LYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF  140
             Y+V + A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD  V+ GDNCH+KF
Sbjct  80   -YDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  138

Query  141  PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            PGK + +DYSSCKG+CTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  139  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PHYSO_507031
Length=197

 Score = 213 bits (543),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 119/164 (73%), Gaps = 1/164 (1%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
            +  HQ+++ PEP +  + K+ ++ PLAFLEN+G  T  D   + K+ GY +LR  MD  K
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK  79

Query  81   LYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF  140
             Y+V + A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD  V+ GDNCH+KF
Sbjct  80   -YDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKF  138

Query  141  PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            PGK + +DYSSCKG+CTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  139  PGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PHYCA_129425
Length=204

 Score = 213 bits (543),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 128/190 (67%), Gaps = 6/190 (3%)

Query  1    MAPSFLPTLAVTALGAASV----VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS L +L V A  +++       DAHQ+++ P P +  D KD ++ PLAFLE+QG  T
Sbjct  1    MAPSLLSSLTVAAALSSAALLAPTADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D  G+ +  GY  LRA MD  K Y V   A + CG+T+     QPIP  GT+RSTGYT
Sbjct  61   VEDFNGWRRSNGYKTLRAFMDGAK-YTVTDGADYYCGFTNAKAAPQPIPD-GTMRSTGYT  118

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD  +V+  DNCH+ FPGKT+ LDYSSCKGSC LRWYWLG R+LK  +SWQ+
Sbjct  119  HDGPCEVWLDSTRVLQSDNCHETFPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQV  178

Query  177  YKECVSLSDN  186
            YK C+ LS +
Sbjct  179  YKACIPLSSS  188

>PHYCA_102550
Length=268

 Score = 216 bits (549),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 123/188 (65%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TL V    +++   +    AHQ+++ P P +  D +D Q  PLAFLE+QG  T
Sbjct  1    MVSSLVSTLTVASTLSSMALLAPTATAHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY +LR  MD  K Y V   A F+CGYTDP    QPIP    +RSTGYT
Sbjct  61   QQDFTAWRNENGYKSLRDFMDRAK-YTVRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVW+DD  VM GDNCH+KFPGK + +DYS CKG CTL WYWLGVR+LK  YSWQ+
Sbjct  120  HDGPCEVWIDDTMVMEGDNCHEKFPGKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQV  179

Query  177  YKECVSLS  184
            YKEC+ L+
Sbjct  180  YKECIPLA  187

>PHYCA_102852
Length=195

 Score = 212 bits (540),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TL V    +++   +   DAHQ+++ PEP +  + KD ++ PLAFLEN+G  T
Sbjct  1    MISSLVSTLTVASTLSSMALLAPTADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY +LR  MD  K Y V   A F+CG+TDP    QPIP    +RSTGYT
Sbjct  61   QEDFTAWRTENGYKSLRDFMDRAK-YPVTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  V+ G+NCH+KFPGK + +DYSSCKG+CTL W+WLGVR+LK  YSWQ+
Sbjct  120  HDGPCEVWLDDTMVLDGENCHEKFPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQV  179

Query  177  YKECVSLS  184
            YK C+ L+
Sbjct  180  YKACIPLT  187

>PHALS_00498
Length=199

 Score = 211 bits (537),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 128/188 (68%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVV----VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TLAV +  ++ V+    V AHQ+++ PEP +  + KD ++ PLAFLENQ   T
Sbjct  1    MVSSAISTLAVVSTMSSVVLLAPNVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
            + D   + KQ  +  LR  MD+ K Y V   A   CG+TDP    QPIP    +RSTGYT
Sbjct  61   TGDAQAYFKQNHFKTLRDFMDNAK-YTVVKGADPACGFTDPNGTPQPIPANNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWL++ +V+S  NCH+KFPGK + +DYSSCK +C LRWYWLGVR+LK++YSWQ+
Sbjct  120  HDGPCEVWLNNTRVLSASNCHEKFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQV  179

Query  177  YKECVSLS  184
            YK C+ LS
Sbjct  180  YKACIPLS  187

>PPTG_17123
Length=201

 Score = 209 bits (532),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 0/160 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +   +M+Q GY +LRA++DDE LY+V
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
              +A+FECG T P  E+QPIPT  + +++GYT DGPCEVWLDD KV SG NCH +FP   
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
              +DYSSC  +CTL WYWLG++Y++  YSWQ+YK CV LS
Sbjct  157  HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196

>PHYKE_3446
Length=199

 Score = 207 bits (528),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 125/188 (66%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAVTAL--GAASV--VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAP       V A   GAA +  + DAHQ+++ PEP +  D K+ ++ PLAFLENQG  T
Sbjct  1    MAPPLASVFTVVAALSGAAVIAPITDAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFAT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   + +  GY  LRA MD  K Y+V   A + CG+TDP   +QPIP  G +RSTGYT
Sbjct  61   QEDANAWRRDNGYKTLRAFMDMAK-YQVTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVW+D+ +V+   NCH+   GK + +DYS+C+G+C LRWYWLGVR+LK  YSWQ+
Sbjct  120  HDGPCEVWIDNTRVLESGNCHETITGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQV  179

Query  177  YKECVSLS  184
            YK C+ L+
Sbjct  180  YKACIPLT  187

>PHYKE_8389
Length=204

 Score = 207 bits (527),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 127/188 (68%), Gaps = 6/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS L +L+V A+ +++ ++    DAHQ+++ P P +  D KD ++ PLAFLENQG  T
Sbjct  1    MAPS-LASLSVAAVLSSAALLAPTADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFET  59

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   + +  GY  LRA MD  K Y V   A + CG+T+     Q IP+   +RSTGYT
Sbjct  60   VDDFNAWRRNNGYKTLRAFMDGAK-YTVTDGADYHCGFTNADAAPQAIPSGNAMRSTGYT  118

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD  +V++ DNCH+   GK + +DYSSC G+CTLRWYWLGVR+LK  YSWQ+
Sbjct  119  HDGPCEVWLDTTRVLTHDNCHEAISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQV  178

Query  177  YKECVSLS  184
            YK CV LS
Sbjct  179  YKACVPLS  186

>PHYRA_81105
Length=201

 Score = 207 bits (526),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 119/159 (75%), Gaps = 0/159 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +  G+M+Q GYA+LR+++DDE LY+V
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
              +A+F+CG T P  E+Q IPT  + +S+GYT DGPCEVWLDD K  +G NCH +FP   
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQ  156

Query  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
              +DYS+C  +C LRWYWLG++Y++  YSWQ+YK C++L
Sbjct  157  HQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195

>PHYCA_537323
Length=200

 Score = 206 bits (525),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 0/159 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q++  P PFF+VDG D Q   LA+L+ QGVNTS +   +M+Q GY +LRA++DDE LY+V
Sbjct  36   QVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQV  95

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
              +A+FECG T P  E+QPIPT  + +++GYT DGPCEVWLDD KV +G NCH +FP   
Sbjct  96   TEEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ  155

Query  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
              +DYSSC  SCTL WYWLG++Y++  YSWQ+YK CV L
Sbjct  156  HQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194

>PHYKE_7718
Length=220

 Score = 207 bits (527),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 120/179 (67%), Gaps = 3/179 (2%)

Query  6    LPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMK  65
            +P   + AL A   + DAHQ+++ PEP +  D KD ++ PLAFLE +G     D   +  
Sbjct  16   VPAETIAALLAP--IADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRI  73

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWL  125
            + GY +LR  MD+ K Y V + A   CG+TDP    QPIP    +RSTGYTHDGPCEVW+
Sbjct  74   ENGYKSLRDFMDNAK-YSVTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWI  132

Query  126  DDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            DD   M  DNCH+ FPGK + +DYS+CKG+CTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  133  DDTLAMGNDNCHEAFPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  191

>PHYSO_284086
Length=204

 Score = 206 bits (524),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 115/165 (70%), Gaps = 2/165 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
              DAHQ+++ P P +  D K  ++ PLAFLENQG  T  D   + + KGY  LRA MD  
Sbjct  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGA  83

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
              Y V   A + CG+TD    +QPIP  GT+RSTGYTHDGPCEVWLD  +V+  DNCH+ 
Sbjct  84   S-YTVADGADYYCGFTDIKGVAQPIPD-GTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            F GKT+ LDYSSCKGSCTLRWYWLGVR+LK  YSWQ+YK CV LS
Sbjct  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PHYKE_8388
Length=205

 Score = 205 bits (522),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 124/188 (66%), Gaps = 5/188 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M PSF  +L V A+ +++ ++    +AHQ+++ P P +  D K  ++ PLAFLE+QG +T
Sbjct  1    MTPSFASSLLVAAVLSSAALIAPIANAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFST  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +    GYA+LRA  DD   Y V+  A F CG+TD    +QPIP    +RSTGYT
Sbjct  61   QEDFTAWRSDNGYASLRAFNDDAS-YTVSDGADFTCGFTDINGAAQPIPDDNAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLDD  VM  +NCHD   GK + +DYSSC  +CTL W+W+GVRYLK  YSWQ+
Sbjct  120  HDGPCEVWLDDTMVMQYNNCHDSISGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQV  179

Query  177  YKECVSLS  184
            YK CV LS
Sbjct  180  YKACVPLS  187

>PHYRA_81107
Length=202

 Score = 202 bits (515),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 124/185 (67%), Gaps = 2/185 (1%)

Query  1    MAPSFLPTLAV-TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            MAPSF+ +L+    L +A+++ DAHQ+++ P P +  D K  ++ PLAFLE+QG +T  D
Sbjct  1    MAPSFVSSLSAGIVLSSAALLADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               + ++ GY +LRA  DD   Y V+  A F CG+TD   + Q IP    +RSTGYTHDG
Sbjct  61   FTAWREENGYDSLRAF-DDGASYTVSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            PCEVWLDD  VM  DNCH+   GK + +DYSSC  +CTL W+W+GVRYL   YSWQ+YK 
Sbjct  120  PCEVWLDDTMVMQYDNCHEVISGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKA  179

Query  180  CVSLS  184
            CV LS
Sbjct  180  CVPLS  184

>PPTG_10048
Length=190

 Score = 202 bits (513),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 121/187 (65%), Gaps = 2/187 (1%)

Query  1    MAP-SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            M P +F+    ++A   A  + +AHQ+++ P P ++ D +D Q  PLAFLE+QG  T  D
Sbjct  1    MGPLTFIKLCGLSAAALAWPLTEAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               +  Q GY  LR  M+  K Y V   A F CG+T+P    QPIP  G +RSTGYTH+G
Sbjct  61   FKSWRIQNGYKTLRDFMEHAK-YTVTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            PCE+W+ D +V   DNCH   PGK +P+DYS CKG+C L WYWLGVR+LK  YSWQ+YKE
Sbjct  120  PCEMWVADTQVYQADNCHVSLPGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKE  179

Query  180  CVSLSDN  186
            C+ L+ N
Sbjct  180  CIPLTTN  186

>PYAP_22273
Length=268

 Score = 204 bits (520),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 117/184 (64%), Gaps = 2/184 (1%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGF  63
            + L   A+ AL A SV+V+AHQ + FPE  + +  +   W P A LENQG  T+ D   +
Sbjct  6    AVLGATAIAALTAPSVLVEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAY  65

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEV  123
            +   GY  LR  MD    Y+ N  A  ECGYTDP    QPIPT G  R++GYTH+GPCE+
Sbjct  66   LSANGYKTLRDFMDKPGAYKANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEI  125

Query  124  WLDDVKVMSGDNCHDKFPGKTF--PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECV  181
            W+DDV V SG NCH     K F   +DYS+CKG C L+WYWLG+R + K+YSWQIYK C+
Sbjct  126  WIDDVMVKSGKNCHYDISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACI  185

Query  182  SLSD  185
             L+D
Sbjct  186  PLAD  189

>PHYSO_477820
Length=202

 Score = 202 bits (513),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 120/185 (65%), Gaps = 2/185 (1%)

Query  1    MAPSFLPTLAVTA-LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            MAPS + +L+  A L  A+++  AHQ+++ P P +  D K  ++ PLAFLE+QG  T  D
Sbjct  1    MAPSLVSSLSAAAVLSGAALLAGAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               +    GY +LRA  +D   Y V   A F CG+T+   E QPIP    +RSTGYTHDG
Sbjct  61   FTAWRTDNGYDSLRAF-NDGASYTVADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            PCEVWLDD  VM  DNCH+   GK + +DYSSC  +CTL W+WLGVRYLK  YSWQIYK 
Sbjct  120  PCEVWLDDTMVMQYDNCHESISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKA  179

Query  180  CVSLS  184
            CV LS
Sbjct  180  CVPLS  184

>PITG_18452
Length=856

 Score = 215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 122/162 (75%), Gaps = 0/162 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q+++ P PFF+VDG D Q   LA+L+ QG+NTS +   +M+Q+GY++LRA++DDE LY+V
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
              +A+FECG T P  E+QPIPT  + +++GYT DGPCE+WLDD KV SG NCH +FP   
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQ  811

Query  145  FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDN  186
              +DYSSC GSC L WYWLG++Y++  YSWQ+YK CV LS N
Sbjct  812  HQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853

>PITG_18450
Length=203

 Score = 196 bits (499),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 121/188 (64%), Gaps = 9/188 (5%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS   +L V A+ ++  ++     AHQ+++ P P +  D KD ++ PL FLE QG  T
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D  G+ +  GY  LR  M+    Y V   A + CG+T+     QP P  G +RSTGYT
Sbjct  61   VEDFNGWRRNNGYKTLRDFME----YTVADGADYYCGFTNVNAAPQPNPD-GAMRSTGYT  115

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
            HDGPCEVWLD  +V+  DNCH+   GKT+ LDYSSCKG+CTLRWYWLGVR+LK  YSWQI
Sbjct  116  HDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQI  175

Query  177  YKECVSLS  184
            YK C+ LS
Sbjct  176  YKACIPLS  183

>PHYRA_81106
Length=202

 Score = 196 bits (499),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 110/165 (67%), Gaps = 1/165 (1%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDE  79
            + DAHQ+++ P P +  D KD ++ PLAFLENQG  T  D   + +  GY  LRA MD  
Sbjct  24   MTDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGA  83

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            K Y V   A + CG+T+     Q IP    +RSTGYTHDGPCEVWLD  +V++ DNCH+ 
Sbjct  84   K-YTVADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
              GK + +DYSSC G+CTL WYW+GVRYLK  YSWQ+YK CV LS
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187

>PPTG_17121
Length=202

 Score = 195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 2/185 (1%)

Query  1    MAPSFLPTLAV-TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            M  S + +L+    L +A+++ +AHQ+++   P +  D KD ++ PLAFLE+QG  T  D
Sbjct  1    MVSSHVSSLSTAVVLSSATLLANAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQED  60

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               + K  GY +LRA  +D   Y V+  A   CG+T+   + QPIP    +RSTGYTHDG
Sbjct  61   FTAWRKDNGYDSLRAF-NDGASYTVSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDG  119

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            PCEVWLDD  VM  DNCH+   GK + +DYSSC  +CTL W+WLGVRYLK  YSWQIYK 
Sbjct  120  PCEVWLDDTMVMQYDNCHEAISGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKA  179

Query  180  CVSLS  184
            CV LS
Sbjct  180  CVPLS  184

>PHYCA_511409
Length=204

 Score = 195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 124/185 (67%), Gaps = 2/185 (1%)

Query  1    MAPSFLPTLAVTALGAASV-VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD  59
            MAPSF+P+L+  A+ +++  + DAHQ+++ P P +  D K  ++ PLAFLE+QG  T  D
Sbjct  3    MAPSFVPSLSAAAVISSAALLADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQED  62

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDG  119
               + +  GY +LRA  +D   Y V+  A F CG+T+   + Q IP    +RSTGYTHDG
Sbjct  63   FTAWRQDNGYDSLRAF-NDGASYTVSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDG  121

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            PCEVWLDD  VM  DNCH+   GK + +DYSSC  +CTL W+WLGVRYLK  YSWQIYK 
Sbjct  122  PCEVWLDDTMVMQYDNCHEAISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKA  181

Query  180  CVSLS  184
            CV LS
Sbjct  182  CVPLS  186

>PHALS_03284
Length=188

 Score = 194 bits (494),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 118/176 (67%), Gaps = 3/176 (2%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKG  68
            ++  AL A +V+  AHQ+++ PEP +  + KD ++ PLAFLENQ   TSAD  G++K+  
Sbjct  1    MSTVALLAPNVI--AHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNN  58

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDV  128
            Y +LR  +     Y V   A  +CG+TDP    QPIP    +R TGYTHDG CE+WLDD 
Sbjct  59   YNSLRDFLKRAN-YTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDT  117

Query  129  KVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            KV+SG NCH+ FPGK  P+DYSSCK +C + WYWL VR LK  YSWQ+YK C+ L+
Sbjct  118  KVLSGSNCHNDFPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLT  173

>PHYSO_353401
Length=146

 Score = 187 bits (475),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 107/139 (77%), Gaps = 0/139 (0%)

Query  46   LAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIP  105
            LA+L+ QGVNTS +   +M++ GYA+LRA++DDE LY+V  +ALF+CG T P  E+QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  106  TTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGV  165
            +  + +++GYT DGPCEVWLDD KV +G NCH +FP     +DYS+C  SCTL WYWLG+
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  166  RYLKKRYSWQIYKECVSLS  184
            +Y++  YSWQ+YK CV+LS
Sbjct  123  KYVEGAYSWQVYKNCVALS  141

>HYAP_07096
Length=251

 Score = 190 bits (483),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 115/163 (71%), Gaps = 1/163 (1%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q++++P P F+VD    Q K LA+L+ QG++TS +   + ++ GY +LRA++DD+ LY V
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  85   NTDALFECGYTD-PTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK  143
            + DA+F+CG+T  P+   Q IPT GT+ S+GYT DGPCEVW DD +V SG NC  +FP  
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  144  TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLSDN  186
               +DYSSC  SCTLRWYWLG++Y+   YSWQ+YK C+ L  N
Sbjct  206  QHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRN  248

>PPTG_08820
Length=250

 Score = 188 bits (478),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 128/193 (66%), Gaps = 9/193 (5%)

Query  1    MAPSFLPTLAVTA--LGAA--SVVVDAHQMMIFPEPFFL--VDGKDAQWKPLAFLENQGV  54
            MA + + TL V     G+A  ++ VDAHQ+++ PEP +   ++ +D +W+PLAFLE+QG 
Sbjct  1    MAHALVSTLTVVVALFGSALLTLTVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGF  60

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLY-EVNTDALFECGYTDPTYESQPIPTTGTIRST  113
               AD  G+  Q GY NLR  MD  K    V   A   CG T+     +PIP  G ++ST
Sbjct  61   PCQADFNGWRAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKST  120

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSC--KGSCTLRWYWLGVRYLKKR  171
            GYTHDGPC V+LDD  V+  DNCH+K PGK++ +DYSSC  KG CTL W+WLG+R++K R
Sbjct  121  GYTHDGPCAVYLDDELVLEYDNCHEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSR  180

Query  172  YSWQIYKECVSLS  184
            +SWQ+YKECV L+
Sbjct  181  WSWQVYKECVPLT  193

>PYIR_26546
Length=239

 Score = 187 bits (476),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 7/177 (4%)

Query  14   LGAASVVVD----AHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKG  68
            L A  V++D    AHQM++ P+P + ++GK  QW+P+A+LE Q G + + D  G++  KG
Sbjct  14   LAAPLVLLDSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKG  73

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDV  128
            +  +R  MD++KLY   +DA F+CGYT    E QPIP    IR+TGYTH+GPCE+WLDDV
Sbjct  74   FKTMREFMDNDKLYRPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDV  133

Query  129  KVMSGDNCH-DKFPGKTF-PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            KV  G NCH D   G  F  LD+SSC G CT+ WYW+G+R   K  SWQIYKEC+ L
Sbjct  134  KVFYGKNCHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYAR_24096
Length=227

 Score = 185 bits (469),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 106/165 (64%), Gaps = 2/165 (1%)

Query  22   DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKL  81
            +AHQ +  P+  + V  ++  W P A LE QG  T+AD   ++K   Y  LR  MD    
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  82   YEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFP  141
            Y+ N+ A FECG+TDP   +QPIP  G  R++GYTH+GPCE+W+DDV+V  GDNCH    
Sbjct  85   YKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS  144

Query  142  GKTF--PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
               F   +DYS+CKG+C L+WYWLG+R   K YSWQIYK C+ LS
Sbjct  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189

>PYVX_18176
Length=201

 Score = 184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 106/166 (64%), Gaps = 2/166 (1%)

Query  19   VVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDD  78
             V DAHQ +I P P +  D KD  + PLAFLE+QG +T  D   +    GY +LRA MD 
Sbjct  20   TVADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDG  79

Query  79   EKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHD  138
               Y V   A   CG+T+    +Q +P  G +RSTGYTH GPCEVWLDD  V+  DNCHD
Sbjct  80   AS-YTVTDGADQTCGWTNKDGTAQALPD-GVMRSTGYTHVGPCEVWLDDTMVLQYDNCHD  137

Query  139  KFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
               GKT+ LDYSSC  +CTL W+W+GVRYL   YSWQ+YK CV LS
Sbjct  138  SISGKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLS  183

>PYAP_22278
Length=289

 Score = 186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 111/169 (66%), Gaps = 6/169 (4%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80
            VDAHQ +  P P F  + ++  W PLAFLENQGV    D+ GF++ KG   LR  MD++ 
Sbjct  22   VDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKA  81

Query  81   LYEVNTD-ALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSG--DNCH  137
             Y++    A FECGYT+P    QPIP  G +RSTGYTHDGPCEVWLD+ +V+     NCH
Sbjct  82   NYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCH  141

Query  138  DKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYL-KKRYSWQIYKECVSL  183
                 K  ++ +D+S CKG+C LRWYWLG R +  K++SWQIYK CV L
Sbjct  142  RDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PHYSO_499978
Length=174

 Score = 174 bits (441),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 5/175 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS + T  V  + +++ ++    DAHQ+++ PEP +  + K+ ++ PLAFLENQG  T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY  LR  MD  K Y V   A F CG+TDP    QPIP    +RSTGYT
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGK-YTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKR  171
            HDGPCEVW+D+ +V+ GDNCH+K   K + +DYS+CKG+CTLRWYW     L  R
Sbjct  120  HDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYWRRCTRLASR  174

>PHYSO_501575
Length=174

 Score = 174 bits (441),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 111/175 (63%), Gaps = 5/175 (3%)

Query  1    MAPSFLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPS + T  V  + +++ ++    DAHQ+++ PEP +  + K+ ++ PLAFLENQG  T
Sbjct  1    MAPSLVSTCIVAGVLSSAALLAPTADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFAT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY  LR  MD  K Y V   A F CG+TDP    QPIP    +RSTGYT
Sbjct  61   QQDFREWRTKNGYKTLRDFMDHGK-YTVTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKR  171
            HDGPCEVW+D+ +V+ GDNCH+K   K + +DYS+CKG+CTLRWYW     L  R
Sbjct  120  HDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWYWRRCTRLASR  174

>PYAP_22279
Length=223

 Score = 175 bits (444),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 109/165 (66%), Gaps = 6/165 (4%)

Query  24   HQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYE  83
            HQ +  P P    D ++    PLAFLENQGV  + D+ G+++QKG   LR  MD++  Y+
Sbjct  22   HQRITIPAPTLTTD-RNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  84   VNT-DALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVM---SGDNCHDK  139
            V    A FECGYTDP    QPIP+ G +RSTGYTHDGPCEVWLD+ +V+   SGD   D 
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  140  FPGK-TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
              G  ++ +D+S CKG+C LRWYWL  R +  ++SWQ+YK+CV L
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PYVX_18174
Length=204

 Score = 173 bits (439),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 110/189 (58%), Gaps = 8/189 (4%)

Query  1    MAPSFLPTLAVTALGAAS----VVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            MAPSF    +  A  A       V DAHQ +I PEP +    +D  + PLAFLE+QG  T
Sbjct  1    MAPSFSVVASAAAAAAGVALLATVADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFET  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   + +  GY  LRA MD +  Y V   A   CG+T+     QPIP     RSTGYT
Sbjct  61   VEDFNAWRRSNGYKTLRAFMD-QASYTVTDGADQTCGFTEIDGTPQPIP--ANFRSTGYT  117

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYS-SCKGSCTLRWYWLGVRYLKKRYSWQ  175
            HDGPCE+WLD  +V + DNCH+   GK   +DYS    G+CTL WYW+GVRYL   YSWQ
Sbjct  118  HDGPCEIWLDSTRVYANDNCHEAISGKDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQ  177

Query  176  IYKECVSLS  184
            +YK CV LS
Sbjct  178  VYKNCVPLS  186

>PITG_13520
Length=171

 Score = 167 bits (424),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 103/157 (66%), Gaps = 5/157 (3%)

Query  1    MAPSFLPTLAV----TALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  S + TLAV    +++   +   DAHQ+++ PEP +    KD ++ PLAFLENQG  T
Sbjct  1    MVSSLVSTLAVASTLSSIALLAPTADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D   +  + GY +LR  MD  K Y+V + A F CG+TDP    QPIP  G +RSTGYT
Sbjct  61   QQDFKAWRDENGYKSLRDFMDRAK-YDVTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYT  119

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCK  153
            HDGPCEVWLDD  V+ GDNCH+KFPGK + +DYSSCK
Sbjct  120  HDGPCEVWLDDKMVLDGDNCHEKFPGKDYTVDYSSCK  156

>PHYCA_510817
Length=188

 Score = 166 bits (420),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 110/185 (59%), Gaps = 6/185 (3%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVNTSA  58
            S L TLAV          +AHQ++  P P +      ++     W PL+FLE +G  T  
Sbjct  3    SSLSTLAVIGSSMLLQSTEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQE  62

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHD  118
            +   +    GY +LR  M+  K Y+V+  A   CG++DP    Q IP+ GT+R++GYTHD
Sbjct  63   NFTQYQVDNGYKSLRDFMEKAK-YKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHD  121

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYK  178
            GPCE+W+ D   +S  NCH+  P +TF LDYS C  SC L WYWLGVR LK +YSWQ+YK
Sbjct  122  GPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYK  181

Query  179  ECVSL  183
            EC+ L
Sbjct  182  ECIPL  186

>PITG_10499
Length=323

 Score = 169 bits (428),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 109/163 (67%), Gaps = 5/163 (3%)

Query  27   MIFPEPFFL--VDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK-LYE  83
            M  PEP +   ++ +D +W+PLAFLE+QG     D  G+  + GY +LR  MD  K +  
Sbjct  1    MGQPEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTS  60

Query  84   VNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK  143
            V   A   CG T+     +PIP  G +RSTGYTHDGPC ++LDD  VM  DNCH+  PG+
Sbjct  61   VTPGADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGR  120

Query  144  TFPLDYSSC--KGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            T+ +D+SSC  KG CTL W+WLG+R++K R+SWQ+YKEC+SL+
Sbjct  121  TYKIDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PPTG_14255
Length=268

 Score = 167 bits (422),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 112/186 (60%), Gaps = 8/186 (4%)

Query  5    FLPTLAVTALGAASVVVD--AHQMMIFPEPFFLVDG-----KDAQWKPLAFLENQGVNTS  57
             L T    A+ ++++++   AHQ++  P P +         +   W PL+FLE +G  T 
Sbjct  1    MLTTFTSVAVLSSTLLLQTQAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQ  60

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTH  117
             +   +    GY +LR  MD+ K Y V   A   CG+TDP    Q IP  GT+R++GYTH
Sbjct  61   ENFTQYQVDNGYKSLRDFMDNAK-YSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTH  119

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            DGPCE+++ D   +S  NCH+    +TF LDYS+C  SC L WYWLGVRYLKK+YSWQ+Y
Sbjct  120  DGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVY  179

Query  178  KECVSL  183
            KEC+ L
Sbjct  180  KECIPL  185

>PPTG_14254
Length=188

 Score = 163 bits (412),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 109/188 (58%), Gaps = 7/188 (4%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVN  55
            M  SF  TLAV          +AHQ++  P P +      ++     W PL+FLE +G  
Sbjct  1    MVSSF-STLAVLGSSMLLHATEAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFK  59

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGY  115
            T  +   F    GY +LR  MD  K Y+V   A   CG+TDP    Q IP  GT+R+TGY
Sbjct  60   TQENFTQFQVDNGYKSLRDFMDRAK-YKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGY  118

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            THDGPCE+++ +   +S  NCH+  P +TF LDYS C  SC L WYWLGVR LK +YSWQ
Sbjct  119  THDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQ  178

Query  176  IYKECVSL  183
            +YKEC+ +
Sbjct  179  VYKECIPI  186

>PHYSO_417649
Length=185

 Score = 160 bits (405),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 8/185 (4%)

Query  6    LPTLAV--TALGAASVVVDAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVNTSA  58
            L ++AV  +AL   S+ V+AHQ++  P P +      A      W PL+FLE +G  T  
Sbjct  1    LTSIAVIGSALALQSLSVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQE  60

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHD  118
            +   +    GY +LR  M+  K Y++   A   CG+TDP    Q IP  GT+R++GYTHD
Sbjct  61   NFTQYQVDNGYKSLRDFMERAK-YKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHD  119

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYK  178
            GPCE+++ D   +S  NCH+    +TF LDYS C  SC L WYWLGVR LK ++SWQ+YK
Sbjct  120  GPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYK  179

Query  179  ECVSL  183
            EC+ L
Sbjct  180  ECIPL  184

>PHYKE_9185
Length=281

 Score = 163 bits (412),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 115/189 (61%), Gaps = 12/189 (6%)

Query  4    SFLPTLAVTALGAASVV----VDAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGV  54
            S   +LAV  LG+A+++     +AHQ++  P P +      ++     W PL+FLE +G+
Sbjct  3    SSFTSLAV--LGSAALLQYSTTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGI  60

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTG  114
             T  +   +     YA+LR  MD  K Y+V+  A   CG+TDP    Q IP  GT+R++G
Sbjct  61   KTQENFTQYQVDNNYASLRDFMDKAK-YKVSDGADQACGWTDPKGIPQQIPEDGTMRTSG  119

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSW  174
            YTHDGPCE+++ D   +S  NCH+    +TF LDYS+C  SC L WYWLGVR LK  YSW
Sbjct  120  YTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSW  179

Query  175  QIYKECVSL  183
            QIYKEC+ L
Sbjct  180  QIYKECIPL  188

>PHYSO_262732
Length=188

 Score = 160 bits (404),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 113/186 (61%), Gaps = 23/186 (12%)

Query  4    SFLPTLAVTALGAASVV-VDAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVNTS  57
            +FL +LAV  +G+A V+  +AHQ++  P P +      A      W PLAFLENQG  T 
Sbjct  3    TFLMSLAV--VGSALVLQAEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT-  59

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTH  117
                         +LR  MD+ K Y V   A   CG+TDP   +Q IP+ GT+R++GYTH
Sbjct  60   -------------HLRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTH  105

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            DGPCE+++ D   +S  NCH+    +TF LDYS C  SCTL WYWLGVR+L  +YSWQ+Y
Sbjct  106  DGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVY  165

Query  178  KECVSL  183
            KEC+ +
Sbjct  166  KECIPI  171

>PHYCA_536934
Length=983

 Score = 171 bits (432),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 110/180 (61%), Gaps = 7/180 (4%)

Query  10   AVTALGAASVV-VDAHQMMIFPEPFFLVDG-----KDAQWKPLAFLENQGVNTSADVAGF  63
            ++  LG+A ++  +AHQ++  P P +         +   W PL+FLE +G  T  +   +
Sbjct  24   SIAVLGSALLLQTEAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQY  83

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEV  123
                GY NLR  MD+ K Y V   A   CG++DP    Q IP  GT+R++GYTHDGPCE+
Sbjct  84   QVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEI  142

Query  124  WLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            W+ D   +S  NCH+    +TF LDYS C  SC L WYWLGVRYLKK+YSWQ+YKEC+ L
Sbjct  143  WMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PHYSO_343376
Length=172

 Score = 152 bits (384),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 88/138 (64%), Gaps = 1/138 (1%)

Query  34   FLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECG  93
            +  + K+ ++ PLAFLENQG  T  D   +  + GY  LR  MD  K Y V   A F CG
Sbjct  36   WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGK-YTVTKGADFSCG  94

Query  94   YTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCK  153
            +TDP    QPIP    +RSTGYTHDGPCEVW+D+ +V+ GDNCH+K   K + +DYS+CK
Sbjct  95   WTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACK  154

Query  154  GSCTLRWYWLGVRYLKKR  171
            G+CTLRWYW     L  R
Sbjct  155  GTCTLRWYWRRCTRLASR  172

>PHYSO_254168
Length=170

 Score = 146 bits (369),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 104/186 (56%), Gaps = 26/186 (14%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60
            MAPS   TLA+ +    +    +            V+ KD ++ PLAFLE QG  T    
Sbjct  1    MAPSLASTLALRSPSRRTPSRSSAGAA--------VEDKDTKYNPLAFLEGQGFATQEGF  52

Query  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120
                +  GY  LR  MD  K Y V   A + CG+T+P    QPIP     RSTGYTHDGP
Sbjct  53   DARRRDNGYKTLRDFMDRGK-YTVTQGADYFCGWTNPKGTPQPIP-----RSTGYTHDGP  106

Query  121  CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSC--KGSCTLRWYWLGVRYLKKRYSWQIYK  178
            CE+WLDDV+V+           ++  +DYSSC  KG CT+ WYWLGVR+LK  YSWQ+YK
Sbjct  107  CEIWLDDVRVLE----------RSPTIDYSSCEKKGGCTMHWYWLGVRFLKNSYSWQVYK  156

Query  179  ECVSLS  184
            EC+ L+
Sbjct  157  ECIPLT  162

>PHYSO_527908
Length=174

 Score = 144 bits (363),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 103/172 (60%), Gaps = 8/172 (5%)

Query  5    FLPTLAV--TALGAASVVVDAHQMMIFPEPFFL-VDGKDAQ----WKPLAFLENQGVNTS  57
             L ++AV  +AL   S+ VDAHQ++  P P +   +   A+    WKPLAFLE QG  T 
Sbjct  1    MLTSIAVLGSALMLQSLSVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQ  60

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTH  117
            A+   FM   GY +LR  MD+   Y V   A   CG+TDP    Q IP  GT+R++G+TH
Sbjct  61   ANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTH  119

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLK  169
            D PCE+++ D   +S  NCH+    + F LDYS+C  SC L WYWLGVR++K
Sbjct  120  DDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PHYSO_341596
Length=231

 Score = 142 bits (359),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 87/136 (64%), Gaps = 9/136 (7%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGY  69
            A++++   +   DAHQ+++          KD ++ PLAFLENQG  T  D A +  + GY
Sbjct  14   ALSSMAMLAPTADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGY  65

Query  70   ANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVK  129
             +LR  MD  K Y V + A F CG+TDP    QPIP    +RSTGYTHDGPCEVWLDD K
Sbjct  66   KSLRDFMDKAK-YTVTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTK  124

Query  130  VMSGDNCHDKFPGKTF  145
            V+ GDNCH+KFPGK +
Sbjct  125  VLEGDNCHEKFPGKDY  140

>PHYCA_14368
Length=219

 Score = 131 bits (330),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 96/188 (51%), Gaps = 50/188 (27%)

Query  1    MAPSFLPTLAVTALGAASVVVD----AHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT  56
            M  SF  T AV +  ++  ++D    AHQ+++ PEP +  + KD ++ PLAFLENQG  T
Sbjct  1    MVHSFALTFAVASTLSSLALLDSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKT  60

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
              D A +  +  Y +LR  MD+ K Y V   A F CG+TDP                   
Sbjct  61   QQDFASWRTENNYKSLRDFMDNAK-YTVTDGADFSCGFTDP-------------------  100

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQI  176
                                      K + +DYSSCKG+CTLRWYWLG+R+LK +YSWQ+
Sbjct  101  --------------------------KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQV  134

Query  177  YKECVSLS  184
            YK C+ LS
Sbjct  135  YKACIPLS  142

>PHYSO_342364
Length=194

 Score = 122 bits (306),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 99/190 (52%), Gaps = 23/190 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWK---PLAFLENQGV-NTSADVAGFMK  65
            A   + A+    DAH  +  P+  F   G+++QW    P  +  N    NT   V  F  
Sbjct  10   AAVIMAASMPGADAHGYIYVPQSQFF-GGENSQWSVQIPPVWPSNDWYGNTQKSVQVFNS  68

Query  66   QK---GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPC  121
             K    Y +LR L+D+  +Y  N      CGYT+P    QPIPT G  I S G  H GPC
Sbjct  69   LKTSHNYKDLRTLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPC  122

Query  122  EVWLDDVKVMSGDNCHDKFPGKT------FPLDYSSC--KGSCTLRWYWLGVRYLKKRYS  173
            E+WLDD KVM+ D+C+ K+          FP+DYS C  KG C +R+YWLG + L K+  
Sbjct  123  EIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTV  182

Query  174  WQIYKECVSL  183
            WQ YK C+ L
Sbjct  183  WQTYKNCIPL  192

>PHYSO_340369
Length=200

 Score = 117 bits (294),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 94/188 (50%), Gaps = 22/188 (12%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFL-----VDGKDAQWKPLAFLENQGVNTSA  58
            SF+  L    L  A  +  A+Q++  P P +       D +   W PLA+ E+QG NTS+
Sbjct  7    SFVVLLGAFVLHPA--ITRANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSS  64

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHD  118
            +   +    G+  LR  MD+   Y V          T P    Q IP    +R+ GYT D
Sbjct  65   NFTQWQLTNGFKTLRDFMDNGN-YSV----------TSP----QQIPDDNIMRTYGYTRD  109

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYK  178
            GPCE+WLD+    S  +C    P  T+ LDYS C  SC + WY LGV    + YSW++YK
Sbjct  110  GPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYK  169

Query  179  ECVSLSDN  186
            EC+ L  N
Sbjct  170  ECIPLYMN  177

>PHYKE_8390
Length=130

 Score = 114 bits (286),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 70/97 (72%), Gaps = 0/97 (0%)

Query  25   QMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEV  84
            Q+++ P PFF+VDG D Q   LA+L+ QGVNTS +  G+M   GY +LRA++DDE LY+V
Sbjct  31   QIVLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKV  90

Query  85   NTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPC  121
              +ALF+CG T P  E+Q IPT  T +++GYT DGPC
Sbjct  91   TEEALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PYIW_18792
Length=125

 Score = 114 bits (284),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 75/123 (61%), Gaps = 1/123 (1%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60
            MAPS   +L +    +++ +VDAHQ +  P P + V  +  Q+ PLAFLE QG   +AD 
Sbjct  1    MAPSITKSLVLAVAVSSAALVDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADF  60

Query  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120
              + K KGY NLR  MDD+K Y+V+    FECG++      QPIP  G +RSTGYTHDGP
Sbjct  61   TAYYKSKGYKNLRGFMDDKKAYKVD-GGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGP  119

Query  121  CEV  123
              +
Sbjct  120  FGI  122

>PYAP_18131
Length=226

 Score = 116 bits (290),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 76/114 (67%), Gaps = 9/114 (8%)

Query  76   MDDEKLYEVNT-DALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGD  134
            MDD+  Y+V    A FECG TDP    QPIP  G +RSTG+THDG   VW+D+ +V+   
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  135  --NCHDKFPGK---TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
              NCH K  G+   ++ +D+S CKG C +RWYWLG+R L K++SWQ+YK C+ +
Sbjct  59   LGNCH-KSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>PHYSO_246676
Length=187

 Score = 110 bits (274),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 82/171 (48%), Gaps = 39/171 (23%)

Query  14   LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLR  73
            +   +   DAHQ+++ PEP +  + K  ++ PLAFLENQG  T  D A + K+ GY  LR
Sbjct  1    MALPAPTADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLR  60

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSG  133
              MD  K Y+V + A F CG+TDP    QPIP    +RSTGYTHDG     L    V+ G
Sbjct  61   DFMDKAK-YDVTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASL----VLDG  115

Query  134  DNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
                                              +K  YSW++YK C+ LS
Sbjct  116  ----------------------------------MKNSYSWKVYKACIPLS  132

>PHYCA_127270
Length=279

 Score = 110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 89/178 (50%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQKG---YANLRA  74
            VDAH  M+ PE  F      A   Q  P+   +    N    V  F   K    + +L+ 
Sbjct  21   VDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPQSVDTFKSLKAANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP    QPIPT G    S    H GPCE+WLDD KV+  
Sbjct  81   LMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVLYE  134

Query  134  DNCHDKFPGKT------FPLDYSSC-KGSC-TLRWYWLGVRYLKKRYSWQIYKECVSL  183
            D+C  K+  K       FP+DYSSC  G C  +R+YWL  + L K+  WQ YK+C+ L
Sbjct  135  DDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PYIR_16435
Length=304

 Score = 110 bits (274),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 100/188 (53%), Gaps = 23/188 (12%)

Query  6    LPTLAVTALGAASV---VVDAHQMMIFPEPFFLVDGK-DAQWKPLAFLENQGVNTSADVA  61
            + TLA+T    AS    + +AH  +  P+  FL      ++W  +           +D A
Sbjct  8    ITTLALTVAATASFSLQLANAHGYIEVPKSEFLAGTTYPSEW--IVEFSPPWTGDWSDPA  65

Query  62   GFM---KQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTH  117
             F    K+KGY+ LR+ ++D+            CG T+P    + IP+  T++ S    H
Sbjct  66   NFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIVH  116

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE+WLDD +VM  DNC   F  K  T+ +D+SSCKGSC LRW+WLG++   +R  WQ
Sbjct  117  PGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGER--WQ  174

Query  176  IYKECVSL  183
            +YK CV L
Sbjct  175  VYKNCVPL  182

>PYU1_G007476
Length=195

 Score = 105 bits (262),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 74/135 (55%), Gaps = 17/135 (13%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI----  110
            N   D A   KQKGY  LR+ ++++            CGYT+P    + IP  G +    
Sbjct  61   NYMNDFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAH  111

Query  111  RSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYL  168
             + G+ H GPCE+WLD+  ++  DNC   FPG     P+D+SSCKG+C LR YWLG +  
Sbjct  112  SNVGFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQDQ  171

Query  169  KKRYSWQIYKECVSL  183
             +R  WQ YK CV +
Sbjct  172  GQR--WQTYKYCVPV  184

>PITG_05271
Length=278

 Score = 107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 92/185 (50%), Gaps = 21/185 (11%)

Query  14   LGAASVVVDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---  67
            L A+    DAH  M+ PE  F      A   Q  P+   E+   N    V  F   K   
Sbjct  14   LAASIPSTDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTAN  73

Query  68   GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLD  126
             + +L+ LMDD  +Y        +CG+TDP  ++QPIP  G    S    H GPCE+WLD
Sbjct  74   KFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLD  127

Query  127  DVKVMSGDNCHDKFPGKT------FPLDYSSC-KGSCT-LRWYWLGVRYLKKRYSWQIYK  178
            D KV+  D+C  K+  +       FP+DYSSC  G C  +R+YWL  + +  +  WQ YK
Sbjct  128  DTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYK  187

Query  179  ECVSL  183
            +C+ L
Sbjct  188  DCIPL  192

>PHYSO_533903
Length=208

 Score = 104 bits (260),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 98/180 (54%), Gaps = 24/180 (13%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQW----KPLAFLENQGVNTSADVAGFMKQK---GYANLR  73
            VDAH  +  P+  F   G+++QW     P+   ++   NT+  V  F   K    + +L+
Sbjct  22   VDAHGYIYVPQSQF-KGGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDLK  80

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCEVWLDDVKVMS  132
             ++DD  LY        +CG+TDP    QPIPT G  + S G  H GPCE WLDD KV+ 
Sbjct  81   TMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  133  GDNCHDKFPGKT------FPLDYSSCK-GSC-TLRWYWLGVRYL-KKRYSWQIYKECVSL  183
             D+C+ ++          FP+DYSSC+ G C  +R+YWLG + L  K+  WQ YK+C+ L
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIPL  194

>PHYSO_438103
Length=238

 Score = 104 bits (259),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 90/179 (50%), Gaps = 23/179 (13%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQW----KPLAFLENQGVNTSADVAGFMKQK---GYANLR  73
             DAH  M+ PE  F   G ++ W     P+   +    N +  V  F   K    + +L+
Sbjct  20   ADAHGYMLIPESQF-TGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLK  78

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMS  132
             LMDD  +Y        +CG+TDP    QPIPT G    S    H GPCE+WLD+ KV+ 
Sbjct  79   TLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLY  132

Query  133  GDNCHDKFPGKT------FPLDYSSCK-GSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
             D+C  K+  +       FP+DYSSC  G C  +R+YWL  + L  +  WQ YK+C+ L
Sbjct  133  EDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PHYKE_6001
Length=289

 Score = 105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 88/178 (49%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGF---MKQKGYANLRA  74
             DAH  M+ PE  F      A   Q  P+   E+   N +  V  F    K   Y +L+ 
Sbjct  21   ADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTAFNALKKANNYVDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP    QPIP+ G    S    H GPCE+WLDD  V S 
Sbjct  81   LMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVFSD  134

Query  134  DNCHDKFPGKT------FPLDYSSCK-GSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
            ++C+ K+  +       FP+DYSSC  G C  +R+YWL  + +  +  WQ YK C+ L
Sbjct  135  EDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPL  192

>PHYSO_340332
Length=295

 Score = 104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 88/178 (49%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---GYANLRA  74
             DAH  M+ PE  F      A   Q  P+    +   N +  V  F   K    + +L+ 
Sbjct  21   ADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP    QPIPT G    S    H GPCE+WLDD KV+  
Sbjct  81   LMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLYE  134

Query  134  DNCHDKFPGKT------FPLDYSSC-KGSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
            D+C  K+  +       FP+DYSSC  G C  +R+YWL  + +  +  WQ YK+C+ L
Sbjct  135  DDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYRA_74651
Length=344

 Score = 105 bits (261),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 97/202 (48%), Gaps = 31/202 (15%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDA-----------QWKPLAFLENQ  52
            S LP  A  AL   +V V+AH  +  P   F+     A            W   +  +N+
Sbjct  6    SILPITA--ALVVFAVQVNAHGYVSNPLSEFVDSETSAWVVQIDPQWAGDWDSCSSDDNE  63

Query  53   GVNTSADVAGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR  111
             + T        +  GY+++R L+D D  LY        +CG+TDP    +  P+TG   
Sbjct  64   CLTTL--YTSLKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDAT  115

Query  112  -STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYW  162
             S G  H GPCE+WLDD KV+S DNC   +   T        P+DYSSC  G CTLR+YW
Sbjct  116  FSRGMVHAGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYW  175

Query  163  LGVRYLKKRYSWQIYKECVSLS  184
            L  + L     WQ+YK CV L+
Sbjct  176  LAFQGLDSSTVWQVYKNCVPLT  197

>PHYSO_340333
Length=284

 Score = 103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 88/178 (49%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---GYANLRA  74
             DAH  M+ PE  F      A   Q  P+    +   N +  V  F   K    + +L+ 
Sbjct  21   ADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDAFKALKTANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP    QPIPT G    S    H GPCE+WLDD KV+  
Sbjct  81   LMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKVLYE  134

Query  134  DNCHDKFPGKT------FPLDYSSC-KGSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
            D+C  K+  +       FP+DYSSC  G C  +R+YWL  + +  +  WQ YK+C+ L
Sbjct  135  DDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  192

>PHYRA_78689
Length=296

 Score = 103 bits (258),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 87/178 (49%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---GYANLRA  74
             DAH  M+ PE  F      A   Q  P+   +    N    V  F   K    + +L+ 
Sbjct  21   ADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNPQSVDTFKSLKTANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP    QPIPT G    S    H GPCE+WLDD KV+  
Sbjct  81   LMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVLYE  134

Query  134  DNCHDKFPGK------TFPLDYSSCK-GSC-TLRWYWLGVRYLKKRYSWQIYKECVSL  183
            D+C  K+  +       FP+DYSSC  G C  +R+YWL  + L  +  WQ YK+C+ L
Sbjct  135  DDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PHYKE_6002
Length=197

 Score = 100 bits (249),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 87/174 (50%), Gaps = 18/174 (10%)

Query  14   LGAASVVVDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGF---MKQK  67
            + A+   V+AH  M+ PE  F  D   A   Q  P+    +   N    V  F    K  
Sbjct  14   MAASIPQVNAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKAN  73

Query  68   GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLD  126
             + +L+ LMDD  +Y        +CG+TDP+   QPIP+ G    S    H GPCE+WLD
Sbjct  74   NFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLD  127

Query  127  DVKVMSGDNCHDKFPGKTFPLDYSSCK-GSCT-LRWYWLGVRYLKKRYSWQIYK  178
              K  S DNC D    +TFP+DYSSC  G C  +R+YWL  + L  +  WQ Y+
Sbjct  128  STKAFSKDNCADM---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PYU1_G005323
Length=251

 Score = 102 bits (253),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 77/133 (58%), Gaps = 13/133 (10%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
             T A  A     KGY +L++ ++D+            CG + P  +++PIP+ G I+ ++
Sbjct  55   RTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLAS  105

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
               H GPCEVW DDV+    D+C   F   T F +D+S+CKGSC LR+YWLG++   KR 
Sbjct  106  TIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGKR-  164

Query  173  SWQIYKECVSLSD  185
             WQ YK C+ L+D
Sbjct  165  -WQSYKNCIPLTD  176

>PYVX_14662
Length=540

 Score = 105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 95/192 (49%), Gaps = 27/192 (14%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDA-------QWKPLAF-LENQG-VNTSADV  60
            A  AL A    V  H  M+ PE  F      A       QW   ++   NQG V+T   +
Sbjct  11   AAVALSATIARVRGHGYMLVPESQFKDSTTSAWVVQIEPQWASDSWDGNNQGSVDTYKSL  70

Query  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDG  119
            A    +KG   +R+L+DD  +Y  +      CG+TDP   +Q IPT G    S G  H G
Sbjct  71   AA---EKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIPTDGKATFSRGMVHVG  121

Query  120  PCEVWLDDVKVMSGDNCHDKFPG------KTFPLDYSSCK-GSC-TLRWYWLGVRYLKKR  171
            PCE+WLDD  V+  D+C+  + G        FP+DYSSC  G C  +R+YWL  + +   
Sbjct  122  PCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGD  181

Query  172  YSWQIYKECVSL  183
              WQ+YK C+ L
Sbjct  182  TVWQVYKNCIPL  193

>PYIW_27477
Length=180

 Score = 99.8 bits (247),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 14/123 (11%)

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYT  116
            A+ A   K+KG+  LR+ ++D+           +CG TDP  +++ IP+   ++ S    
Sbjct  39   ANFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIV  89

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSW  174
            H GPCE+W+DD +VM  DNC   F  K  T+ +D+S+CKG C LRW+WLG++   KR  W
Sbjct  90   HPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGKR--W  147

Query  175  QIY  177
            Q+Y
Sbjct  148  QVY  150

>PHALS_03177
Length=259

 Score = 101 bits (252),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 96/198 (48%), Gaps = 30/198 (15%)

Query  9    LAVTALGAASVVV--------DAHQMMIFPEPFFLVDGKD---AQWKPLAFLENQGVNTS  57
            +  TAL A+++V+        D+H  M  P   F   G D    Q +PL    +   NT 
Sbjct  1    MTRTALIASTIVIFATLTPSIDSHGYMYIPRTQFKGQGNDGWIVQIEPLWKSSDWNGNTQ  60

Query  58   ADVAGFMKQKG---YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
              V  F   K    + +L+ LMD+  L         +CGY+DP  + QPIP  G    S 
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSR  113

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPG------KTFPLDYSSC-KGSC-TLRWYWLGV  165
               H GPCE+WLD+ KV+  D+C+ K+          FP+DYSSC  G C  +R+YWL  
Sbjct  114  AMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAF  173

Query  166  RYLKKRYSWQIYKECVSL  183
            + +  +  WQ YK C+ L
Sbjct  174  QGINGKTFWQSYKMCIPL  191

>PPTG_04622
Length=273

 Score = 101 bits (252),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 74/130 (57%), Gaps = 16/130 (12%)

Query  65   KQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCE  122
            +  GY+++RAL+D D  LY  N      CG+TDP    +  PTTG    S G  H GPCE
Sbjct  74   ESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRGMVHAGPCE  127

Query  123  VWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCK-GSCTLRWYWLGVRYLKKRYSW  174
            +WLDD  V+S D+C   +   T        P+DYSSC  G C LR+YWL  + +  +  W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMVW  187

Query  175  QIYKECVSLS  184
            Q+YK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PHALS_03176
Length=207

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 94/198 (47%), Gaps = 30/198 (15%)

Query  9    LAVTALGAASVVV--------DAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTS  57
            +  TAL A++V++        D H  M+ P+  F      A   Q  PL    +   NT 
Sbjct  1    MTTTALIASTVLIFATFISNTDGHGYMLIPQAQFKGSANSAWIVQIDPLWKSSDWNGNTQ  60

Query  58   ADVAGFMKQKG---YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
              V  F K K    + +L+ LMD             +CG++DP  + QPIP  G    S 
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMDTSAFGA-------KCGFSDPKGKPQPIPKDGKATFSR  113

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPG------KTFPLDYSSC-KGSCT-LRWYWLGV  165
               H GPCE+WLD+ KV+  D+C+ K+          FP+DYSSC  G C  +R+YWL  
Sbjct  114  AIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAF  173

Query  166  RYLKKRYSWQIYKECVSL  183
            + +  +  WQ YK C+ L
Sbjct  174  QGVNGKTVWQSYKNCIPL  191

>PYIR_16444
Length=182

 Score = 98.6 bits (244),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 95/188 (51%), Gaps = 19/188 (10%)

Query  4    SFLPTLAVTALGAASVV---VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTS--A  58
            S L  +A  AL   +V    VDAH  +  P+  F+    +     + F      N     
Sbjct  3    SALQVIATVALATTAVTIPQVDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGNWKDPK  62

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTH  117
            + A   KQKG+  LR+ ++       N  A+  CG T+     +PIP+ G +  S    H
Sbjct  63   NFAKVAKQKGFPTLRSYIE-------NKGAI--CGKTNAKATPKPIPSDGKVHFSRAIVH  113

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE+WLD+ +V   DNC   F  K   + +D+SSCKG+C LR++WLG++   KR  WQ
Sbjct  114  PGPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGKR--WQ  171

Query  176  IYKECVSL  183
            +YK CV +
Sbjct  172  VYKNCVPV  179

>PPTG_14221
Length=275

 Score = 100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 87/178 (49%), Gaps = 21/178 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQKG---YANLRA  74
            V+AH  M+ PE  F      A   Q  P+   +    N    V  F   K    + +L+ 
Sbjct  21   VEAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPKSVDTFKSLKAANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+T+P    QPIPT G    S    H GPC +WLDD  V+  
Sbjct  81   LMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWLDDKMVLYE  134

Query  134  DNCHDKFPGKT------FPLDYSSC-KGSC-TLRWYWLGVRYLKKRYSWQIYKECVSL  183
            D+C  K+  +       FP+DYSSC  G C  +R+YWL  + L K+  WQ YK+C+ L
Sbjct  135  DDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKDCIPL  192

>PYAP_18709
Length=235

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 75/132 (57%), Gaps = 13/132 (10%)

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STG  114
            T A  A     KG+ +LR+ ++D+            CG + P    +PIP+ GTI+ ++ 
Sbjct  56   TGAQYAAVAPGKGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLAST  106

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYS  173
              H GPCEVWLD+ +    D+C   F   T F +D+ +CKGSC LR+YWLG++   KR  
Sbjct  107  IEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGKR--  164

Query  174  WQIYKECVSLSD  185
            WQ YK C+ L+D
Sbjct  165  WQSYKNCIPLND  176

>PHYSO_533682
Length=278

 Score = 100 bits (249),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 74/130 (57%), Gaps = 15/130 (12%)

Query  63   FMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPC  121
            F     + +L+ LMDD  +Y        +CG+TDP    QPIPT G    S G  H GPC
Sbjct  69   FKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGPC  122

Query  122  EVWLDDVKVMSGDNCHDKF--PGK----TFPLDYSSC-KGSCT-LRWYWLGVRYLKKRYS  173
            E+WLDD KV+S D+C+ K+  P +    TFP+DYSSC  G C  +R Y LG + L  +  
Sbjct  123  EIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTV  182

Query  174  WQIYKECVSL  183
            WQ YK C+ L
Sbjct  183  WQSYKNCIPL  192

>PHYCA_534473
Length=1050

 Score = 103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 76/134 (57%), Gaps = 16/134 (12%)

Query  61   AGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHD  118
            A   +  GY+++R L+D D  LY  N      CG+TDP   ++  PTTG    S G  H 
Sbjct  842  ASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVHA  895

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLKK  170
            GPCE+WLDD KV+S D+C   +   T        P+DYSSC  S C LR+YWL  + +  
Sbjct  896  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  955

Query  171  RYSWQIYKECVSLS  184
            +  WQ+YK+CV L+
Sbjct  956  KIVWQVYKDCVPLT  969

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 68/132 (52%), Gaps = 16/132 (12%)

Query  63   FMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGP  120
              K     ++R ++D D KLY  +      CG TDP  + +  P+TG    S G  H GP
Sbjct  539  LKKSNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGIVHAGP  592

Query  121  CEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRY  172
            CE+WLDD  V+  D+C   +   T        P+DYSSC  G C  R+YWL ++    + 
Sbjct  593  CEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKT  652

Query  173  SWQIYKECVSLS  184
             WQ+YK C+ L+
Sbjct  653  LWQVYKNCIPLT  664

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 89/182 (49%), Gaps = 31/182 (17%)

Query  9    LAVTALGAASV-VVDAHQMMIFPEPFF-------LVDGKDAQWKPLAFLENQG----VNT  56
            LA+ A  A +V  V AH  +  P P +        V   + QWK   + E++G    ++T
Sbjct  8    LALVAAVATTVDYVQAHGYIAKPAPSWKDKETNDWVVEIEPQWK-GGWDESKGDPGLLST  66

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGY  115
              ++A    +  Y ++R LMD   +Y  +      CG+TDP       PT GT   S G 
Sbjct  67   FKELAA---KNNYKDVRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGI  117

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRY  167
             H GPCE+WLDD  V+  D+C   +   T        P+DYSSC  G C LR+YWL ++ 
Sbjct  118  VHAGPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQR  177

Query  168  LK  169
            LK
Sbjct  178  LK  179

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 59/108 (55%), Gaps = 16/108 (15%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R L+D D KLY  +      CGYT+P    +  PT GT   S G  H GPCE+WLDD 
Sbjct  284  DIRTLLDSDTKLYGAD------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDK  337

Query  129  KVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYL  168
             V+S D+C   +   T        P+DYSSC  G C  R+YWL ++ L
Sbjct  338  MVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PYIR_16443
Length=275

 Score = 100 bits (248),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 73/126 (58%), Gaps = 15/126 (12%)

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTH  117
            + A   KQKG+  LR+ ++D+            CG T+P    + IP+   ++ S    H
Sbjct  63   NFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVH  113

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE+WLDD +VM  DNC   F  K  T+ +D+SSCKGSC LRW+WLG++   KR  WQ
Sbjct  114  PGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGKR--WQ  171

Query  176  IY-KEC  180
            +Y K C
Sbjct  172  VYSKSC  177

>PHYCA_534296
Length=309

 Score = 100 bits (249),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 89/172 (52%), Gaps = 21/172 (12%)

Query  27   MIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---GYANLRALMDDEK  80
            M+ PE  F      A   Q  P+   ++   N +  V  F   K    + +L+ LMDD  
Sbjct  1    MLIPESQFSGSANSAWIVQIDPVWASDSWDGNNAGSVETFKSLKSANNFKDLKTLMDDTS  60

Query  81   LYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSGDNCHDK  139
            +Y        +CG+T+P+  +QPIPT G    S    H GPCE+WLDD KV+  D+C+ K
Sbjct  61   VYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWLDDTKVLYEDDCYSK  114

Query  140  FPGKT------FPLDYSSC-KGSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
            +  +       FP+DYSSC  G C  +R+YWL  + +  +  WQ YK+C+ L
Sbjct  115  YGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIPL  166

>PYAP_18711
Length=210

 Score = 98.2 bits (243),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 13/131 (10%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
             T A      K++G  NLRA ++ +           ECG T+P  + +PIP+ G I+  +
Sbjct  56   RTGAQYDAERKKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGS  106

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
               H GPCEVW D+  V S  +C  +F   T F +DYS CKG+C LR+YWLG++   KR 
Sbjct  107  SMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGKR-  165

Query  173  SWQIYKECVSL  183
             WQ YK CV +
Sbjct  166  -WQSYKNCVPI  175

>PHYRA_73584
Length=287

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 100/203 (49%), Gaps = 32/203 (16%)

Query  5    FLPTLAVTALGAASVV-VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-----------  52
             + T A+ ++ AA +  V AH  M  P   F VD + + W  +  +E Q           
Sbjct  1    MVSTTAILSVVAAMLSQVSAHGYMYIPLAEF-VDSETSAW--VVQIEPQWTGDWDSCSSS  57

Query  53   -GVNTSADVAGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-T  109
                 +   +   K  GY+++R L+D D  LY  N      CG+T+P   ++  PTTG  
Sbjct  58   DDDCLTTLYSSLKKSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDA  111

Query  110  IRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF------PGKTF-PLDYSSCKGS-CTLRWY  161
              S G  H GPCE+WLDD  V+S D+C   +          F P+DYSSC  S C LR+Y
Sbjct  112  TFSRGMVHAGPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFY  171

Query  162  WLGVRYLKKRYSWQIYKECVSLS  184
            WL  + +  +  WQ+YK+CV L+
Sbjct  172  WLAFQGVDSKTVWQVYKDCVPLT  194

>PYIW_19151
Length=248

 Score = 98.6 bits (244),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 98/195 (50%), Gaps = 29/195 (15%)

Query  5    FLPTLAVTALGAASVVV----DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD-  59
              PT  +TA+G A+ ++    DAH  +I P+        +    P  F+       + D 
Sbjct  1    MTPTTTLTAVGVATALMMSQTDAHGYIISPK-----AQGNGVGHPGTFVIEYPPPWTGDW  55

Query  60   -----VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
                  A   K+KG++ LR+ ++D+            CG+TDP    + IP   TIR S 
Sbjct  56   KDPKNFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSR  106

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKR  171
               H GPCE+++DD +V   D+C   F G   ++ +D+S CKG C +R+YWLG++    R
Sbjct  107  DIPHPGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASGTR  166

Query  172  YSWQIYKECVSLSDN  186
              WQ+YK CV +S +
Sbjct  167  --WQVYKSCVPVSSS  179

>PPTG_04647
Length=327

 Score = 99.4 bits (246),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 73/130 (56%), Gaps = 16/130 (12%)

Query  65   KQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCE  122
               GY+++R L+D D  LY        +CGYT+P   ++  PTTG    S G  H GPCE
Sbjct  73   SSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  126

Query  123  VWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSCKGS-CTLRWYWLGVRYLKKRYSW  174
            +WLDD  V+S DNC   +   T        P+DYSSC  S C LR+YWL  + +  +  W
Sbjct  127  IWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  186

Query  175  QIYKECVSLS  184
            Q+YK+CV L+
Sbjct  187  QVYKDCVPLT  196

>PHYKE_10578
Length=239

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 93/189 (49%), Gaps = 24/189 (13%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKG  68
            +  A+ A +   DAH  +  PEP F      + W  +  ++N   + +  D  G  K K 
Sbjct  9    SAVAILAFTSHADAHGALKVPEPTFEQGASHSNW--VTLVDNYWDIGSGGDQVG--KFKT  64

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEV  123
             A  + +   + + ++  D   +CG+T    + QP+P+ G +      + G+TH GPCEV
Sbjct  65   MATEKGMSVKDVILDMVKDK--KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEV  122

Query  124  WLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            ++DD  V+ GDNC D++PG            +DYSSC G C L +YWLG +       WQ
Sbjct  123  YIDDKLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQ----NEQWQ  178

Query  176  IYKECVSLS  184
             Y  CV L+
Sbjct  179  SYVNCVPLT  187

>PHYSO_533747
Length=206

 Score = 96.3 bits (238),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 93/174 (53%), Gaps = 24/174 (14%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQW----KPLAFLENQGVNTSADVAGFMKQK---GYANLR  73
            VDAH  +  P+  F   G+++QW     P+   ++   NT+  V  F   K    + +L+
Sbjct  22   VDAHGYIYVPQSQF-KGGENSQWLVQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDLK  80

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCEVWLDDVKVMS  132
             ++DD  LY        +CG+TDP    QPIPT G  + S G  H GPCE WLDD KV+ 
Sbjct  81   TMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLY  134

Query  133  GDNCHDKFPGKT------FPLDYSSCK-GSC-TLRWYWLGVRYL-KKRYSWQIY  177
             D+C+ ++          FP+DYSSC+ G C  +R+YWLG + L  K+  WQ Y
Sbjct  135  ADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTY  188

>PHYCA_130365
Length=266

 Score = 97.4 bits (241),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 96/200 (48%), Gaps = 27/200 (14%)

Query  5    FLPTLAVTALGAASVVVD---AHQMMIFPEPFF-------LVDGKDAQWKPLAFLENQG-  53
             + + ++ AL +A   VD   AH  +  PEP +        V   + QWK   + E++G 
Sbjct  1    MVSSTSILALVSAVATVDYVQAHGYIAKPEPSWKGKKTSDWVVEIEPQWK-GGWDESKGD  59

Query  54   VNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-S  112
                A          Y ++R++MD   +Y        +CG+TDP       PT GT   S
Sbjct  60   EGLLATFKELAASNNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFS  113

Query  113  TGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLG  164
             G  H GPCE+WLDD  V+  D+C   +   T        P+DYSSC  G C LR+YWLG
Sbjct  114  RGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLG  173

Query  165  VRYLKKRYSWQIYKECVSLS  184
            ++ L  +  WQ YK C+ L+
Sbjct  174  LQRLDGKTVWQAYKNCIPLT  193

>PYVX_16138
Length=559

 Score = 100 bits (249),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 88/185 (48%), Gaps = 23/185 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFF-------LVDGKDAQWKPLAFLENQGVNTSADVAG  62
            AV A+      V  H  M+ PE  F        +   D QW+   +  N   +    V+ 
Sbjct  11   AVFAVALCVSRVQGHGYMLIPESQFSGTATSSWIVQIDPQWESDGWNGNSQDSVDTYVS-  69

Query  63   FMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPC  121
              ++KG   +R+L+DD  +Y        +CGYTDP   +Q IPT  T   S G  H GPC
Sbjct  70   LAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPC  123

Query  122  EVWLDDVKVMSGDNCHDKFPG------KTFPLDYSSC--KGSCTLRWYWLGVRYLKKRYS  173
            E+WLDD  V+  D+C+  + G        FP+DYSSC   G   +R+YWL  + +     
Sbjct  124  EIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETV  183

Query  174  WQIYK  178
            WQ+Y 
Sbjct  184  WQVYS  188

>PHYRA_73606
Length=366

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 93/195 (48%), Gaps = 27/195 (14%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV--NTSAD--------  59
            AV +L  A   V+AH  M  P   F  D   + W      +  G     S+D        
Sbjct  10   AVVSLAVAFQNVNAHGYMYIPLAEF-TDSVTSAWVVQISPQWSGDWDTCSSDDSDCLTSV  68

Query  60   VAGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTH  117
              G     GY+++R L+D D  LY        +CGYT+P   ++  PTTG    S G  H
Sbjct  69   YTGLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVH  122

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLK  169
             GPCE+WLDD  V+S D+C   +   T        P+DYSSC  S C LR+YWL  + + 
Sbjct  123  VGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVD  182

Query  170  KRYSWQIYKECVSLS  184
                WQ+YK+CV L+
Sbjct  183  SEIVWQVYKDCVPLT  197

>PHYRA_73607
Length=343

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 73/134 (54%), Gaps = 16/134 (12%)

Query  61   AGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHD  118
            +      GY+++R L+D D  LY  +      CG+T+P   ++  PTTG    S G  H 
Sbjct  70   SSLKSSNGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVHV  123

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLKK  170
            GPCE+WLDD KV+S DNC   +   T        P+DYSSC  S C LR+YWL  + +  
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  171  RYSWQIYKECVSLS  184
               WQ+YK CV L+
Sbjct  184  SMVWQVYKNCVPLT  197

>PHYCA_12942
Length=353

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 89/172 (52%), Gaps = 21/172 (12%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKGYANLRALMDDE  79
             DAH  +  P+P F  DG  A+W  +  ++N   + +  D  G  K K  A  R +   +
Sbjct  20   ADAHGSLKQPKPTF--DGSSAEW--VTMIDNYWDIGSGGDQVG--KFKTMAAERGMSVKD  73

Query  80   KLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGD  134
             + ++  D   +CGYT      QPIP+ G ++       G+TH GPCE+++DD  V+ GD
Sbjct  74   VILDMVKDK--KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGD  131

Query  135  NCHDKFPG---KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            NC ++F G       +DYSSC G+C L  YWLG +  +    WQ Y  CV L
Sbjct  132  NCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PPTG_03139
Length=320

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 90/193 (47%), Gaps = 26/193 (13%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLE--------NQGVNTSADVA  61
            A+ A    +  V  H  M  P+  F  +G   Q+  +A +E        N G + + + A
Sbjct  10   AIAASAMLASTVKGHGYMSVPKVEFTFNGDTTQY--MATIEASSSGFSGNFGQSPTDNTA  67

Query  62   GFMK---QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT------GTIRS  112
             F K      Y++L+  M D K+  V+ D   ECGYT+P    QP+P T      G+   
Sbjct  68   NFNKGFAASKYSSLKEFMTD-KMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEG  126

Query  113  TGYTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKK  170
               +H+GPCEVW DD +V   DNC   FP      P D+ +C GS  L  YW+ +     
Sbjct  127  FTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH----  182

Query  171  RYSWQIYKECVSL  183
              SWQ+Y  C +L
Sbjct  183  SPSWQVYINCAAL  195

>PHYSO_483955
Length=320

 Score = 97.4 bits (241),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/196 (35%), Positives = 95/196 (48%), Gaps = 29/196 (15%)

Query  9    LAVTALGAASV-VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ---GVNTSADVAGFM  64
            LA+ A  A ++  V AH  +  PEP +  D K   W  +  +E Q   G + S    G +
Sbjct  8    LAMVAAVATTIDYVQAHGYIAKPEPSWK-DKKTNDW--VVEIEPQWKGGWDESKGDEGLL  64

Query  65   KQ-------KGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYT  116
                       Y ++R+LMD   +Y        +CG+TDP  +    PT GT   S G  
Sbjct  65   ATFKELSAANNYKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIV  118

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYL  168
            H GPCE+WLDD  V+  D+C   +   T        P+DYSSC  G C LR+YWL ++ L
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  169  KKRYSWQIYKECVSLS  184
              +  WQ YK C+ L+
Sbjct  179  DGKTVWQAYKNCIPLT  194

>PHYRA_83499
Length=473

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 87/186 (47%), Gaps = 26/186 (14%)

Query  13   ALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANL  72
            AL A +   DAH  +  PE  F       +W  L       ++   D+     Q G    
Sbjct  12   ALLAFASHADAHGNLKEPEATFEDGAPTVEWVTL-------IDNYWDIGSGGDQVGKYKT  64

Query  73   RALMDDEKLYEVNTDALFE--CGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWL  125
             A      + +V  D + +  CGYT    + QPIPT G ++       G+TH GPCE+++
Sbjct  65   MAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYI  124

Query  126  DDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            DD  V+ GD+C +++PG           P+DYSSC G CTL  YWL  +  +    WQ Y
Sbjct  125  DDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAY  180

Query  178  KECVSL  183
              CVSL
Sbjct  181  VNCVSL  186

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 12/67 (18%)

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKT--------FPLDYSSCKGSCTLRWYWLGVRYLKK  170
            GPCE++LDD  ++ GDNC D++ G           P+DYSSC G+CTL  YWLG +    
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQ----  406

Query  171  RYSWQIY  177
               WQ Y
Sbjct  407  NEQWQAY  413

>PHYRA_86752
Length=300

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 86/186 (46%), Gaps = 26/186 (14%)

Query  13   ALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANL  72
            AL A +   DAH  +  PE  F       +W  L       ++   D+     Q G    
Sbjct  12   ALLAFASHADAHGNLKEPEATFEDGAPTVEWVTL-------IDNYWDIGSGGDQVGKYKT  64

Query  73   RALMDDEKLYEVNTDALFE--CGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWL  125
             A      + +V  D + +  CGYT    + QPIPT G ++       G+TH GPCE+++
Sbjct  65   MAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYI  124

Query  126  DDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            DD  V+ GD+C +++PG           P+DYSSC G CTL  YWL  +  +    WQ Y
Sbjct  125  DDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAY  180

Query  178  KECVSL  183
              CV L
Sbjct  181  VNCVPL  186

>PYAR_14256
Length=199

 Score = 94.0 bits (232),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 12/129 (9%)

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGY  115
            T A  A     KG+ NLRA ++D+            CG T P  + +P        ++  
Sbjct  53   TGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLASTI  103

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSW  174
             H GPCE+WLDD      D+C  KF   T F +D+S+CKGSC LR+YWLG++   KR  W
Sbjct  104  EHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGKR--W  161

Query  175  QIYKECVSL  183
            Q YK C+ L
Sbjct  162  QSYKNCIPL  170

>PHYSO_485524
Length=278

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 97/206 (47%), Gaps = 34/206 (17%)

Query  1    MAPSFLPTLAVTALGAASV-VVDAHQMMIFPEPFF-------LVDGKDAQWKPLAFLENQ  52
            M+P+ +  LA T   A SV  V AH  +  PE  F        +   D QWK     +  
Sbjct  2    MSPASI--LAATLAVALSVNTVQAHGYVEKPESEFKDKISSEWIVQIDPQWKG----DWD  55

Query  53   GVNTSADVAGFMKQKGYAN----LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTT  107
            G      +    K+   +N    +R L+D D KLY  N      CGYT+P    +  PT 
Sbjct  56   GAKGDEGLVALYKELKDSNNAKDIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTD  109

Query  108  GTIR-STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSC-KGSCTL  158
            GT   S G  H GPCE+WLDD  V+  D+C   +   T        P+DYSSC  G C  
Sbjct  110  GTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMF  169

Query  159  RWYWLGVRYLKKRYSWQIYKECVSLS  184
            R+YWL ++ L  +  WQ+YK C+ LS
Sbjct  170  RFYWLALQRLDGKTYWQVYKNCIPLS  195

>PYU1_G014690
Length=295

 Score = 95.9 bits (237),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 72/130 (55%), Gaps = 16/130 (12%)

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYT  116
            A+ A   K+KG+  LR+ ++D+            CG TDP    + IP+   +  S    
Sbjct  61   ANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIV  111

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFP---LDYSSCKGSCTLRWYWLGVRYLKKRYS  173
            H GPCE+WLDD +VM  D+C   F G   P   +D+SSCK +C LR++WLG++    R  
Sbjct  112  HPGPCEIWLDDKRVMQDDDCEATF-GDEIPVWNIDFSSCKSNCMLRFFWLGLQDSGTR--  168

Query  174  WQIYKECVSL  183
            WQ+YK CV L
Sbjct  169  WQVYKNCVPL  178

>PHYCA_69583
Length=224

 Score = 94.4 bits (233),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 98/210 (47%), Gaps = 42/210 (20%)

Query  4    SFLPTLAVTALGAASVV--VDAHQMMIFPEPFF-----------LVDGKDAQWKPLAFLE  50
            S  P  A TA+  A  +  V AH  M  P   F           +     A W+ +A   
Sbjct  3    SATPLFAATAVAVAGCLTAVQAHGYMYIPLTEFKGTPTGAWIVQITPQLQANWESVA---  59

Query  51   NQGVNTSADVAGFM---KQKGYAN-LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIP  105
                N    +A ++   K+ GYAN +R L+D D  LY  N      CG+++P  +++  P
Sbjct  60   ----NDEELIALYVEKAKEAGYANNIRKLLDSDTNLYGAN------CGFSNPDAKAKDPP  109

Query  106  TTGTIR-STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTF--------PLDYSSCKGS-  155
            + GT     G  H GPCE+WLDD  V+  D+C   F    +        P+DYSSC  S 
Sbjct  110  SDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSG  169

Query  156  CTLRWYWLGVR-YLKKRYSWQIYKECVSLS  184
            C  R+YWL  +     +Y WQIYK+C+ L+
Sbjct  170  CMFRFYWLAFQGSTSGKYVWQIYKDCIPLT  199

>PHYKE_2937
Length=366

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 72/130 (55%), Gaps = 16/130 (12%)

Query  65   KQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCE  122
               GY+++R L+D D  LY        +CGYT+P   ++  PTTG    S G  H GPCE
Sbjct  78   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  131

Query  123  VWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLKKRYSW  174
            +WLDD  V+S D+C   +   T        P+DYSSC  S C LR+YWL  + +     W
Sbjct  132  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMVW  191

Query  175  QIYKECVSLS  184
            Q+YK+CV L+
Sbjct  192  QVYKDCVPLT  201

>PYAP_24689
Length=252

 Score = 94.4 bits (233),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 13/135 (10%)

Query  54   VNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-S  112
            + T A      K+ G   LRA ++ +            CG T+P  + +PIP  G I+  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  113  TGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKR  171
            +   H GPCE+W D+ +V    +C+ +F   T F +DYS C+G C LR+YWLG++   KR
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGKR  168

Query  172  YSWQIYKECVSLSDN  186
              WQ YK CV L ++
Sbjct  169  --WQSYKNCVPLGND  181

>H310_06362
Length=197

 Score = 93.2 bits (230),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 72/142 (51%), Gaps = 26/142 (18%)

Query  55   NTSADVAGFMKQ--KGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI--  110
            N +A    F  Q   G+  LRA++D             +CGYT     ++PIPT G +  
Sbjct  36   NAAAFTKAFSDQMATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVW  86

Query  111  ----RSTGY--THDGPCEVWLDDVKVMSGDNCHDKFPGK---TFPLDYSSCKGSCTLRWY  161
                   G+  +H GPCE+WLD+ +V   +NC   FP K     P+D+SSC GSCT+R+Y
Sbjct  87   QNPDTGEGFVPSHTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFY  146

Query  162  WLGVRYLKKRYSWQIYKECVSL  183
            WL +        WQ+YK C  L
Sbjct  147  WLALH----EDLWQVYKNCAPL  164

>PHYRA_86016
Length=236

 Score = 93.6 bits (231),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 60/106 (57%), Gaps = 17/106 (16%)

Query  91   ECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG---  142
            +CGYT    + QPIPT G ++       G+TH GPCE+++DD  V+ GD+C +++PG   
Sbjct  21   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  80

Query  143  -----KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
                    P+DYSSC G CTL  YWL  +  +    WQ Y  CV L
Sbjct  81   GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PHYKE_1913
Length=280

 Score = 94.4 bits (233),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 90/188 (48%), Gaps = 24/188 (13%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKG  68
            +  AL A S   DAH  +  PEP F       +W  +  +EN   + +  D  G  K K 
Sbjct  9    SAIALLAFSSRADAHGHLKSPEPTFEDGAPTVEW--VTLIENYWDIGSGGDQVG--KYKT  64

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEV  123
             A  + +   + + ++  D    CGYT    + +P+P+ G          G+TH GPCEV
Sbjct  65   MAAEKGMSVKDVVLDMVKDKT--CGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEV  122

Query  124  WLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            +++D  V+ GD+C D++PG           P+DYSSC G CTL  YWL  +  +    WQ
Sbjct  123  YINDKMVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQ  178

Query  176  IYKECVSL  183
             Y  CV L
Sbjct  179  AYINCVPL  186

>PITG_04948
Length=232

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 68/124 (55%), Gaps = 16/124 (13%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R L+D D  LY        +CGYT+P    +  PT GT   S G  H GPCE+WLDD 
Sbjct  78   DIRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDK  131

Query  129  KVMSGDNCHDKFPGKTF-------PLDYSSC-KGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
             V+  D+C   +   T        P+DYSSC  G C LR+YWL ++ L  +  WQ+YK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNC  191

Query  181  VSLS  184
            + LS
Sbjct  192  IPLS  195

>PPTG_04619
Length=276

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 96/202 (48%), Gaps = 25/202 (12%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV--NTSA  58
            M  S       +A+  ++  V AH  +  PE  F  D K ++W      + +G   N   
Sbjct  1    MVSSMSIVAVASAIAMSANYVQAHGYVENPESEFK-DKKTSEWIVQIDPQWKGDWDNAKG  59

Query  59   D---VAGFMKQKGYAN---LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR  111
            D   VA + + K   N   +R L+D D  LY        +CGYT+P    +  PT GT  
Sbjct  60   DEGLVALYKELKASNNAKDIRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTAT  113

Query  112  -STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSC-KGSCTLRWYW  162
             S G  H GPCE+WLDD  V+  D+C   +   T        P+DYSSC  G C  R+YW
Sbjct  114  FSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYW  173

Query  163  LGVRYLKKRYSWQIYKECVSLS  184
            L ++ L  +  WQ+YK C+ LS
Sbjct  174  LALQRLDGKTYWQVYKNCIPLS  195

>PITG_04949
Length=337

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 15/131 (11%)

Query  63   FMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPC  121
               +  + ++R+LMD   ++        ECG+TDP  +    P+ GT   S G  H GPC
Sbjct  70   LAPKNNFKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPC  123

Query  122  EVWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSCK-GSCTLRWYWLGVRYLKKRYS  173
            E+WLDD  V+  D+C   +   T        P+DYSSC  G C LR+YWL ++ LK +  
Sbjct  124  EIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTV  183

Query  174  WQIYKECVSLS  184
            WQ YK C+ L+
Sbjct  184  WQAYKNCIPLT  194

>PPTG_07509
Length=299

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 90/193 (47%), Gaps = 32/193 (17%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAG----F  63
            L+   L A + + DAH  +  P   F       +W  +  ++N   + +  D  G     
Sbjct  7    LSAITLLAFAPIADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTM  64

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHD  118
             K+KG +    ++D  K  +        CGYT    + +PIP  G ++       G+TH 
Sbjct  65   AKEKGMSVKDVVLDMVKDKK--------CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHV  116

Query  119  GPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKK  170
            GPCE+++DD  V+ GDNC + FPG           P+D+SSC G CTL  YWLG +  + 
Sbjct  117  GPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ-  175

Query  171  RYSWQIYKECVSL  183
               WQ Y  CV L
Sbjct  176  ---WQAYVNCVPL  185

>PYIR_23585
Length=240

 Score = 92.0 bits (227),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 93/184 (51%), Gaps = 20/184 (11%)

Query  6    LPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVN--TSADVAGF  63
            L TLA+TA+    V  +AH  +  P+  F      + W    F    G +  ++AD A  
Sbjct  8    LATLALTAVTVPQVA-NAHGYIATPKSEFKSGASQSSWV-AEFSSPWGGSKWSAADFAKT  65

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCE  122
               KG+A  RA ++              CG T      +PIP+  T++ S    H GPCE
Sbjct  66   APGKGFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCE  116

Query  123  VWLDDVKVMSGDNCHDKFPGKTFP---LDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            +W+D+ +V   D+C   F G + P   +D+S+CKGSC LR+YWLG++    R+  Q Y +
Sbjct  117  LWIDNTRVYHNDDCEAAF-GSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSK  173

Query  180  CVSL  183
            C++L
Sbjct  174  CLAL  177

>PHYCA_97965
Length=288

 Score = 93.2 bits (230),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 94/202 (47%), Gaps = 38/202 (19%)

Query  6    LPTLAVTALGAASVVV------DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSA  58
            + TLA  AL +A  +V      +AH  +  PE  F       +W  +  ++N   + +  
Sbjct  1    MNTLAGIALSSAIALVAFAPDANAHGNLKQPEATFKDGAPTVEW--VTLIDNYWDIGSGG  58

Query  59   DVAG----FMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR---  111
            D  G      K+KG +    ++D  K  +        CGYT    + QPIP+ G ++   
Sbjct  59   DQVGKFKTMAKEKGMSVKDVVLDMVKDKK--------CGYTRTDVDPQPIPSDGIVKWWG  110

Query  112  --STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWY  161
                G+TH GPCE+++DD  V+ GD+C D+FPG            +D+SSC G CTL  Y
Sbjct  111  NGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIY  170

Query  162  WLGVRYLKKRYSWQIYKECVSL  183
            WL  +       WQ Y  CV L
Sbjct  171  WLAFQ----NEQWQSYVNCVPL  188

>PHYRA_78175
Length=319

 Score = 93.2 bits (230),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 84/191 (44%), Gaps = 22/191 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW------KPLAFLENQGVNTSADVAGF  63
            A+      S  V  H  M  P+  F   G   Q+          F    G + + + A F
Sbjct  10   AIVGSAMLSATVQGHGSMSVPKVEFTFVGDTTQYMGTIDSSTSGFTGTFGGSPTDNTANF  69

Query  64   MK---QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTG------  114
             K      Y++L+  M D KL  VN +   ECGYT+P   +QP+P T    S G      
Sbjct  70   NKGFAASKYSSLKEFMAD-KLVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFT  128

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
             +H+GPCEVW DD +V   DNC   FP      P D  +C GS  L  YW+ +       
Sbjct  129  ASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SA  184

Query  173  SWQIYKECVSL  183
            SWQ+Y  C +L
Sbjct  185  SWQVYINCAAL  195

>PYU1_G005324
Length=191

 Score = 90.5 bits (223),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)

Query  9    LAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV-NTSADVAGFMK  65
            +A  AL  A+ +  V+ H  +  P   F      + W         G   T A  A    
Sbjct  7    IASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAVAP  66

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVW  124
            +KGY +L++ +D +            CG T    +++ IP  G ++ ++   H GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  125  LDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            L + +    D+C   F   T F +D+S+CKG+C LR+YWLG++   KR  WQ YK CV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  184  SDN  186
              +
Sbjct  176  KSS  178

>PYU1_G005326
Length=191

 Score = 90.5 bits (223),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)

Query  9    LAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV-NTSADVAGFMK  65
            +A  AL  A+ +  V+ H  +  P   F      + W         G   T A  A    
Sbjct  7    IASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAVAP  66

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVW  124
            +KGY +L++ +D +            CG T    +++ IP  G ++ ++   H GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  125  LDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            L + +    D+C   F   T F +D+S+CKG+C LR+YWLG++   KR  WQ YK CV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  184  SDN  186
              +
Sbjct  176  KSS  178

>PYU1_G005328
Length=191

 Score = 90.5 bits (223),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 88/183 (48%), Gaps = 16/183 (9%)

Query  9    LAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV-NTSADVAGFMK  65
            +A  AL  A+ +  V+ H  +  P   F      + W         G   T A  A    
Sbjct  7    IASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAVAP  66

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVW  124
            +KGY +L++ +D +            CG T    +++ IP  G ++ ++   H GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  125  LDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            L + +    D+C   F   T F +D+S+CKG+C LR+YWLG++   KR  WQ YK CV L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCVPL  175

Query  184  SDN  186
              +
Sbjct  176  KSS  178

>PPTG_07507
Length=299

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 89/193 (46%), Gaps = 32/193 (17%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAG----F  63
            L+   L A +   DAH  +  P   F       +W  +  ++N   + +  D  G     
Sbjct  7    LSAITLLAFAPTADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTM  64

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHD  118
             K+KG +    ++D  K  +        CGYT    + +PIP  G ++       G+TH 
Sbjct  65   AKEKGMSVKDVVLDMVKDKK--------CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHV  116

Query  119  GPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKK  170
            GPCE+++DD  V+ GDNC + FPG           P+D+SSC G CTL  YWLG +  + 
Sbjct  117  GPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ-  175

Query  171  RYSWQIYKECVSL  183
               WQ Y  CV L
Sbjct  176  ---WQAYVNCVPL  185

>PHYCA_98479
Length=276

 Score = 92.4 bits (228),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 60/106 (57%), Gaps = 17/106 (16%)

Query  91   ECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG---  142
            ECG+T      QP+PT G  +       G+TH GPCE+++DD  V+ GDNC D++PG   
Sbjct  85   ECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDV  144

Query  143  -----KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
                    P+DYSSCKG CTL  YWLG +  +    WQ Y  CV L
Sbjct  145  GSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PHYRA_86241
Length=195

 Score = 90.1 bits (222),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 91/192 (47%), Gaps = 26/192 (14%)

Query  6    LPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLA--FLEN-QGVNTSADVAG  62
            L   AV  LG  +  V AH  M+ P+  F      A    +A  F  N + V    ++  
Sbjct  7    LFAAAVATLGCLTTHVQAHGYMLIPQTEFKGTATGAWSVEIAPQFQANWESVADDTELIA  66

Query  63   FMKQK----GYAN-LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGY  115
               +K    GYAN +R L+D D  LY        +CG++DP  +++  P+ GT     G 
Sbjct  67   LYAEKATEAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGL  120

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGKTF--------PLDYSSCKGS-CTLRWYWLGVR  166
             H GPCE+WLDD  V+  D+C   F  + +        P+DYSSC  S C  R+YWL  +
Sbjct  121  AHHGPCEIWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQ  180

Query  167  -YLKKRYSWQIY  177
                 +Y WQIY
Sbjct  181  GSTSGKYVWQIY  192

>PHYRA_73582
Length=326

 Score = 92.8 bits (229),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 89/193 (46%), Gaps = 24/193 (12%)

Query  9    LAVTALGAASV-VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMK--  65
            LA+ A  A ++  V AH  +  P P +  +  +     +A L   G + S    G +   
Sbjct  8    LAMVAAAATTIDYVQAHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVF  67

Query  66   -----QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDG  119
                    Y +L+ LMD  +  E       +CG+TDP       PT GT   S G  H G
Sbjct  68   KELSATNNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAG  120

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKR  171
            PCE+WLDD  V+  D+C   +   T        P+DYS C  G C LR+YWL ++ L  +
Sbjct  121  PCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGK  180

Query  172  YSWQIYKECVSLS  184
              WQ YK C+ L+
Sbjct  181  AVWQSYKNCIPLT  193

>PYIR_22134
Length=300

 Score = 92.0 bits (227),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 88/184 (48%), Gaps = 28/184 (15%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKP-------------LAFLENQGVNTSADVAGFMKQK  67
            VDAH  M  P+P F + G   Q+               ++F  +   NT+A  A  +K  
Sbjct  26   VDAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAA-LKAS  84

Query  68   GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDGPC  121
             Y ++RAL++ + ++   + A  ECG T  T  +QP+P          S G+T  H GPC
Sbjct  85   TYDSVRALVEAKGVFI--SGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPC  142

Query  122  EVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKE  179
            EVW D+ KV S +NC   +P      P+D++ C G+  L+  WL +       +WQIY  
Sbjct  143  EVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQIYIN  198

Query  180  CVSL  183
            C  L
Sbjct  199  CAPL  202

>PHYCA_531163
Length=314

 Score = 92.4 bits (228),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 16/130 (12%)

Query  65   KQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCE  122
               GY+++R L+D D  LY        +CGYT+    ++  P+TG    S G  H GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  127

Query  123  VWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSCKGS-CTLRWYWLGVRYLKKRYSW  174
            +WLDD  V+S D+C   +   T        P+DYSSC  S C LR+YWL  + +     W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  175  QIYKECVSLS  184
            Q+YK+CV L+
Sbjct  188  QVYKDCVPLT  197

>PHYSO_484051
Length=285

 Score = 91.7 bits (226),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 72/134 (54%), Gaps = 16/134 (12%)

Query  61   AGFMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHD  118
            A   +  GY+++R L+D D  LY        +CG+T+P    +  PTTG    S    H 
Sbjct  70   ALLKESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHA  123

Query  119  GPCEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLKK  170
             PCE+WLDD  V+S D+C   +   T        P+DYSSC  S C LR+YWL  + +  
Sbjct  124  SPCEIWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  171  RYSWQIYKECVSLS  184
            +  WQ+YK+CV L+
Sbjct  184  KMVWQVYKDCVPLT  197

>PYU1_G005325
Length=207

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 87/180 (48%), Gaps = 16/180 (9%)

Query  9    LAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV-NTSADVAGFMK  65
            +A  AL  A+ +  V+ H  +  P   F      + W         G   T A  A    
Sbjct  7    IASLALAGAACINHVEGHTYLTQPLAEFKKGASKSSWVAEFPPPWSGTFRTGAQYAAVAP  66

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVW  124
            +KGY +L++ +D +            CG T    +++ IP  G ++ ++   H GPCE+W
Sbjct  67   KKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASSMEHPGPCEIW  117

Query  125  LDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            L + +    D+C   F   T F +D+S+CKG+C LR+YWLG++   KR  WQ YK C+ L
Sbjct  118  LGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGKR--WQSYKNCIPL  175

>PHALS_03179
Length=372

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 101/198 (51%), Gaps = 27/198 (14%)

Query  8    TLAVTALGAASVVV--------DAHQMMIFPEPFFL-VDGKDA---QWKPLAFLENQGVN  55
            T++ TA+ A+++++        ++H  ++ P+  F  + G +A   Q  PL    +   N
Sbjct  40   TMSTTAVIASTILILATLMSSIESHGYVLIPQTQFKGLPGNEAWIVQIDPLWKSSDWNGN  99

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALF-ECGYTDPTYESQPIPTTGTIR-ST  113
            T   V  +   K   N + L   + L E  T AL  ECG++DP  + QPIP  G    S 
Sbjct  100  TEQSVKAYQSLKAANNFKDL---KTLME--THALGPECGFSDPKGKPQPIPKDGKATLSR  154

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGK------TFPLDYSSC-KGSCT-LRWYWLGV  165
               H GPCE+WLD+ KV+  D+C+ K+  +        P+DYSSC  G C  +R+YWL  
Sbjct  155  AIVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAF  214

Query  166  RYLKKRYSWQIYKECVSL  183
            + +K    WQ YK C+ L
Sbjct  215  QGIKGITFWQSYKNCIPL  232

>PHYSO_255056
Length=269

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/192 (34%), Positives = 92/192 (48%), Gaps = 22/192 (11%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSAD----  59
            SF+   AV  +G  +  V AH  M+ P   F      A    ++   N      AD    
Sbjct  6    SFISATAVAVVGCLTTQVQAHGYMLIPLTEFKGTATGAWIVQISPQFNANWEFVADDTEL  65

Query  60   VAGFM---KQKGYAN-LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-ST  113
            +A ++   K+ GYAN +R L+D D  LY        +CG+++P  + +  PT GT     
Sbjct  66   IALYVEKAKEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFER  119

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVR-YLKKRY  172
            G  H GPCE+WLDD  V+  D+C   F  +    DY S  G C  R+YWL  +     +Y
Sbjct  120  GLAHHGPCEIWLDDTMVLHNDDCAKAFSVE----DYMSING-CMFRFYWLAFQGSTSGKY  174

Query  173  SWQIYKECVSLS  184
             WQIYK C+ L+
Sbjct  175  VWQIYKNCIPLT  186

>PPTG_04618
Length=326

 Score = 92.0 bits (227),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 15/131 (11%)

Query  63   FMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPC  121
               +  Y ++R+LMD   +Y  +      CG+TDP       P+ GT   S G  H GPC
Sbjct  70   LAPKNNYKDVRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIVHAGPC  123

Query  122  EVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRYS  173
            E+WLDD  V+  D+C   +   T        P+DYSSC  G C LR+YWL ++ L  +  
Sbjct  124  EIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTV  183

Query  174  WQIYKECVSLS  184
            WQ YK C+ L+
Sbjct  184  WQAYKNCIPLT  194

>PYAP_18713
Length=184

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 73/133 (55%), Gaps = 14/133 (11%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPT-TGTIRST  113
             T A  A   K KG+ +LR+ ++D+            CG T+P  + + +P+ +  + S 
Sbjct  58   KTGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFSR  108

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT--FPLDYSSCKGSCTLRWYWLGVRYLKKR  171
               H GPCE+W+DD  V   D+C  +F  K   FP+D+SSCKG C LR+YWLG++   KR
Sbjct  109  PMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSGKR  168

Query  172  YSWQIYKECVSLS  184
              WQ Y   ++ S
Sbjct  169  --WQSYSTYIAES  179

>PITG_11936
Length=333

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 88/195 (45%), Gaps = 27/195 (14%)

Query  10   AVTALGAASVVVDA---HQMMIFPEPFFLVDGKDAQWKPLAFLENQGV----------NT  56
            ++ A+ A++++V     H  M  P+  F  +G + Q+         G           NT
Sbjct  7    SLAAIAASTMLVSTAKGHGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNT  66

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT------GTI  110
            +    GF   K Y +L+  M+D  +  VN D   ECGYT+P    QP+P T      G  
Sbjct  67   ANFNKGFAASK-YKSLKEFMNDNMVL-VNEDFTKECGYTNPDATPQPLPKTYVEWSHGAG  124

Query  111  RSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYL  168
                 +H+GPCEV+ D+ +V   DNC   FP      P D+ +C GS  L  YW+ +   
Sbjct  125  EGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH--  182

Query  169  KKRYSWQIYKECVSL  183
                SWQ+Y  C  L
Sbjct  183  --SPSWQVYINCAPL  195

>PHYKE_6076
Length=272

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 95/194 (49%), Gaps = 34/194 (18%)

Query  14   LGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV------------NTSAD  59
            + AA++V  V+AH  M  P+  F   G   Q+  +A +E                NT+A 
Sbjct  12   VAAATLVASVNAHGYMSVPKVEFTFVGDTTQF--MATIEASATGWSGSFGGSPADNTAAF  69

Query  60   VAGFMKQKGYANLRALMDD-EKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTG  114
               F   K Y++L+ L+ D  KL   +T    ECGYT+P   +QP+P T        S G
Sbjct  70   TTAFESSK-YSSLKELVTDLGKL--TSTSYTTECGYTNPDETAQPLPDTYVEWAHSDSEG  126

Query  115  YT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVRYLK  169
            +T  H+GPCEVW DDV+V   D+C   +   P K  P D+ +C GS  L  YWL +    
Sbjct  127  FTPSHEGPCEVWCDDVRVFQDDDCAAHYTTAPAK-LPYDHDACLGSSRLTLYWLALH---  182

Query  170  KRYSWQIYKECVSL  183
               +WQ+Y  C +L
Sbjct  183  -SSTWQVYTNCAAL  195

>PHYSO_246481
Length=318

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 89/199 (45%), Gaps = 28/199 (14%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSA-----  58
            SF   LA+TAL      VD H  M  P   FL    D   + +A +E+   + S      
Sbjct  7    SFRAMLAMTALATG---VDGHGYMTEPAVTFLSSSTD-NTQFIATIESSASDFSGTFSGS  62

Query  59   ---DVAGFMKQ---KGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT-----  107
               + A F K      Y +L+ L++D+    V TDA   CG  DP   +QP+P T     
Sbjct  63   PADNTAAFTKAFEASSYTSLKELINDKATITV-TDATLTCGSCDPDETAQPLPDTYVEWS  121

Query  108  -GTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLG  164
              +      +H GPCEVW DDV+V   D+C   +       P D  +C G+ TL +YWL 
Sbjct  122  HSSTEGFSSSHAGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLA  181

Query  165  VRYLKKRYSWQIYKECVSL  183
            +       +WQ+Y  C  L
Sbjct  182  LH----SSTWQVYINCAPL  196

>PYIW_24289
Length=196

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 85/191 (45%), Gaps = 25/191 (13%)

Query  11   VTALGAASVVVDAHQMMIFPEPFFLVD-----------GKDAQWKP--LAFLENQGVNTS  57
            V AL  A+  VD H  M  P+P F              G +    P  +++  +  +N  
Sbjct  13   VVALLTAATNVDGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNAL  72

Query  58   ADVAGFMKQK---GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTG  114
            A    F  Q     Y NLR L+D + ++   TD   ECG+T+ T   QP+    T   T 
Sbjct  73   AFKTAFSSQTDSIKYRNLRDLIDTKAVFSAGTDK--ECGFTNVTSAKQPLSAHATGGFTP  130

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDY--SSCKGSCTLRWYWLGVRYLKKRY  172
             TH GPCE+W D V V   DNC   +P     L Y  S C G+  L++YWL V  +K   
Sbjct  131  -THQGPCEIWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK---  186

Query  173  SWQIYKECVSL  183
             W+ Y  C  L
Sbjct  187  -WEAYINCAPL  196

>H257_13550
Length=266

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 79/152 (52%), Gaps = 26/152 (17%)

Query  45   PLAFLENQGVNTSADVAGFMKQK--GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQ  102
            P  F ++   N +A    F  Q+  G+  LRA++D +           +CGY+     ++
Sbjct  81   PGKFNDSPDKNVAAFNKAFRDQQATGFKTLRAMLDPQGP---------DCGYSKLDVPAK  131

Query  103  PIPTTGTI------RSTGY--THDGPCEVWLDDVKVMSGDNCHDKFPGKT---FPLDYSS  151
            PIP+ G +         G+  +H GPCE+WLD+ +V   D+C   FP K     P+D++S
Sbjct  132  PIPSDGNVVWQNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFAS  191

Query  152  CKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            C GSCT+R+YW+ +     +  WQ+YK C  L
Sbjct  192  CVGSCTIRFYWIALH----QDLWQVYKNCAPL  219

>PYAR_20617
Length=254

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 83/180 (46%), Gaps = 16/180 (9%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPF--FLVDGKDAQWKPLAFLENQGV-NTSADVAGFMK  65
            +A  A+  A  + DAH  +   EP   F      + W        +G   T A  A   K
Sbjct  7    IASLAVATAVGIHDAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAK  66

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVW  124
             +G  +LR  ++D+            CG +      + IP +G I  ++   H GPCEVW
Sbjct  67   AEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVW  117

Query  125  LDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
             DDV     D+C   F   T F +D+S C GSC LR+YWLG++   KR  WQ YK CV L
Sbjct  118  FDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDGGKR--WQSYKNCVPL  175

>PHYRA_85794
Length=230

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 85/189 (45%), Gaps = 23/189 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKG  68
            +  AL A +   +AH  +  P+P F        W  +  ++N   + +  D  G  K   
Sbjct  9    SAIALLAFATRAEAHGHLNQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMA  66

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEV  123
             A     + D  L  V  D   +CG+T    + QP+PT G          GYTH GPCE+
Sbjct  67   -AEKGVSVRDVVLDMVGADK--KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCEL  123

Query  124  WLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            ++DD  V+  DNC   +PG           P+DYSSC G CT   YWLG +  +    WQ
Sbjct  124  YIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQ  179

Query  176  IYKECVSLS  184
             Y  CV LS
Sbjct  180  AYINCVPLS  188

>PHYSO_459106
Length=223

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  63   FMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGP  120
              K     ++R ++D D KLY        +CG+TDP  + Q  PTTG    S G  H GP
Sbjct  70   LKKANNVKDIRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGP  123

Query  121  CEVWLDDVKVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRY  172
            CE+WLDD  V+  D+C   +   T        P+DYSSC  G C  R+YWL ++    + 
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKT  183

Query  173  SWQIYKECVSLS  184
             WQ+YK C+ L+
Sbjct  184  YWQVYKNCIPLT  195

>PHYRA_77971
Length=230

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 85/189 (45%), Gaps = 23/189 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKG  68
            +  AL A +   +AH  +  P+P F        W  +  ++N   + +  D  G  K   
Sbjct  9    SAIALLAFATRAEAHGHLDQPQPTFQDGASTVNW--VVQIDNYWDIGSGGDQVGKYKTMA  66

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEV  123
             A     + D  L  V  D   +CG+T    + QP+PT G          GYTH GPCE+
Sbjct  67   -AEKGVSVRDVVLDMVGADK--KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCEL  123

Query  124  WLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            ++DD  V+  DNC   +PG           P+DYSSC G CT   YWLG +  +    WQ
Sbjct  124  YIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQ  179

Query  176  IYKECVSLS  184
             Y  CV LS
Sbjct  180  AYINCVPLS  188

>PHYRA_79140
Length=424

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 58/107 (54%), Gaps = 17/107 (16%)

Query  91   ECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG---  142
            +CG TD +   QPIP+ G  +       G+TH GPCE++LDD  V+  DNC D +PG   
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  143  -----KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
                    P+DYSSC G CTL  YWL  +  +    WQ Y  CV LS
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCVPLS  187

>PYU1_G007364
Length=316

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/190 (31%), Positives = 86/190 (45%), Gaps = 32/190 (17%)

Query  13   ALGAASVVVDAHQMMIFPEPFF--------LVDGKDAQWKPLAFLENQGVNTSADVAGFM  64
            +L  A   V+AH  +  P   F         +   D  + P  F +N   N       F 
Sbjct  26   SLSLAPSAVNAHGYITVPMAEFSDGAMKTNFIAKMDPAF-PGKFNDNPQANVDTFTKAFQ  84

Query  65   KQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR------STGY--T  116
                YA+LR L+              +CG T      +PIP+ G +       + G+  +
Sbjct  85   ASGKYASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPS  135

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSW  174
            H GPCE+WLDD  V+  +NC  +FPG      +D+SSC G C +R+YWL ++      +W
Sbjct  136  HTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAW  191

Query  175  QIYKECVSLS  184
            QIYK C+ L+
Sbjct  192  QIYKNCIPLA  201

>PHYCA_112615
Length=196

 Score = 88.2 bits (217),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 81/172 (47%), Gaps = 25/172 (15%)

Query  21   VDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSADVAGFMKQK---GYANLRA  74
             DAH  M+ PE  F      A   Q  P+   E+   N    V  F   K    + +L+ 
Sbjct  21   TDAHGYMLIPESQFKGSANSAWIVQIDPVWASEDWDGNKPGSVDAFKALKTANNFKDLKT  80

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            LMDD  +Y        +CG+TDP  ++QPIP+ G    S    H GPCE+WLDD K +  
Sbjct  81   LMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWLDDTKDIKS  134

Query  134  DNCHDKFPGKTFPLDYSSC-KGSCT-LRWYWLGVRYLKKRYSWQIYKECVSL  183
                       FP+DYSSC  G C  +R+YWL  + +  +  WQ Y E  S+
Sbjct  135  ----------IFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYIETPSV  176

>PITG_08202
Length=191

 Score = 88.2 bits (217),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 87/187 (47%), Gaps = 27/187 (14%)

Query  2    APSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDA---QWKPLAFLENQGVNTSA  58
            A +F+ T A+  L A+   VDAH  M+ PE  F      A   Q  P+   +    N + 
Sbjct  5    AAAFVSTAAL--LAASIPNVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNAK  62

Query  59   DVAGFMKQKG---YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STG  114
             V  F   K    + +LR LMDD  +Y        +CG+T+P    QPIP+ G    S  
Sbjct  63   SVDTFKSLKAANNFKDLRTLMDDTSVYGA------DCGFTNPNDTPQPIPSDGKATFSRA  116

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSC-KGSC-TLRWYWLGVRYLKKRY  172
              H GPC +WLDD   +             FP+DYSSC  G C  +R+YWL  + L K+ 
Sbjct  117  LVHHGPCGIWLDDKMDIKS----------IFPVDYSSCSNGGCKQMRFYWLAFQGLNKKT  166

Query  173  SWQIYKE  179
             WQ Y +
Sbjct  167  VWQSYSK  173

>PHYSO_524101
Length=308

 Score = 90.5 bits (223),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 86/183 (47%), Gaps = 28/183 (15%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV------------NTSADVAGFMKQKG  68
            ++AH  M  P   FL  G   Q+  +A +E                NT+A    F +   
Sbjct  21   INAHGYMSDPAVKFLTTGDPTQF--IATIEASASGFSGTFNGAPADNTAAFTTAF-ESSS  77

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDGPCE  122
            Y++L+ L++D+    V TDA   CG  DP   +QP+P T        S G+T  H+GPCE
Sbjct  78   YSSLKELINDKATITV-TDATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTASHEGPCE  136

Query  123  VWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
            VW DDV+V   D+C   +       P D  +C GS TL +YWL +       +WQ+Y  C
Sbjct  137  VWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH----SSTWQVYVNC  192

Query  181  VSL  183
              L
Sbjct  193  APL  195

>PHYKE_2809
Length=291

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 16/124 (13%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R ++D D KLY        +CG+TDP    +  PT G    S G  H GPCE+WLDD 
Sbjct  65   DIRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDK  118

Query  129  KVMSGDNCHDKFPGKTF-------PLDYSSCK-GSCTLRWYWLGVRYLKKRYSWQIYKEC  180
             V+  D+C   +   T        P+DYSSC  G C  R+YWL ++ L  +  WQ+YK C
Sbjct  119  MVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNC  178

Query  181  VSLS  184
            V LS
Sbjct  179  VPLS  182

>PHYCA_12943
Length=287

 Score = 89.4 bits (220),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/198 (31%), Positives = 94/198 (47%), Gaps = 30/198 (15%)

Query  6    LPTLAVTALGAASVVV------DAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSA  58
            + TLA   L +  V++      +AH  +  PE  F       +W  +  ++N   + +  
Sbjct  1    MNTLAGIVLSSTIVLLAFAPDANAHGNLKQPEATFKDGAPTVEW--VTLVDNYWDIGSGG  58

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----ST  113
            D  G  K K  A  + +   + + ++  D   +CGYT    + QPIP+ G ++       
Sbjct  59   DQVG--KFKTMAKEKGMSVKDVVLDMVKDK--KCGYTRTDVDPQPIPSDGIVKWWGNGGG  114

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGV  165
            G+TH GPCE+++DD  V+ GD+C D+FPG            +D+SSC G CTL  YWL  
Sbjct  115  GFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAF  174

Query  166  RYLKKRYSWQIYKECVSL  183
            +       WQ Y  CV L
Sbjct  175  Q----NEQWQSYVNCVPL  188

>PHYKE_2454
Length=374

 Score = 90.9 bits (224),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 92/196 (47%), Gaps = 32/196 (16%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSA----------  58
            L  +AL A+  +V+ H  M  PE  F     D       F+   G +++           
Sbjct  8    LLASALTAS--IVNGHGWMTKPEATFSASAGDK----TQFVATIGSSSTGFEGSYNSAPA  61

Query  59   -DVAGF---MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT---GTIR  111
             +VA F    K   Y +L+AL+DD+    V + A   CG  DP+  +QP+P+T       
Sbjct  62   DNVASFTKAFKASSYKSLKALIDDKAKITV-SGATLTCGSADPSAAAQPLPSTLEWSHSD  120

Query  112  STGYT--HDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRY  167
            S G+T  H+GPCE W DDV+V   +NC   FP      P + SS  G+  L +YW+ +  
Sbjct  121  SEGFTPSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH-  179

Query  168  LKKRYSWQIYKECVSL  183
                 SWQ+Y  C +L
Sbjct  180  ---GPSWQVYVNCAAL  192

>SDRG_08137
Length=282

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 90/197 (46%), Gaps = 32/197 (16%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWK-------PLAFLENQGVNTSADVA  61
            L  +ALG +  +V  H ++  P   F ++     +        P  F  +   N +A  +
Sbjct  68   LRCSALGISLALVAGHGIVSNPAAEFSLNVMRTTYVATIQANLPGKFDGSPQENVAAFTS  127

Query  62   GFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR----STG---  114
             F  Q  +  LR +++ +            CG + P    + IP+ GT+      TG   
Sbjct  128  AFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWRNPDTGEGF  178

Query  115  -YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT---FPLDYSSCKG-SCTLRWYWLGVRYLK  169
              +H GPCEVWLDD +V   D+C   FP K     P+DYSSC G  C LR+YWL +    
Sbjct  179  ISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALH---  235

Query  170  KRYSWQIYKECVSLSDN  186
             +  WQ+YK CV L  N
Sbjct  236  -QPQWQVYKNCVPLQGN  251

>PHYRA_78161
Length=373

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 91/199 (46%), Gaps = 25/199 (13%)

Query  5    FLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNT--------  56
              P   + A   A  VV+ H  M  P+  F     D   + +A +E+             
Sbjct  2    IAPVKCLLASALAVTVVNGHGYMTDPKVTFTAQAGDPT-QYIATIESTASGLTGTFNGAP  60

Query  57   SADVAGFMKQKG---YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GT  109
            S +VA F K  G   Y++L+  ++D+    V T A   CG  DP  E+QP+P +      
Sbjct  61   SDNVAAFTKAFGSSKYSSLKEFINDKATVTV-TGATLTCGSCDPKEEAQPMPKSTMEWSH  119

Query  110  IRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKFP--GKTFPLDYSSCKGSCTLRWYWLGV  165
              S G+T  H+GPCEVW DDV+    D+C   +P      P D  +C GS TL +YW+ +
Sbjct  120  SDSEGFTASHEGPCEVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAM  179

Query  166  RYLKKRYSWQIYKECVSLS  184
                   +WQ+Y  C  L+
Sbjct  180  H----SSTWQVYVNCAPLA  194

>PITG_04947
Length=298

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 69/131 (53%), Gaps = 16/131 (12%)

Query  63   FMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGP  120
              K     ++R ++D D KLY  +      CG TDP    +  PTTG    S G  H GP
Sbjct  45   LKKSNNIKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPTTGDATFSRGIVHAGP  98

Query  121  CEVWLDDVKVMSGDNCHDKF---PGKTF----PLDYSSCK-GSCTLRWYWLGVRYLKKRY  172
            CE+WLDD  V+  D+C   +     KT     P+DYSSCK G C  R+YWL ++   ++ 
Sbjct  99   CEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKT  158

Query  173  SWQIYKECVSL  183
             WQ+YK C+ L
Sbjct  159  LWQVYKNCIPL  169

>PYAP_18138
Length=268

 Score = 89.0 bits (219),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 87/184 (47%), Gaps = 19/184 (10%)

Query  1    MAPSFLPTLAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQG-VNTS  57
            +APS    +  T L AA++   V AH  +  P P F        W      E  G +   
Sbjct  13   VAPSLNTIVVSTLLTAATLSEDVQAHTALKEPRPEFKPGKGGVGWVTHFNAEWPGKIPGG  72

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYT  116
             + A   KQ G  +LR+ +D +         + ECG +      +PIP T T+      T
Sbjct  73   NEWAAAAKQHGVKDLRSYIDAK---------ITECGDSLKDVSPKPIPKTNTVTFERALT  123

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGK-TFPLDYSSCKG-SCTLRWYWLGVRYLKKRYSW  174
            H GPCE W+DD +V   ++C   F  K T PLDYS C G +C LR+YWLG+    +   W
Sbjct  124  HKGPCEFWIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGL----QNSDW  179

Query  175  QIYK  178
            Q+Y+
Sbjct  180  QVYR  183

>PYAR_14260
Length=212

 Score = 87.8 bits (216),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 71/130 (55%), Gaps = 13/130 (10%)

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STG  114
            T A  A     KG+ NLR+ ++ +            CG +  + + +PIP+ G ++ ++ 
Sbjct  33   TGAQYAAVAPGKGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFAST  83

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT-FPLDYSSCKGSCTLRWYWLGVRYLKKRYS  173
              H GPCE+WLD+      D+C  +F   T   +++S+CKGSC LR+YWLG++    R  
Sbjct  84   LEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQDSGTR--  141

Query  174  WQIYKECVSL  183
            WQ YK CV L
Sbjct  142  WQSYKNCVPL  151

>PHYRA_83494
Length=224

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 57/107 (53%), Gaps = 17/107 (16%)

Query  91   ECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG---  142
            +CG TD +   Q +PT G  +       G+TH GPCE+++DD  V+ GDNC D +PG   
Sbjct  22   KCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDV  81

Query  143  -----KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
                    P+DYSSC G CT   YWL  +  +    WQ Y  CV L+
Sbjct  82   GSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLT  124

>PHYRA_78174
Length=279

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 95/197 (48%), Gaps = 35/197 (18%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV------------NT  56
            + VT L A   +V  H  M  P+  +  +G   Q+  +A +E                NT
Sbjct  11   VVVTTLAA---LVHGHGYMSVPKCEYTFEGDTTQF--MATIEASASGFSGSFSGSPADNT  65

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNT-DALFECGYTDPTYESQPIPTT------GT  109
            +A   GF   K Y +L+ ++ D  L +V + D   ECGYT+P   +QP+P T      G+
Sbjct  66   AAFAKGFEASK-YTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAHGS  122

Query  110  IRSTGYTHDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVR  166
                  +H+GPCEVW DDV+V   D+C   +   P K  P D+ +C G+  L +YWL + 
Sbjct  123  GEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAK-VPYDHDACLGASRLTFYWLALH  181

Query  167  YLKKRYSWQIYKECVSL  183
                  +WQ+Y  C +L
Sbjct  182  ----SSTWQVYTNCAAL  194

>PHYRA_83500
Length=394

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 57/107 (53%), Gaps = 17/107 (16%)

Query  91   ECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVKVMSGDNCHDKFPG---  142
            +CG TD +   QPIP+ G  +       G+TH GPCE++LDD  V+  DNC D +PG   
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  143  -----KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
                    P+DYSSC G CTL  YWL  +  +    WQ Y  C  LS
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLS  187

>PHYRA_73581
Length=293

 Score = 88.6 bits (218),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 93/206 (45%), Gaps = 34/206 (17%)

Query  5    FLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKD--------AQWKPLAFLENQGVNT  56
             L   AV A+G  +  V AH  M  P    L   K          Q  P   LE    + 
Sbjct  7    LLVATAVAAVGCLTSQVQAHGYMYLPLAVPLAKYKKGKQISSWIVQIDPQ--LEADWNSI  64

Query  57   SADVAGFM------KQKGYAN-LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG  108
            S D A         K+ GY N +R L+D D  LY  +      CGY+DP  + +  PT G
Sbjct  65   SDDTALIALYADKAKESGYENDVRKLLDSDANLYGAD------CGYSDPDADPKDPPTDG  118

Query  109  TIR-STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTF--------PLDYSSCKGS-CTL  158
            T   S G  H GPCE+WLDD  V+  D+C   F    +        P+DYSSC  S C L
Sbjct  119  TATFSRGIAHHGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCML  178

Query  159  RWYWLGVRYLKKRYSWQIYKECVSLS  184
            R+YWL  +     Y WQIYK CV L+
Sbjct  179  RFYWLAFQGSNDGYVWQIYKHCVPLT  204

>PHYRA_78625
Length=434

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 70/167 (42%), Gaps = 51/167 (31%)

Query  22   DAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVNTSADVAGFMKQKGYANLRALM  76
            +AHQ++  P P +      +      W PL+FLE +G  T  +   F    GY +LR  +
Sbjct  239  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  298

Query  77   DDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNC  136
            D  K Y++                                              +S  NC
Sbjct  299  DKAK-YKL---------------------------------------------ALSYLNC  312

Query  137  HDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            H+    +TF LDYS C  SC L WYWLG RYLK  YSWQ+YKEC+ L
Sbjct  313  HESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  359

>PHYCA_19611
Length=531

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 84/183 (46%), Gaps = 26/183 (14%)

Query  20   VVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ--------GVNTSADVAGF---MKQKG  68
             V  H  M  P+  F   G   Q+  +A +++         G + + + A F   M    
Sbjct  227  TVKGHGYMSVPKVEFTFVGDTTQY--MATIDSSTSGFSGQFGGSPADNTANFNKGMAASK  284

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTG------YTHDGPCE  122
            Y +L+  M+D K+  VN +   ECGYT+P    QP+P T    S G       +H+GPCE
Sbjct  285  YTSLKEFMND-KMVLVNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSHEGPCE  343

Query  123  VWLDDVKVMSGDNCHDKFP--GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
            VW DD +V   DNC   FP      P D  +C GS  L  YW+ +       SWQ+Y  C
Sbjct  344  VWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQVYINC  399

Query  181  VSL  183
             +L
Sbjct  400  AAL  402

 Score = 39.7 bits (91),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 6/70 (9%)

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYS  173
            T +GP  V      +   DNC   +P      P D  +C G+  L +YWL +       +
Sbjct  75   TSNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALH----SST  130

Query  174  WQIYKECVSL  183
            WQ+Y  C +L
Sbjct  131  WQVYTNCAAL  140

>SDRG_07565
Length=278

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 71/144 (49%), Gaps = 25/144 (17%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR---  111
            N +A    F  Q  +  LR +++ +            CG + P    + IP+ GT+    
Sbjct  119  NVAAFTTAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLN  169

Query  112  -STG----YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT---FPLDYSSCKGS-CTLRWYW  162
              TG     +H GPCEVWLDD +V   D+C   FP K     P+DYSSC GS C LR+YW
Sbjct  170  PDTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYW  229

Query  163  LGVRYLKKRYSWQIYKECVSLSDN  186
            L +     +  WQ+YK CV L  N
Sbjct  230  LALH----QPQWQVYKNCVPLQGN  249

>PHYRA_78626
Length=473

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 70/167 (42%), Gaps = 51/167 (31%)

Query  22   DAHQMMIFPEPFFLVDGKDAQ-----WKPLAFLENQGVNTSADVAGFMKQKGYANLRALM  76
            +AHQ++  P P +      +      W PL+FLE +G  T  +   F    GY +LR  +
Sbjct  278  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  337

Query  77   DDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNC  136
            D  K Y++                                              +S  NC
Sbjct  338  DKAK-YKL---------------------------------------------ALSYLNC  351

Query  137  HDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            H+    +TF LDYS C  SC L WYWLG RYLK  YSWQ+YKEC+ L
Sbjct  352  HESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILL  398

>PPTG_04620
Length=342

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  63   FMKQKGYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGP  120
              K     ++R ++D D KLY  +      CG TDP    +  P+TG    S G  H GP
Sbjct  72   LKKSNNVKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPSTGDATFSRGIVHAGP  125

Query  121  CEVWLDDVKVMSGDNCHDKF---PGKTF----PLDYSSCK-GSCTLRWYWLGVRYLKKRY  172
            CE+WLDD  V+  D+C   +     KT     P+DYSSCK G C  R+YWL ++    + 
Sbjct  126  CEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKT  185

Query  173  SWQIYKECVSLS  184
             WQ+YK C+ LS
Sbjct  186  LWQVYKNCIPLS  197

>PHYRA_73583
Length=630

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 67/124 (54%), Gaps = 16/124 (13%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R L+D D  LY  N      CGYT+P    +  P+TG    S G  H GPCE+WLDD 
Sbjct  78   DIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDK  131

Query  129  KVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
             V+  D+C   +   T        P+DYSSC  G C  R+YWL ++ L  +  WQ+YK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNC  191

Query  181  VSLS  184
            + LS
Sbjct  192  IPLS  195

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 67/124 (54%), Gaps = 16/124 (13%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R ++D D KLY        +CG+TDP    +  P+TG    S G  H GPCEVWLDD 
Sbjct  379  DIRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDE  432

Query  129  KVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
             V+  D+C   +   T        P+DYSSC  G C  R++WL ++    +  WQ+YK C
Sbjct  433  MVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNC  492

Query  181  VSLS  184
            V LS
Sbjct  493  VPLS  496

>PYIW_15526
Length=256

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 75/142 (53%), Gaps = 29/142 (20%)

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGY-  115
            +A+      + GY +L+ ++D          ++  CGYT+P   + P+  +G ++S  Y 
Sbjct  65   AAEFTAAWPKTGYTSLKEMLDK---------SVSGCGYTNP--NAAPVDVSG-LKSMKYQ  112

Query  116  ----------THDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWL  163
                      +H GPCE W+D+ K+   D+C   +PG   T P+DYS CKG+C L +YWL
Sbjct  113  NNEYKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWL  172

Query  164  GVRYLKKRYSWQIYKECVSLSD  185
             V   K    WQ+YK CV++ +
Sbjct  173  AVHSPK----WQVYKGCVAIKN  190

>PYU1_G001517
Length=311

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 88/195 (45%), Gaps = 30/195 (15%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFL--VDGK--------DAQWKPLAFLENQGVNTSA  58
            L   A G ASV  +AH  +  P PFF   VD          DA +   AF     +N   
Sbjct  11   LVAVAFGVASV--NAHGFLAIPAPFFKTGVDITSYTSTIMGDATYPGFAFNTAPSINMEN  68

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-------  111
             V  F     + NLRAL++ E    V T A  +CG+TDP+  S  + T  TI        
Sbjct  69   FVKNFKNDAKHPNLRALVEKEAKV-VATGADAQCGWTDPSKTSYTL-TNSTITYGRNFEG  126

Query  112  -STGYTHDGPCEVWLDDVKVMSGDNCHDKF--PGK--TFPLDYSSCKGSCTLRWYWLGVR  166
               G+ H GPCE W DDV V    +C + +  P K    P+D + CKG+  L  YW+ + 
Sbjct  127  TGEGFVHPGPCETWCDDVMVQQDMHCDETYNKPNKAAVIPIDVAKCKGAKQLTTYWIAMH  186

Query  167  YLKKRYSWQIYKECV  181
                   WQ+Y +CV
Sbjct  187  ----GNEWQVYLDCV  197

>PPTG_03138
Length=294

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 95/196 (48%), Gaps = 32/196 (16%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV------------NT  56
            +  TA+ AA+V   AH  M  P   FL      Q+  +A +E+               NT
Sbjct  11   MLATAMLAANVY--AHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNT  66

Query  57   SADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRS  112
            +A    F +   +++L+ L++++    V+ DA   CG  DP   +QP+P T        S
Sbjct  67   AAFTKAF-ESSSFSSLKELINEKATLTVS-DATLTCGSCDPDETAQPLPDTYVEWAHSDS  124

Query  113  TGYT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVRY  167
             G+T  H+GPCE+W DDV+V  GD+C   +   P K  P D+ +C GS  L +YWL +  
Sbjct  125  EGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAK-LPYDHDACLGSSVLTFYWLALH-  182

Query  168  LKKRYSWQIYKECVSL  183
                 +WQ+Y  C  L
Sbjct  183  ---SSTWQVYVNCAPL  195

>PHYKE_3913
Length=321

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 16/124 (13%)

Query  71   NLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDV  128
            ++R L D D  LY  N      CG+T+P    +  PT GT   S G  H GPCE+WLDD 
Sbjct  105  DIRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDK  158

Query  129  KVMSGDNCHDKFPGKT-------FPLDYSSC-KGSCTLRWYWLGVRYLKKRYSWQIYKEC  180
             V+  D+C   +   T        P+DYSSC  G C  R+YW+ ++ L  +  WQ+YK C
Sbjct  159  MVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNC  218

Query  181  VSLS  184
            V L+
Sbjct  219  VPLT  222

>PHYRA_78176
Length=312

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 72/138 (52%), Gaps = 16/138 (12%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTI  110
            NT+A    F +   Y++L+  +DD+    V TDA   CG  DP   +QP+P T       
Sbjct  66   NTAAFTTAF-ESSSYSSLKEFIDDKATITV-TDATLTCGACDPDETAQPLPETYVEWAHS  123

Query  111  RSTGYT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGV  165
             S G+T  H+GPCEVW DDV+V   D+C   F   P +  P D+ +C GS  L +YWL +
Sbjct  124  DSEGFTASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQ-LPYDHDACLGSSVLTFYWLAL  182

Query  166  RYLKKRYSWQIYKECVSL  183
                   +WQ+Y  C  L
Sbjct  183  H----SSTWQVYVNCAPL  196

>PYIW_21963
Length=326

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 89/198 (45%), Gaps = 26/198 (13%)

Query  8    TLAVTALGAASVVVDAHQMMIFPEPFFL--VDGK--------DAQWKPLAFLENQGVNTS  57
            T  + AL   +  V  H  ++ P+P F   VD          DA +  +AF     +N  
Sbjct  8    TAVIAALALGATQVRGHGFLVKPKPSFQSGVDITSYTGTMMGDAIYPGVAFNTAPSINME  67

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-------  110
              +  F     + NL+ L++  +   +N  A  +CG+TDP+  S+P+  +  I       
Sbjct  68   NFIKNFKTDTRHPNLKTLVEKNQKV-INAKADAKCGWTDPSKTSEPLEGSSIIYGRNFEG  126

Query  111  RSTGYTHDGPCEVWLDDVKVMSGDNCHDKF----PGKTFPLDYSSCKGSCTLRWYWLGVR  166
               G+ H GPCE W D+V V    +C +K+         P+D + CKG+  L  YW+ + 
Sbjct  127  TGEGFVHPGPCETWCDNVMVQQEMHCDEKYNVANKAAIIPIDAAKCKGAKQLTTYWIAMH  186

Query  167  YLKKRYSWQIYKECVSLS  184
                   WQIY +CV LS
Sbjct  187  ----GNEWQIYLDCVGLS  200

>PHYRA_80750
Length=275

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 82/174 (47%), Gaps = 23/174 (13%)

Query  21   VDAHQMMIFPEPFFLVDGKDAQW----KPLAFLENQGVNTSADVAGFMKQK---GYANLR  73
             DAH  M+ PE  F  D  ++ W     P+    +   N +  V  F   K    + +L+
Sbjct  21   ADAHGYMLIPESQFK-DSANSAWVVQIDPVWDSADWDGNNAGSVDAFKALKTANNFVDLK  79

Query  74   ALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMS  132
             LMDD   +        +CG+TDP+   QPIP+ G    S    H GPCE+WLDD KV  
Sbjct  80   TLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDDKKVFY  133

Query  133  GDNCHDKFPGKT------FPLDYSSCK-GSCT-LRWYWLGVRYLKKRYSWQIYK  178
             D+C   +  +       FP+DYS C  G C  +R+YWL  + +  +  WQ Y 
Sbjct  134  EDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSYN  187

>PHYKE_6078
Length=317

 Score = 87.8 bits (216),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 89/201 (44%), Gaps = 29/201 (14%)

Query  2    APSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV-------  54
            A SF   LA   L A    V+ H  M  P   FL      Q+       + G+       
Sbjct  5    ATSFSAMLATAVLAAG---VNGHGYMSDPAVTFLTSNDPTQFIATIEASDSGLSGTFNGA  61

Query  55   ---NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----  107
               NT+A    F +   Y++L+  ++D+    V TDA   CG  DP   +Q +P T    
Sbjct  62   PADNTAAFTTAF-ESSSYSSLKEFINDKATITV-TDATLTCGSCDPDEAAQALPDTYVEW  119

Query  108  GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYW  162
                S G+T  H+GPCEVW DD +V   D+C   +   P +  P D+ +C GS T+  YW
Sbjct  120  AHSDSEGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQ-LPFDHDACLGSSTVTLYW  178

Query  163  LGVRYLKKRYSWQIYKECVSL  183
            L +       +WQ+Y  C  L
Sbjct  179  LALH----SSTWQVYVNCAPL  195

>SDRG_08129
Length=218

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 88/197 (45%), Gaps = 32/197 (16%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWK-------PLAFLENQGVNTSADVA  61
            L  +ALG +  +V  H ++  P   F  +     +        P  F  +   N +A  +
Sbjct  4    LRCSALGISLALVAGHGIVSNPAAEFSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTS  63

Query  62   GFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR----STG---  114
             F  Q  +  LR +++ +            CG + P    + IP+ G +      TG   
Sbjct  64   AFKVQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGAMTWRNPDTGEGF  114

Query  115  -YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT---FPLDYSSCKG-SCTLRWYWLGVRYLK  169
              +H GPCEVWLDD +V   D+C   FP K     P+DYSSC G  C LR+YWL +    
Sbjct  115  ISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLALH---  171

Query  170  KRYSWQIYKECVSLSDN  186
             +  WQ+YK CV L  N
Sbjct  172  -QPQWQVYKNCVPLQGN  187

>PYIR_24743
Length=357

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 69/147 (47%), Gaps = 24/147 (16%)

Query  48   FLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT  107
            F +N   N       F  Q  +  LR L+ D            +CG + P    + IP  
Sbjct  66   FNDNPQANVDTFTKAFQGQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGD  116

Query  108  GTI------RSTGY--THDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSC  156
            G +         G+  +H GPCE+WLDD +V S +NC   F   P    P+D+SSCK +C
Sbjct  117  GKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENC  176

Query  157  TLRWYWLGVRYLKKRYSWQIYKECVSL  183
             LR+YWL +       +WQ+YK CV L
Sbjct  177  MLRFYWLALH----EPTWQVYKNCVPL  199

>PYAR_24818
Length=198

 Score = 85.1 bits (209),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/198 (33%), Positives = 95/198 (48%), Gaps = 22/198 (11%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVD--------GKDAQWKP--LAFLE  50
            MA S L T AV A+ + + V DAH  M  P+P   +D        G +    P  ++F  
Sbjct  1    MAKSVLTTAAVLAIVSLNSV-DAHSKMTLPKPNSAIDNAPSGTLDGPNTLQVPAGMSFGY  59

Query  51   NQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI  110
                NT+A +  +  Q  Y ++R ++ D+  +  +  A  ECG +  T   Q +P     
Sbjct  60   GHEQNTAAFLKAYKSQSKYTSIRQMIYDK--FRPDGGATKECGRSAMTGPPQDLPDF-VE  116

Query  111  RSTGY--THDGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVR  166
              TG+  TH GPCEVW DD +V   DNC  K+P K    P D + C+G+  L+ +WL + 
Sbjct  117  YETGFDSTHWGPCEVWCDDKRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLALH  176

Query  167  YLKKRYSWQIYKECVSLS  184
                   WQ Y  C +LS
Sbjct  177  VP----DWQAYISCATLS  190

>PYAR_18165
Length=261

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 78/179 (44%), Gaps = 29/179 (16%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFL-VDGKDAQWKPLAFLENQGVNTSADVAGFMKQK  67
            L V  L   + +V AH  M  P P F  +  K+A    L  L      T  +V   +++ 
Sbjct  6    LLVACLAVQTTLVHAHGAMSAPLPAFADISNKNAPSASLPGLAGPYTGTD-EVKSLLEKA  64

Query  68   GYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLD  126
            G +                    +CG T+     QP P+ G +  +    H GPCE+WLD
Sbjct  65   GGS--------------------KCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLD  104

Query  127  DVKVMSGDNCHDKFPGKTFPLDYSSC--KGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            D KV+S  +C  +FP K  P+D+S C  K SC LRW W+          W+ Y  CV +
Sbjct  105  DTKVVSATDCWKQFPDKRIPVDFSKCANKASCELRWIWMATHT----SPWEFYDNCVRV  159

>PPTG_07521
Length=281

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 87/190 (46%), Gaps = 28/190 (15%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGY  69
            ++ +L A   VV+ H  +  P P +  D  + +W          V+   D+     Q G 
Sbjct  9    SIVSLVALISVVNGHGYLEEPSPSW-EDSPNPEWV-------INVDNYWDIGSGGDQCGL  60

Query  70   ANLRALMDDEKLYEVNTD---ALFECGYTDPTYESQPIPTTGTIR-----STGYTHDGPC  121
                A   +  + +V  D   A  ECG+T      QPIP+ G  +       G+TH GPC
Sbjct  61   FKTMAEEKNVTVKDVVLDMVGAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPC  120

Query  122  EVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYS  173
            E++LDD  V+ GDNC D++PG           P+DYSSC   CTL  YWL  +      +
Sbjct  121  EIYLDDKMVLHGDNCEDEYPGGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NAN  176

Query  174  WQIYKECVSL  183
            WQ Y  CV L
Sbjct  177  WQAYINCVPL  186

>PHYSO_324715
Length=274

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 84/183 (46%), Gaps = 39/183 (21%)

Query  19   VVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQK--GYAN-LRAL  75
              V  H  M+ PE   L D K                    ++ ++K K  GY N +R L
Sbjct  32   TTVQGHGYMLVPEAVPLSDHKKDNM----------------ISSWIKAKAEGYENNIRKL  75

Query  76   MD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSG  133
            +D D KLY        +CGY+DP    +   T GT   S G  H GPCE+WLDD  ++  
Sbjct  76   LDGDTKLYGA------DCGYSDPNASPKDPSTDGTATFSRGIAHHGPCEIWLDDKMILHD  129

Query  134  DNCHDKFPGKTF--------PLDYSSCKGS-CTLRWYWL---GVRYLKKRYSWQIYKECV  181
            D+C + F    +        P+DYSSC  + C L +YWL   G      +Y WQIYK  V
Sbjct  130  DDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGNSKYVWQIYKCYV  189

Query  182  SLS  184
            +L+
Sbjct  190  ALT  192

>PHALS_05392
Length=367

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 65/125 (52%), Gaps = 15/125 (12%)

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDD  127
            + ++R+LMD   +Y        +CGYTDP       P+ G    S G  H GPCE+WLDD
Sbjct  159  FKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDD  212

Query  128  VKVMSGDNCHDKFPGKTF-------PLDYSSCKG-SCTLRWYWLGVRYLKKRYSWQIYKE  179
              V+  D+C   +   T        P+DYSSC    C LR+YWL ++ L  +  WQ YK 
Sbjct  213  KMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTVWQAYKN  272

Query  180  CVSLS  184
            C+ L+
Sbjct  273  CIPLN  277

>PYU1_G001527
Length=278

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDG  119
            Q  Y ++RAL+D + +++   +   ECG T PT E QP+P          S G+T  H G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  120  PCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVW D+V   S DNC   +P      P D S C G   L++YWL +       +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  178  KECVSLS  184
              C  L+
Sbjct  194  IACAPLA  200

>PYU1_G001523
Length=278

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDG  119
            Q  Y ++RAL+D + +++   +   ECG T PT E QP+P          S G+T  H G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  120  PCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVW D+V   S DNC   +P      P D S C G   L++YWL +       +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  178  KECVSLS  184
              C  L+
Sbjct  194  IACAPLA  200

>PHYCA_18657
Length=295

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 86/189 (46%), Gaps = 31/189 (16%)

Query  14   LGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLEN-QGVNTSADVAG----FMKQKG  68
            LG+ +  VDAH  +  P   F        W  +  ++N   + +  D  G      K+KG
Sbjct  98   LGSTNHCVDAHGHLNQPSSTFQDGASHVNW--VTQIDNFWDIGSGGDQVGKYKTLAKEKG  155

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEV  123
             +     + D  L  V  D   +CG+T    + +P+PT G          G+TH GPCE+
Sbjct  156  VS-----VRDVILQMVGNDK--KCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCEL  208

Query  124  WLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            ++DD  V+  D+C   +PG           P+DYSSC G CT   YWLG +  +    WQ
Sbjct  209  YIDDKMVLHSDDCQADYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQ  264

Query  176  IYKECVSLS  184
             Y  CV LS
Sbjct  265  AYINCVPLS  273

>PHYRA_93650
Length=231

 Score = 84.3 bits (207),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 86/180 (48%), Gaps = 22/180 (12%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLA--FLEN-QGVNTSADVAGFMKQ  66
            AV  LG  +  V AH  M+ P+  F      A    +A  F  N + V    ++     +
Sbjct  11   AVATLGCLTTHVQAHGYMLIPQTEFKGTATGAWSVEIAPQFQANWESVADDTELIALYAE  70

Query  67   K----GYAN-LRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTHDG  119
            K    GYAN +R L+D D  LY        +CG++DP  +++  P+ GT     G  H G
Sbjct  71   KATEAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHG  124

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVR-YLKKRYSWQIYK  178
            PCE+WLDD  V+  D+C   F  +    DY S  G C  R+YWL  +     +Y WQIYK
Sbjct  125  PCEIWLDDTMVLHNDDCAKAFSVE----DYMSING-CMFRFYWLAFQGSTSGKYVWQIYK  179

>PYIW_21964
Length=265

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 96/205 (47%), Gaps = 30/205 (15%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLV-----------DGKDAQWKP--LA  47
            MAPS      V A+ AA+ +V AH  M  P+  F V           DG      P  ++
Sbjct  2    MAPSKTALAGVLAVLAAAPLVSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMS  61

Query  48   FLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT  107
            F  +   NT A  A  +K   Y ++RAL+DD+ ++    +A  ECG T PT   QP+P  
Sbjct  62   FTGDPASNTKAFTAA-LKASTYKSMRALVDDKAVF--IKEANKECGVTSPTGAKQPLPDK  118

Query  108  ----GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTL  158
                    S G+T  H GPCEVW DD    + +NC   +   P +  P+D++ C G+  L
Sbjct  119  YVEWSHSSSEGFTPSHQGPCEVWCDDKLAFTDENCAADYTSAPAE-LPIDHAKCVGASLL  177

Query  159  RWYWLGVRYLKKRYSWQIYKECVSL  183
            +  WL +       +WQIY  C  L
Sbjct  178  KIVWLALH----SSTWQIYINCAPL  198

>PHYCA_19598
Length=390

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 83/194 (43%), Gaps = 27/194 (14%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKD-----------AQWKPLAFLENQGVNTS  57
            L V+AL     VV+ H  +  P+  F     D           A   P  F      N +
Sbjct  8    LLVSALAVG--VVNGHGYLTIPKVKFTASAGDPTQFIGTIQSSASGLPGTFNGAPKDNVA  65

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRST  113
            A    F   K Y +L+ L  D+    V + A   CG  DP  E QP+P +        S 
Sbjct  66   AYTKAFASSK-YKSLKDLFTDKAKITV-SGATLTCGSCDPKEEPQPMPESIVEWSHSDSE  123

Query  114  GYT--HDGPCEVWLDDVKVMSGDNCHDKFP--GKTFPLDYSSCKGSCTLRWYWLGVRYLK  169
            G+T  H+GPCEVW DDV+    DNC   FP      P D  +C G+ TL +YW+ +    
Sbjct  124  GFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH---  180

Query  170  KRYSWQIYKECVSL  183
               +WQ+Y  C  L
Sbjct  181  -SDTWQVYVNCAPL  193

>PHYCA_19612
Length=610

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 86/186 (46%), Gaps = 28/186 (15%)

Query  18   SVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV------------NTSADVAGFMK  65
            +V  +AH  M  P   FL      Q+  +A +E                NT+A    F +
Sbjct  323  TVTRNAHGYMSDPAVKFLTTNDPTQF--IATIEASASGFSGSFSGSPADNTAAFTTAF-E  379

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDG  119
               Y++L+ L++D+    V TDA   CG  DP   +Q +P T        S G+T  H+G
Sbjct  380  SSSYSSLKELINDKATITV-TDATLTCGACDPDETAQALPATYVEWAHSDSEGFTASHEG  438

Query  120  PCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVW DDV+V  GD+C   +       P D+ +C GS  L +YWL +       +WQ+Y
Sbjct  439  PCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH----SSTWQVY  494

Query  178  KECVSL  183
              C  L
Sbjct  495  VNCAPL  500

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 82/186 (44%), Gaps = 25/186 (13%)

Query  17   ASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSA--------DVAGFMK---  65
            ++V V+ H  M  P   FL    D   + +A +E+     S         + A F K   
Sbjct  19   STVNVNGHGYMTEPAVTFLSSSTD-NTQFIATIESSASKFSGTFSGSPADNTAAFTKAFA  77

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDG  119
               Y +L+ L+       V TDA   CG  +P   +QP+P          + G+T  H+G
Sbjct  78   SSSYTSLKDLITSLATVTV-TDATLTCGSCNPDETAQPLPDKYVEWSHSSTEGFTSSHEG  136

Query  120  PCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVW DDV+V   D+C   +       P D  +C G+ TL +YWL +       +WQ+Y
Sbjct  137  PCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH----SSTWQVY  192

Query  178  KECVSL  183
              C  L
Sbjct  193  VNCAPL  198

>PHYKE_6079
Length=302

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 89/200 (45%), Gaps = 30/200 (15%)

Query  4    SFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGV---------  54
            SF   LA+  L A    V  H  M  P   FL    D   + +A +E+            
Sbjct  7    SFSAMLAMATLVAG---VYGHGYMTEPAVTFLSSSTD-NTQFIATIESSASGFSGTFSGS  62

Query  55   ---NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----  107
               NT+A    F   K Y +L+ L++D     V TDA   CG  DP   +QP+P T    
Sbjct  63   PADNTAAFTTAFDSSK-YTSLKELINDLATITV-TDATLTCGSCDPDETAQPLPETYVEW  120

Query  108  GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWL  163
                S G+T  H+GPCEVW DDV+V    +C   +       P D+ +C G+ TL +YWL
Sbjct  121  SHSSSEGFTSSHEGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWL  180

Query  164  GVRYLKKRYSWQIYKECVSL  183
             +       +WQ+Y  C  L
Sbjct  181  ALH----SSTWQVYVNCAPL  196

>PYAP_18221
Length=226

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 95/204 (47%), Gaps = 43/204 (21%)

Query  8    TLAVTALGAASVVV---DAHQMMIFPEPFFLVDGK---------DAQWKPLAFLENQGVN  55
            T  ++AL AA+ +V   +AH  +  P P F V GK          AQ   +A  + +  N
Sbjct  4    TAVLSALVAATALVNNAEAHGYISNPRPDF-VPGKMYTDFNAEFTAQQTGIAAFQGKPFN  62

Query  56   TSAD-----VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPT--TG  108
             S +          KQ G  +LR LMD           +  CG T+P    + +    T 
Sbjct  63   RSPEQNTQVFTDAFKQSGLKSLRELMDK---------YVPGCGNTNPNTTPRDVTKLKTM  113

Query  109  TIRSTGY------THDGPCEVWLDDVKVMSGDNC---HDKFPGKTFPLDYSSCKGSCTLR  159
            T ++  Y      +H GPCEVW+D+ +V   ++C   +  +P    P+DYS CKG+C L 
Sbjct  114  TYQNNEYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPA-ALPVDYSKCKGTCRLT  172

Query  160  WYWLGVRYLKKRYSWQIYKECVSL  183
            +YWL +   K    WQ YK+CV +
Sbjct  173  FYWLALHSQK----WQAYKQCVPI  192

>PYVX_21297
Length=263

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 52/95 (55%), Gaps = 6/95 (6%)

Query  91   ECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDY  149
             CG TD     QP+P+ G +       H GPCEVWLDD KV S ++C   +  KT P+DY
Sbjct  66   NCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASANDCWSTYADKTIPIDY  125

Query  150  SSCKG-SCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            S C G SC LRW WL          W+I+  CV++
Sbjct  126  SVCTGSSCQLRWVWLATH----NDPWEIFDNCVNV  156

>PHALS_05394
Length=288

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 92/197 (47%), Gaps = 28/197 (14%)

Query  8    TLAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ------GVNTSAD  59
            ++    + AA++V  V +H  +  P P +   GK+   + +  +E Q         +   
Sbjct  6    SIFAMVVAAANIVDHVQSHGFIANPPPSWK-KGKNENQEWVVQIEPQWKGDWDKATSDQG  64

Query  60   VAGFMKQKGYAN----LRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STG  114
            +    K+ G AN     R+LMD   +Y        +CGYTDP       P+ GT   S  
Sbjct  65   LLDTFKELGAANNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRP  118

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFPGKTF-------PLDYSSCKG-SCTLRWYWLGVR  166
              H G CE+W++   V+  D+C   +  K         P+DYSSCKG  C LR+YWL ++
Sbjct  119  MKHAGLCEIWINKKMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQ  178

Query  167  YLKKRYSWQIYKECVSL  183
             +  +  WQ YK C+S+
Sbjct  179  RIGDKTVWQAYKNCISI  195

>PYU1_G001528
Length=274

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 92/209 (44%), Gaps = 36/209 (17%)

Query  1    MAPSFLPT------LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW-----------  43
            +APSF  T      LA+  L  A    DAH  M  P+P F ++G   Q+           
Sbjct  2    VAPSFKSTAVLAGALAIFTLNGA----DAHGSMSVPKPTFTINGDTTQFCGTVDSSALTA  57

Query  44   -KPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQ  102
               ++F  +   NT+A  A  +K   Y ++R L + + +  V T A  +CGYT  T  +Q
Sbjct  58   PAGMSFTTDPLSNTNAFTAA-LKTSSYKSVRDLWNAKGVLGV-TGATKQCGYTSATGAAQ  115

Query  103  PIPTTGTIRSTGY------THDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKG  154
            P+P      S G       +H GPCEVW D+V   +  NC   +P      P D++ C G
Sbjct  116  PLPAKYVEWSHGSGEGFTPSHQGPCEVWCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVG  175

Query  155  SCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
               L  YWL +   +    WQ Y  C  L
Sbjct  176  KKMLTIYWLALHSPQ----WQAYINCAPL  200

>PYIR_19612
Length=260

 Score = 83.6 bits (205),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 14/123 (11%)

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTH  117
            + A   K+KG+A LR+ ++D+            CG+TDP    + IP    +R S   +H
Sbjct  62   NFATAAKEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFSRDISH  112

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE+W+DD +V   D+C   F G   ++ +D++ C G C +R+YWL ++    R  WQ
Sbjct  113  PGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGTR--WQ  170

Query  176  IYK  178
            +Y+
Sbjct  171  VYR  173

>PHYKE_6077
Length=322

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW------KPLAFLENQGVNTSADVAG  62
            L V A    +  V  H  M  P   F + G   Q+          F    G     + A 
Sbjct  9    LTVVASSMLAATVQGHGYMSAPPVEFTLVGDTTQYMGSIDAATSGFSGEFGGAPKDNTAN  68

Query  63   F---MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT------GTIRST  113
            F   M    Y +L+  M   K    + +   ECGYT+P   +QP+P T      G+    
Sbjct  69   FNKGMAASKYTSLKEFMA-AKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGF  127

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT--FPLDYSSCKGSCTLRWYWLGVRYLKKR  171
              +H+GPCEVW DD +V   DNC   FP      P D  +C GS  L  YW+ +      
Sbjct  128  TSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH----S  183

Query  172  YSWQIYKECVSL  183
             SWQ+Y  C +L
Sbjct  184  PSWQVYINCAAL  195

>PPTG_18166
Length=445

 Score = 85.5 bits (210),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 92/193 (48%), Gaps = 39/193 (20%)

Query  13   ALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAG----FMKQK  67
            AL   +   DAH  +  PEP +  D  +  W  +  ++N   + +  D  G      K+K
Sbjct  11   ALVVLTSRADAHGYLKQPEPDWK-DSPNPGW--ITMVDNYWDIGSGGDQVGKFKTMAKEK  67

Query  68   GYANLRALMD---DEKLYEVNTDALFECGYTDPTYESQPIPTTGTI-----RSTGYTHDG  119
            G +    ++D   D+K           CG T      +PIP+ G +     R  G+TH G
Sbjct  68   GMSVKDVVLDMVKDQK-----------CGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVG  116

Query  120  PCEVWLDDVKVMSGDNCHDKFPGKT--------FPLDYSSCKGSCTLRWYWLGVRYLKKR  171
            PCE++LDD  V+ GD+C +++PG +         P+D+SSC G CTL  YWL  +  +  
Sbjct  117  PCEIYLDDKMVLHGDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQNAQ--  174

Query  172  YSWQIYKECVSLS  184
              WQ Y  CV LS
Sbjct  175  --WQTYVNCVPLS  185

>PHYKE_5749
Length=300

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 92/196 (47%), Gaps = 33/196 (17%)

Query  8    TLAVTALGAASVV--VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFM  64
            +L ++A+G A +    DAH  +  P+P +  DG D     +  ++N   + +  D  G  
Sbjct  5    SLLLSAIGLAGLASRADAHGYLKEPKPSW-KDGGDGNVGWITQVDNYWDIGSGGDQVGKF  63

Query  65   K----QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGY  115
            K    +KG +    ++D   +    T     CG T P  + QPIP+ G  +       G+
Sbjct  64   KTMAAEKGMSVKDVVLD---MVGSQT-----CGNTLPDGDPQPIPSDGKAKWLGNEGGGF  115

Query  116  THDGPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRY  167
            TH GPCE++LDD  V+  D+C D+F G           P+DYSSC G C    YWL  + 
Sbjct  116  THTGPCEIYLDDKMVLHSDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWLAFQN  175

Query  168  LKKRYSWQIYKECVSL  183
             +    WQ Y  CV L
Sbjct  176  AQ----WQTYINCVPL  187

>PYU1_G001526
Length=334

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 14/127 (11%)

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGYT--HDG  119
            Q  Y ++RAL+D + +++   +   ECG T PT E QP+P          S G+T  H G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  120  PCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
            PCEVW D+V   S DNC   +P      P D S C G   L++YWL +       +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  178  KECVSLS  184
              C  L+
Sbjct  194  IACAPLA  200

>PYU1_G001519
Length=265

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 83/189 (44%), Gaps = 22/189 (12%)

Query  11   VTALGAASVVVDAHQMMIFPEPFF-----------LVDGKDAQWKP--LAFLENQGVNTS  57
            V AL   +   DAH  M  P+P +            +DG      P  ++F  +   NT+
Sbjct  9    VLALAVMAATADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTN  68

Query  58   ADVAGFMKQKGYANLRAL-MDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYT  116
            A +  F  Q  Y +L+ L M D +  +V + A  ECG++D     QP+P T        +
Sbjct  69   AYLKAFKAQTKYKSLKDLAMSDAQ--KVESGATKECGFSDVNGTPQPLPDTVQWDRFDNS  126

Query  117  HDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDY--SSCKGSCTLRWYWLGVRYLKKRYSW  174
            H GPCEVW DDV V   DNC    P     L Y  + C G   L  +W+ +       +W
Sbjct  127  HMGPCEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHVP----TW  182

Query  175  QIYKECVSL  183
            QIY  C  +
Sbjct  183  QIYTNCAPI  191

>SDRG_17317
Length=122

 Score = 79.3 bits (194),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 58/108 (54%), Gaps = 16/108 (15%)

Query  91   ECGYTDPTYESQPIPTTGTIR----STGY----THDGPCEVWLDDVKVMSGDNCHDKFPG  142
            +CG T  T   + IP+ GT+      TG     +H GPCEVWLDD +V   D+C   FP 
Sbjct  8    DCGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPA  67

Query  143  KT---FPLDYSSCKG-SCTLRWYWLGVRYLKKRYSWQIYKECVSLSDN  186
            K     P+DYSSC G  C LR+YWL +        WQ+YK CV L  N
Sbjct  68   KPAAHLPIDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPLEGN  111

>PPTG_07520
Length=294

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 25/182 (14%)

Query  16   AASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKGYANLRA  74
            A +  V+AH  +  P+P +  D  +  W  +  ++N   + +  D  G  K K  A  + 
Sbjct  14   ALTSRVEAHGYLEQPKPSWK-DKPNVGW--ITMVDNYWDIGSGGDQIG--KFKAMAKEKG  68

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVK  129
            +   + + ++  D   +CG T    + QPIP  G ++       G+TH GPCE++LDD  
Sbjct  69   MSVKDVVLDMVKDQ--KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKM  126

Query  130  VMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECV  181
            V+ GD+C D+F G           P+D+SSC G C L  YWL  +  +    WQ Y  CV
Sbjct  127  VLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCV  182

Query  182  SL  183
             L
Sbjct  183  PL  184

>PPTG_07516
Length=294

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 25/182 (14%)

Query  16   AASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGFMKQKGYANLRA  74
            A +  V+AH  +  P+P +  D  +  W  +  ++N   + +  D  G  K K  A  + 
Sbjct  14   ALTSRVEAHGYLEQPKPSWK-DKPNVGW--ITMVDNYWDIGSGGDQIG--KFKAMAKEKG  68

Query  75   LMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHDGPCEVWLDDVK  129
            +   + + ++  D   +CG T    + QPIP  G ++       G+TH GPCE++LDD  
Sbjct  69   MSVKDVVLDMVKDQ--KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKM  126

Query  130  VMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECV  181
            V+ GD+C D+F G           P+D+SSC G C L  YWL  +  +    WQ Y  CV
Sbjct  127  VLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVNCV  182

Query  182  SL  183
             L
Sbjct  183  PL  184

>SPRG_19916
Length=305

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 71/154 (46%), Gaps = 25/154 (16%)

Query  45   PLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPI  104
            P  F ++   N +     F  Q  +  LR ++D +           +CG T      + I
Sbjct  49   PGKFDDSPQTNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAI  99

Query  105  PTTGTIR----STGY----THDGPCEVWLDDVKVMSGDNCHDKFPGK---TFPLDYSSCK  153
            PT G +      TG     +H GPCEVW+DD +V   D+C   FP K     P+DYSSC 
Sbjct  100  PTNGMMTWQNPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCS  159

Query  154  G-SCTLRWYWLGVRYLKKRYSWQIYKECVSLSDN  186
            G  C LR+YWL +        WQ+YK CV L  N
Sbjct  160  GDGCMLRFYWLALH----EPMWQVYKNCVPLEGN  189

>PYU1_G005871
Length=284

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 23/131 (18%)

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR------STGY--TH  117
            + GY +L+ +MD          A+  CGY++P      +     ++        G+  +H
Sbjct  77   KTGYKSLKQMMDK---------AVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSH  127

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE W+D+ +V   D+C  KFPG   T P+ Y SCKG+C L +YWL +   K    WQ
Sbjct  128  HGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQ  183

Query  176  IYKECVSLSDN  186
             YK CV++ +N
Sbjct  184  AYKSCVAIKNN  194

>PYIR_14463
Length=369

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 66/143 (46%), Gaps = 24/143 (17%)

Query  48   FLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT  107
            F +N   N       F  Q  +  LR L+ D            +CG + P    + IP  
Sbjct  68   FDDNPQANVDTFTKAFNAQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGD  118

Query  108  GTI------RSTGY--THDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSC  156
            G +         G+  +H GPCEVWLDD +V S +NC   F   P    P+D+SSCKG C
Sbjct  119  GKVVWQNPDSGEGFVPSHTGPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDC  178

Query  157  TLRWYWLGVRYLKKRYSWQIYKE  179
             LR+YWL +       +WQ+Y E
Sbjct  179  MLRFYWLALH----EPTWQVYSE  197

>PYU1_G005872
Length=297

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 23/131 (18%)

Query  66   QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR------STGY--TH  117
            + GY +L+ +MD          A+  CGY++P      +     ++        G+  +H
Sbjct  77   KTGYKSLKQMMDK---------AVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSH  127

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
             GPCE W+D+ +V   D+C  KFPG   T P+ Y SCKG+C L +YWL +   K    WQ
Sbjct  128  HGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK----WQ  183

Query  176  IYKECVSLSDN  186
             YK CV++ +N
Sbjct  184  AYKSCVAIKNN  194

>CCA17179
Length=185

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 70/144 (49%), Gaps = 25/144 (17%)

Query  54   VNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTI---  110
            ++ +A          + NLR  + D+  Y         CG T+P  + +PIP    I   
Sbjct  31   IDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWE  81

Query  111  ---RSTGY--THDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYW  162
                  G+  +H GPCEVWL++ +V   DNC + F   P +  P+D+S+C   C L+++W
Sbjct  82   NPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPAR-IPIDFSTCTNGCLLQFFW  140

Query  163  LGVRYLKKRYSWQIYKECVSLSDN  186
            L +        WQ+YK C+ ++ N
Sbjct  141  LALH----EPQWQVYKNCIPIAPN  160

>PYIW_24287
Length=325

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 83/197 (42%), Gaps = 29/197 (15%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW-----KPLAFLENQGVNTSADVA--  61
            LA  A   A   V+ H  +  P+  F ++G   Q+      P       G + S D +  
Sbjct  10   LACVATALAVASVEGHGYLSVPKATFAINGDPTQFCATMFGPSTLTAPAGKSFSGDPSSN  69

Query  62   ------GFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIR  111
                   F  Q  YA+L+AL+D    +   + A  ECG T  T   QP+P T        
Sbjct  70   ALAFSTAFKAQTKYASLKALIDANGKFI--SGASKECGVTSATGAKQPLPATYVEWAHSN  127

Query  112  STGYT--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVR  166
              G+T  H GPCEVW D     S DNC   +   P K  P D S C G+  L++YWL + 
Sbjct  128  EEGFTPSHQGPCEVWCDGKVAFSNDNCPKNYATAPAK-LPYDKSKCTGASMLKFYWLALH  186

Query  167  YLKKRYSWQIYKECVSL  183
                  +WQ Y  C  L
Sbjct  187  ----SDTWQAYIACAPL  199

>PHYSO_262844
Length=276

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 90/197 (46%), Gaps = 37/197 (19%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFF-----------LVDGKDAQWKPLAFLENQGVNTS  57
            +A TA+   +  VDAH  +  P  +F           + +  D  +  L + +N   NT+
Sbjct  5    VATTAIALLAHSVDAHGYLTQPAAYFPYGINTKYNAIMTESCDPAFAGLKWNDNPEANTA  64

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR------  111
                 F   + +  LRA+MD          A  +CG T  T     + +  +++      
Sbjct  65   MFTKSFPNSQ-FKTLRAMMDT---------AASDCGNTALTGSPVDVSSLSSMKWQNDQE  114

Query  112  STGY--THDGPCEVWLDDVKVMSGDNC---HDKFPGKTFPLDYSSCKGSCTLRWYWLGVR  166
              G+  +H GPCE W+DD +V   D+C   +  +P +  P+DYS+C G CT  +YWL + 
Sbjct  115  QMGFIDSHHGPCEAWIDDTRVFHSDDCRAAYTSYPAE-IPIDYSACSGDCTFTFYWLALH  173

Query  167  YLKKRYSWQIYKECVSL  183
                  +WQ+YK+C  +
Sbjct  174  ----EPNWQVYKQCAPI  186

>PYIR_25999
Length=344

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 87/205 (42%), Gaps = 29/205 (14%)

Query  1    MAPSFLPTLA--VTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKP------------L  46
            +AP+    LA  +  L A    VDAH  M  P+P F + G   Q+              +
Sbjct  2    IAPTSKTVLACVLATLVAVPGAVDAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGM  61

Query  47   AFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPT  106
            +F  +   NT A  A  +K   Y ++R L++ + +      A  +CG T  T   QP+P 
Sbjct  62   SFTTDPESNTKAFTAA-IKTSAYKSVRDLINAKGVMMAG--ATKQCGITSATGTPQPLPA  118

Query  107  T----GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTL  158
                     S G+T  H GPCEVW DD    + DNC   +P      P+D+S C G   L
Sbjct  119  KYVEWSHGASEGFTPSHQGPCEVWCDDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLL  178

Query  159  RWYWLGVRYLKKRYSWQIYKECVSL  183
               WL +       +WQ Y  C  L
Sbjct  179  TMIWLALH----SPTWQAYINCAVL  199

>PYIW_24288
Length=201

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 80/207 (39%), Gaps = 34/207 (16%)

Query  5    FLPTL------AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW--------------K  44
             LPT+       V  L AA   VD H  M  P+P F+       +               
Sbjct  1    MLPTIKTAQLACVATLFAAVTSVDGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPA  60

Query  45   PLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPI  104
             + +  N   N       F  Q  Y NLR L+D   ++    D   ECG+T  T   QP+
Sbjct  61   GMTYSSNGANNARVYERAFGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPL  118

Query  105  PT------TGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDY--SSCKGSC  156
            P           +    TH+GPCEVW D        NC   F G    L Y  S C G+ 
Sbjct  119  PAQYVEWNNRVNQGLAPTHEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAK  178

Query  157  TLRWYWLGVRYLKKRYSWQIYKECVSL  183
             L++YWL    L  R  W++Y  CV L
Sbjct  179  MLKFYWLS---LDSR-EWEVYINCVPL  201

>PHYKE_7717
Length=568

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 0/45 (0%)

Query  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184
            FPGK + +DYS+CKG+CTLRWYWLGVR+LK  YSWQ+YK C+ L+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLT  46

>SPRG_19917
Length=241

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 64/134 (48%), Gaps = 25/134 (19%)

Query  62   GFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR----STG---  114
             F  Q  Y  LRAL+D             +CG T      + IP+ G +      TG   
Sbjct  66   AFKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEGF  116

Query  115  -YTHDGPCEVWLDDVKVMSGDNCHDKFPGK---TFPLDYSSCKGS-CTLRWYWLGVRYLK  169
              +H GPCEVWLD+ +V   D+C   FP K     P+DYSSC    C LR+YW+ +   +
Sbjct  117  ILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALHSPR  176

Query  170  KRYSWQIYKECVSL  183
                WQ+YK CV L
Sbjct  177  ----WQVYKNCVPL  186

>PYIR_16375
Length=262

 Score = 80.9 bits (198),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 8/118 (7%)

Query  68   GYANLRAL-MDDEKLYEVNTDALFECGYTD-PTYESQPIPTTGTIRSTGYTHDGPCEVWL  125
            GY +LR L + ++ +Y+ +TD   ECG T     +   +P +G I  +G+TH GPCE+W 
Sbjct  77   GYTSLRDLILANQDMYDESTDK--ECGLTTLDEAKRTTMPASGNITFSGFTHPGPCELWC  134

Query  126  DDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            DD K+   +NC   +P    P D + C G+   R +W+GV        WQ+Y  CV L
Sbjct  135  DDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVH----GSPWQVYTNCVYL  188

>PYU1_G001525
Length=312

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 80/188 (43%), Gaps = 21/188 (11%)

Query  11   VTALGAASVVVDAHQMMIFPEPFF-----------LVDGKDAQWKP--LAFLENQGVNTS  57
            +  +   +   DAH  M  P+P +            +DG  A   P  ++F  +   NT 
Sbjct  7    IAGVAVLAATADAHSKMALPKPTWNPVWGTNSPSGTIDGPKALTVPGGMSFGTDPTSNTK  66

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTH  117
            A  A F  Q  Y +L+ L+   +  E  T    ECG++  +   QP+P          +H
Sbjct  67   AFTAAFKAQTKYKSLKDLVFATQTVESGTTK--ECGFSLVSGTPQPLPDVVEWDELTPSH  124

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQ  175
            +GPCE+W D+    S +NC   +PG     P D S C G+  L   WL +       +WQ
Sbjct  125  EGPCEIWCDNKLAFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLALHT----PTWQ  180

Query  176  IYKECVSL  183
            +Y  C  L
Sbjct  181  VYTNCAPL  188

>PYU1_G001514
Length=469

 Score = 82.8 bits (203),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 86/204 (42%), Gaps = 27/204 (13%)

Query  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQW-------------KPLA  47
            M PS +  +       A + V AH  M  P+  F   G   Q+               ++
Sbjct  2    MTPSKMTGVLAVLAAVAPLGVSAHGYMSVPKVTFATSGDPTQFCATLDGPSTLTAPSGMS  61

Query  48   FLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT  107
            F  +   NT A  A F  Q  Y ++RAL+D + +++   D   +CG T  T   QP+P  
Sbjct  62   FTTDPESNTKAFAAAFKAQSTYKSMRALVDAKGVFQPGMDK--QCGVTSATGAKQPLPAK  119

Query  108  ----GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLR  159
                    S G+T  H GPCEVW D+ +V   DNC   +       P D S C G+  L+
Sbjct  120  YVEWAHSSSEGFTPSHQGPCEVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLK  179

Query  160  WYWLGVRYLKKRYSWQIYKECVSL  183
             YWL +       +WQ Y  C  L
Sbjct  180  IYWLALH----SSTWQAYINCAPL  199

>PHYRA_86751
Length=163

 Score = 78.6 bits (192),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 17/101 (17%)

Query  90   FECGYTDPTYESQPIPTTGTI-----RSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKT  144
            + CGYT    + + I T G          G+TH GPCE++LDD  ++ GDNC D++ G  
Sbjct  7    YPCGYTRTDVDPKAIRTDGLAIWYRNDGGGFTHQGPCEIYLDDTMILHGDNCEDEYSGGA  66

Query  145  --------FPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIY  177
                     P+DYSSC G+CTL  YWLG     +   WQ Y
Sbjct  67   DDSGIMSDMPIDYSSCNGACTLAIYWLGF----QNEQWQAY  103

>PYAP_19707
Length=241

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 50/95 (53%), Gaps = 6/95 (6%)

Query  91   ECGYTDPTYESQPIPTTGTIR-STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDY  149
            +CG TD     QPIPT G +       H GPCEVWLD+ KV S   C  +FP K   +D+
Sbjct  68   KCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEFPNKRIKVDF  127

Query  150  SSCK-GSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            + CK GSC LRW W+          W+ +  CV +
Sbjct  128  AKCKSGSCQLRWVWMATHT----SPWEFFDNCVRV  158

>PHYRA_77293
Length=302

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 91/198 (46%), Gaps = 35/198 (18%)

Query  9    LAVTALGAASVVVDAHQMMIFPEPFF-----------LVDGKDAQWKPLAFLENQGVNTS  57
            +A +A+   +  V AH  +  P  +F           L +  D  +  L + +N   NT+
Sbjct  5    VASSAVALLAHQVSAHGYLSQPAAYFPNGIDTKYNGLLTESCDPAFAGLKWNDNPEANTA  64

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR------  111
                 F K + +  LRALMD          A  +CG T  T  +  + +  +++      
Sbjct  65   MFTKSFPKSQ-FKTLRALMDT---------AAPDCGNTALTGTAVDVSSLSSMKWQNDQE  114

Query  112  STGY--THDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLGVRY  167
              G+  +H GPCE W+DD +V   D+C   + G     P+D+SSC G CT  +YW+ +  
Sbjct  115  QKGFIDSHHGPCEAWIDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAMH-  173

Query  168  LKKRYSWQIYKECVSLSD  185
                 +WQ+YK+C  +++
Sbjct  174  ---EPNWQVYKQCAPIAN  188

>PHYCA_10471
Length=309

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 87/192 (45%), Gaps = 24/192 (13%)

Query  13   ALGAA--SVVVDAHQMMIFPEPFF-----------LVDGKDAQWKP--LAFLENQGVNTS  57
            AL A+  +V  +AH  M  P P +           L+DG+D    P  +++      NT 
Sbjct  9    ALAASVLTVTTEAHSYMTDPMPTWSVGYPTTNYAGLIDGQDYLPVPDGMSYGGTPEGNTE  68

Query  58   ADVAGFMKQKGYANLRALMDDEKLYEVNT---DALFECGYTDPTYESQPIPTTGTIRSTG  114
            A    F   K Y++L+ L D   + +  +    A  ECG++ P   ++ +P     +  G
Sbjct  69   AYWTAFNASKKYSSLKDLADKTMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFG  128

Query  115  YTHDGPCEVWLDDVKVMSGDNCHDKFP--GKTFPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
            Y+H GPCEVW DD    S  NC   +P      P D   C G+  ++ YW+ +  L    
Sbjct  129  YSHQGPCEVWCDDKLAFSDTNCALHYPEVPANLPYDVDVCTGAKMMQSYWIALHGLP---  185

Query  173  SWQIYKECVSLS  184
             WQ+Y  CV LS
Sbjct  186  -WQLYLNCVRLS  196

>PYAP_22257
Length=247

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 66/139 (47%), Gaps = 22/139 (16%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPT------TG  108
            N  A    F  QK +  L+ +++ +            CG +    + Q +          
Sbjct  57   NVKAFTEAFKSQKTFKTLKDMVEKQ--------LKGSCGKSSGKGKPQSVEGLSDVHWEN  108

Query  109  TIRSTGY--THDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWLG  164
            T   TG+  +H GPCE+W+DD +VM  DNC  KF G     P++YS CKG C LR+YWL 
Sbjct  109  TEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLA  168

Query  165  VRYLKKRYSWQIYKECVSL  183
            +        WQ+YK CV +
Sbjct  169  LH----EPEWQVYKNCVPI  183

>PYU1_G001524
Length=300

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 77/177 (44%), Gaps = 21/177 (12%)

Query  22   DAHQMMIFPEPFF-----------LVDGKDAQWKP--LAFLENQGVNTSADVAGFMKQKG  68
            DAH  M  P+P +            +DG      P  ++F  +   NT A  A F  Q  
Sbjct  20   DAHSKMALPKPTWDPAWGTNSPSGTIDGPSVLTPPSGMSFSTDPASNTKAYTAAFKAQTK  79

Query  69   YANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDV  128
            Y +++ ++D  +  E  + A  ECG++     +QP+P          +H+GPCEVW DD 
Sbjct  80   YTSMKQMVDATQKLE--SGASKECGFSLVNGAAQPLPDQVEWDQLPASHEGPCEVWCDDK  137

Query  129  KVMSGDNCHDKFPGK--TFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
               S +NC   +P      P D S C G+  L   WL +       +WQ+Y  C  L
Sbjct  138  LAFSDENCAINYPDSPAKLPYDKSKCTGAKMLTSVWLALHVP----TWQVYYNCAPL  190

>SPRG_04679
Length=226

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 72/153 (47%), Gaps = 34/153 (22%)

Query  55   NTSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR---  111
            N +A  + F  Q  +  LR +++ +            CG + P    + IP+ GT+    
Sbjct  57   NVAAFTSAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLN  107

Query  112  -STG----YTHDGPCEVWLDDVKVMSGDNCHDKFPGKT---FPLDYSSCKGS-CTLRWYW  162
              TG     +H GPCEVWLDD +V   D+C   FP K     P+DYSSC G+ C LR+YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYW  167

Query  163  LGVRYLKKRYSWQIYKE---------CVSLSDN  186
            L +     +  WQ+Y +         CV L  N
Sbjct  168  LALH----QPQWQVYSQLKQPVWNENCVPLQGN  196

>PHYSO_488921
Length=296

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 8/73 (11%)

Query  116  THDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
            +H GPCE W+DDVK+   DNC  +F   P K  P DYSSCKG C L +YWL +       
Sbjct  122  SHSGPCEAWIDDVKIFHHDNCAAEFKSYPAK-VPADYSSCKGDCLLVFYWLALH----EP  176

Query  173  SWQIYKECVSLSD  185
            +WQIYK+CV +++
Sbjct  177  NWQIYKQCVPITN  189

>PPTG_10073
Length=186

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 85/187 (45%), Gaps = 25/187 (13%)

Query  5    FLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQ-GVNTSADVAGF  63
             L   AV  L   +   +AH  +  P+P +  D  +  W  +  ++N   + +  D  G 
Sbjct  1    MLAASAVVLLATFTSRTEAHSYLEQPKPSW-KDSPNPGW--VTLIDNYWDIGSGGDQVGA  57

Query  64   MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-----STGYTHD  118
             K    A  + +   + + ++  D   +CG T    + QPIP  G ++       G+TH 
Sbjct  58   FKT--MAKEKGMSVKDVVLDMVKDQ--KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHT  113

Query  119  GPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGVRYLKK  170
            GPCE++LDD  V+ GD+C D+F G           P+D+SSC G C L  YWL  +    
Sbjct  114  GPCEIYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQ----  169

Query  171  RYSWQIY  177
               WQ Y
Sbjct  170  NAQWQTY  176

>H310_05432
Length=301

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 31/194 (16%)

Query  8    TLAVTALGAASVVVDAHQMMIFPEPFF------------LVDGKDAQWKPLAFLENQGVN  55
            T+AV  L AA+    +H +++ P+P               +DG  A      + ++   N
Sbjct  6    TIAVV-LAAAAPWTRSHGILVDPKPTIRDGVPDKTNYCGTIDGYKA-LPGEKYDDSPEYN  63

Query  56   TSADVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR----  111
            T+A V  F K+  + +L+AL+  +           ECG T      QP+P  G ++    
Sbjct  64   TNAFVRQF-KKSSFTSLKALVHSQPT------TCGECGITRDDGTPQPMPLDGIVKWGHG  116

Query  112  STGY--THDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLK  169
            + GY  +H+GPCEVW D  +V S DNC    P    P++ ++CKG+  L + WL +    
Sbjct  117  NEGYVSSHEGPCEVWCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAMH---  173

Query  170  KRYSWQIYKECVSL  183
               SWQ+Y  CV L
Sbjct  174  -TSSWQVYINCVPL  186

>PYVX_21174
Length=95

 Score = 75.1 bits (183),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 12/74 (16%)

Query  114  GYTHDGPCEVWLDDVKVMSGDNCHDKFPG--------KTFPLDYSSCKGSCTLRWYWLGV  165
            G+TH GPCE+W DD   + GDNC +++PG           P+DYS CKG C LR+YWLG 
Sbjct  11   GFTHQGPCEIWFDDTLALRGDNCENEYPGGAVGSTDYSAIPVDYSLCKGDCVLRFYWLGF  70

Query  166  RYLKKRYSWQIYKE  179
                +   WQ Y E
Sbjct  71   ----QNAMWQSYSE  80

>H257_11265
Length=282

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 90/197 (46%), Gaps = 35/197 (18%)

Query  9    LAVTALGA-ASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFL-----------ENQGVNT  56
            L+VT L A       AH  ++ P+P F+  G D    P  +            EN  ++ 
Sbjct  8    LSVTLLAALMPTATLAHGYLVDPQPTFVNPGGD----PTGYSGTIDGNVALPGENYNLSP  63

Query  57   SADVAGF---MKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR--  111
              +   F   +K+  +A+LRA +D +     NT    ECG T      + +P+   ++  
Sbjct  64   QDNTIAFTRQLKKSSFASLRAFIDAQG----NTGG--ECGLTRADGTPRSLPSDSKVKWA  117

Query  112  --STGY--THDGPCEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRY  167
              S G+  +H+GPCE+W D  +V   DNC    P    P++ S C+GS  L   WL +  
Sbjct  118  HGSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHT  177

Query  168  LKKRYSWQIYKECVSLS  184
             +    WQ+YK CV L+
Sbjct  178  SQ----WQVYKNCVRLT  190

>PPTG_04617
Length=496

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 87/196 (44%), Gaps = 43/196 (22%)

Query  5    FLPTLAVTALGAASVV------VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSA  58
             + T+++ A  A +VV      VDAH   + PE   LV+ K  +                
Sbjct  1    MVSTMSLFAATATAVVCLFSTHVDAHGYTLIPEAVPLVEHKKDK----------------  44

Query  59   DVAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIR-STGYTH  117
             ++ ++ Q     +     D KLY        +C Y+DP  + +  P+ GT   S G  H
Sbjct  45   KISSWIVQ-----IEPQFIDSKLYGA------DCEYSDPKADPKTSPSDGTATFSRGIAH  93

Query  118  DGPCEVWLDDVKVMSGDNCHDKFPGKTF--------PLDYSSCKGS-CTLRWYWLGVRYL  168
             GPCE+WLDD  V+  D+C   F    +        P+DYSSC  S C  R+YW+  +  
Sbjct  94   HGPCEIWLDDKMVLHDDDCEKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGS  153

Query  169  KKRYSWQIYKECVSLS  184
               Y  QIY+ CV L+
Sbjct  154  DNGYVRQIYRHCVPLT  169

>PHYKE_3912
Length=252

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 88/187 (47%), Gaps = 29/187 (16%)

Query  9    LAVTALGAASVV-VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQK  67
            L+V A  AAS+  +++H  M  P   F  D   + W  +  +E Q         G + Q 
Sbjct  8    LSVVAGLAASISQINSHDYMNIPLAEF-TDSVTSAW--VVQIEPQWT-------GELGQ-  56

Query  68   GYANLRALMD-DEKLYEVNTDALFECGYTDPTYESQPIPTTG-TIRSTGYTHDGPCEVWL  125
               ++R L D D  LY  N      CG+TDP    +  PT G    S G  H G CE+WL
Sbjct  57   -LHDIRTLPDSDNSLYGAN------CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWL  109

Query  126  DDVKVMSGDNCHDKFPGKT-------FPLDYSSCKGS-CTLRWYWLGVRYLKKRYSWQIY  177
            DD  V+S D+C   +   T        P+D S C  S   LR+YWL  + +  +  WQ+Y
Sbjct  110  DDTMVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVY  169

Query  178  KECVSLS  184
            K+CV L+
Sbjct  170  KDCVPLT  176

>PHYSO_329293
Length=310

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 8/73 (11%)

Query  116  THDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRY  172
            +H GPCE W+DDVK+   DNC  +F   P K  P DYSSCKG C L +YWL +       
Sbjct  122  SHSGPCEAWIDDVKIFHHDNCAAEFKSYPAK-VPADYSSCKGDCLLVFYWLALH----EP  176

Query  173  SWQIYKECVSLSD  185
            +WQIYK+CV +++
Sbjct  177  NWQIYKQCVPITN  189

>PHYRA_78162
Length=478

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 87/201 (43%), Gaps = 30/201 (15%)

Query  5    FLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSA------  58
              P   + A   A  VV+ H  M  P   F  +  D       F+     +TS       
Sbjct  2    IAPVKCLVASAMAVTVVNGHGYMTKPAATFSAEAGD----KTQFIATIDSSTSGLKGTFN  57

Query  59   -----DVAGFMK---QKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT---  107
                 +VA F K      Y +L+AL+DD+    V T A   CG  DP   +Q +P T   
Sbjct  58   TAPADNVASFTKAFASSKYKSLKALIDDKAKVTV-TGATLTCGTADPAAAAQALPKTVEW  116

Query  108  GTIRSTGYT--HDGPCEVWLDDVKVMSGDNCHDKFPG--KTFPLDYSSCKGSCTLRWYWL  163
                S G+T  H+GPCEVW DDV+    +NC   F       P + S C+G+  L +YW+
Sbjct  117  SHSESEGFTASHEGPCEVWCDDVRAFQDENCSAHFTSAPAELPYESSKCQGASKLTFYWM  176

Query  164  GVRYLKKRYSWQIYKECVSLS  184
             +       SWQ+Y  C +LS
Sbjct  177  AMH----GPSWQVYVNCANLS  193

>PYVX_19277
Length=331

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 84/195 (43%), Gaps = 26/195 (13%)

Query  10   AVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPL----------AFLENQGVNTSAD  59
            A+ A  A    V+ H  M  P   F + G   Q+              F  +   NT++ 
Sbjct  10   AILAATAVVAQVNGHGYMSDPVVEFTITGDTTQFMATIESTASGFTGTFSSDPATNTASF  69

Query  60   VAGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTT----GTIRSTGY  115
               F     Y +LR  ++D     V +D    CGYT+P   +Q +P          + G+
Sbjct  70   TKAF-DASTYTSLREFVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGF  127

Query  116  T--HDGPCEVWLDDVKVMSGDNCHDKF---PGKTFPLDYSSCKGSCTLRWYWLGVRYLKK  170
            T  H+GPCEVW D+ +V   D+C   +   P K  P D  +C GS  L +YWL +     
Sbjct  128  TSSHEGPCEVWCDETRVFQDDDCAANYTTAPAK-LPYDRDACLGSSALTFYWLALH----  182

Query  171  RYSWQIYKECVSLSD  185
              +WQ+Y  C +L +
Sbjct  183  SSTWQVYINCAALEE  197

>PHYCA_132255
Length=128

 Score = 75.5 bits (184),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 54/98 (55%), Gaps = 9/98 (9%)

Query  91   ECGYTDPTYESQPIPTTGTIR--STGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK---TF  145
            ECG T      QP+PT G ++  S G +H GPCE+W DD +V    NC  ++ G+   + 
Sbjct  7    ECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPTSL  66

Query  146  PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183
            P+D  +CK S  L +YWL +    +   WQ+Y  CV L
Sbjct  67   PIDLDTCKSSSELVFYWLSL----QGAPWQVYINCVKL  100

Lambda      K        H        a         alpha
   0.317    0.134    0.425    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 15069773544

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40