Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0017385346122622611451e-160
PYU1_G001739932032662076394e-83
PYIW_18788932032441855515e-70
PPTG_17123147532011574911e-61
PHYRA_81105534612011574894e-61
PHYCA_537323449662001574884e-61
PITG_18452147538561605152e-59
PYAP_22273932032681974502e-54
PYIR_25089854042621604502e-54
PHYCA_14369109792481694473e-54
PPTG_10636109792462104464e-54
PHYRA_84190720132061874425e-54
PHYSO_353401534611461384358e-54
PYVX_18173449665001624602e-53
HYAP_07096534612511614412e-53
PHYRA_85631109792281914384e-53
PYU1_G001740147522061574364e-53
PPTG_10635528561991594347e-53
PHYSO_341599109791851654302e-52
PYU1_G001742932042131604305e-52
PHALS_00498109791991574251e-51
PHYSO_536424606911971654233e-51
PHYSO_507031586531971654233e-51
PHYCA_102550457052681614284e-51
PYU1_G001744568762131594227e-51
PHYKE_7718109792201794228e-51
PYU1_G001741854041991554191e-50
PPTG_10634720132081574155e-50
PYIW_18791854041941704137e-50
PHYCA_102624720131951574138e-50
PPTG_10643457052501684162e-49
PYAR_24096932032271624115e-49
PHYKE_3446231281991574052e-48
PHYCA_129425147522041574043e-48
PHYCA_102852242061951574024e-48
PYIR_26626147522121674001e-47
PHYKE_8389147522041633982e-47
PPTG_15264231281941593962e-47
PPTG_17366239131941593962e-47
PHYKE_8388568762051613904e-46
PHYRA_82864231281931573878e-46
PHYSO_284086147522041573861e-45
PHYRA_81106147522021633852e-45
PHYRA_81107568762021613824e-45
PPTG_10048213141901603772e-44
PHYSO_477820568762021573755e-44
PHALS_03284309411881703729e-44
PHYCA_511409568762041743722e-43
PPTG_17122147522041633712e-43
PPTG_17121568762021573687e-43
PYAP_22279854042231723699e-43
PYIR_26546866052391723612e-41
PITG_18450147522031633539e-41
PYAP_22278932042891713564e-40
PYVX_18174854042041583365e-38
PYVX_18176568762011733312e-37
PPTG_0882086622501623291e-36
PHYSO_499978231281741363213e-36
PHYSO_501575820771741363213e-36
PPTG_14254445761881393162e-35
PHYCA_510817445761881393163e-35
PITG_1049986623231593183e-34
PHYKE_9185445762811653145e-34
PPTG_14255469372681443075e-33
PHYSO_343376532371721232971e-32
PHYSO_417649445761851652981e-32
PITG_13520109791711272952e-32
PHYCA_53693413059831393111e-31
PHYSO_262732469371881792851e-30
PHYSO_254168462841701502734e-29
PHYSO_342364529831941252676e-28
PHYKE_839053461130952504e-26
PYU1_G007476539131951352545e-26
PYIR_1643542333041292572e-25
PHYSO_341596528562311012532e-25
PHYSO_527908600641741242483e-25
PHYCA_534473423310501332643e-25
PPTG_04622696962731312534e-25
PYAP_18711943562101332479e-25
PHYRA_7358442332871352511e-24
PHYRA_73607194343431352512e-24
PHYSO_340369526762001422432e-24
PHYCA_14368528562191692434e-24
PYIW_27477823991801262397e-24
PYAP_18131991722261182427e-24
PYAR_14256943551991712407e-24
PHYRA_74651699693441332471e-23
PITG_0527144782781282431e-23
PYVX_14662510865401322511e-23
PYU1_G01469042342951762432e-23
PYVX_16138786195591262483e-23
PHYSO_533903604652081262363e-23
PHYKE_2937571983661352443e-23
PHYKE_600144782891392404e-23
PPTG_04647194343271332424e-23
PYAP_246891014392521332359e-23
PHYRA_73606571983661312401e-22
PHYSO_459106194342231332303e-22
PITG_0494842342321522304e-22
PHYKE_2809752822911822318e-22
PPTG_0461842353261492338e-22
PYIR_16443823992751162301e-21
PHYCA_12727044782791542301e-21
PYU1_G005323943552511332271e-21
PHYCA_531163194343141312302e-21
PYIW_19151831912481462272e-21
PHYSO_340333526712841252273e-21
PHYSO_533682604462781302263e-21
PITG_0494742332981312273e-21
PHYSO_48552442342781382255e-21
PHYCA_534296526713091262265e-21
PHYSO_34033244782951242265e-21
PHYCA_69583463492241582216e-21
PHYCA_13036542352661752221e-20
PHYSO_438103557212381692211e-20
SDRG_081291363312181692181e-20
PHYSO_484051571982851312222e-20
PHYRA_7868968382961242222e-20
PPTG_0462042333421322242e-20
PITG_0494942353371372232e-20
PHYSO_533747604512061502162e-20
SDRG_075651244122781682202e-20
PHYKE_10578778802391332182e-20
PHYSO_48395542353201402223e-20
PYIR_1644442341821352143e-20
PHYSO_324715696932741822193e-20
PHALS_03177526712591292183e-20
PHYRA_86016727462361342173e-20
PPTG_0461942342761372184e-20
SDRG_081371363342821682185e-20
PHALS_0317644782071502146e-20
PHYRA_86752732363001342186e-20
PHYRA_73581696932931372178e-20
PYAP_18709943552351412149e-20
PHYRA_7358342346301252229e-20
PPTG_1422144782751252169e-20
PHYRA_83499204334731342201e-19
SPRG_2216117303001492142e-19
PYU1_G005324845341911482082e-19
PYU1_G005326463491911482082e-19
PYU1_G00532842331911482082e-19
PYAR_206171040482541942114e-19
PYU1_G00152797792781602106e-19
PYU1_G00152397762781602106e-19
PHYSO_246676457051871822057e-19
H310_0636217301971292058e-19
SPRG_199171339462411452079e-19
SPRG_19916161733051442109e-19
PHALS_03179308833721062129e-19
PHYKE_391342343211362092e-18
PYU1_G007364851643161362092e-18
PYAP_1871342341841322022e-18
PHYRA_7358242353261662082e-18
PYAR_14260845342121402033e-18
CCA1717917291851462003e-18
PYIW_21963839893261632065e-18
PHALS_0539242353671422066e-18
PYIR_19612831912601322036e-18
SDRG_173181339462411452016e-18
PHYSO_255056463492691512028e-18
PHYCA_97965401872881342021e-17
SDRG_17317161731221191911e-17
H257_1355017302661422002e-17
PYU1_G00152697803341382022e-17
PYU1_G005325943562071321962e-17
CCI4738117292111311962e-17
PYIR_24743851643571322004e-17
PYIR_23585845342401311955e-17
SPRG_046791244122261791938e-17
PHALS_0539442342881591968e-17
SDRG_0878217304501381981e-16
PPTG_0750738072991351951e-16
PPTG_07509718142991351951e-16
PHYRA_86241728921951271901e-16
PHYKE_902473982991451942e-16
PYAP_24691101441145721852e-16
PHYRA_8075044782751201932e-16
PHYCA_12943369712871411922e-16
PHYKE_6002526711971621873e-16
SPRG_076271258855361991953e-16
PHYRA_7914038074241311934e-16
PHYRA_78175764333191241915e-16
PHYRA_77971705552301101875e-16
PHYRA_83500718143941311926e-16
PHYRA_85794726192301101876e-16
PYAR_18165995792611321886e-16
PPTG_0313997753201241907e-16
PHYSO_488921574612961721897e-16
PYIW_1552617302561311887e-16
PYIR_2213497753001761897e-16
PITG_1193697753331241908e-16
PYIW_1879293204125971798e-16
PPTG_04617696934961181928e-16
PHYSO_329293510323101721891e-15
PHYSO_476077161732681671871e-15
PHYSO_472009159812681671871e-15
PYIW_242881643022011291841e-15
PYAP_236721009052571771861e-15
SPRG_077951259793351431881e-15
PHYKE_771752856568801902e-15
PHYCA_1961197755311591892e-15
PHYRA_83494464352241351832e-15
PITG_0889273983091451862e-15
PYAP_222571003612471351842e-15
PYU1_G00586817292671621852e-15
PYIR_14463819503691261872e-15
PYVX_24563161732541581834e-15
PYIW_242891643031961191794e-15
SPRG_077971259813181341844e-15
PITG_20312159812701541825e-15
PHYCA_112615308831961121795e-15
PPTG_0625673983181451845e-15
PHYRA_84732161732651591816e-15
PITG_20631161732701601826e-15
PHYKE_1029517292921851826e-15
PHYCA_103479510323141611836e-15
PHYKE_391242332521251817e-15
PHYCA_15125371743341491837e-15
PHYCA_1047197823091361827e-15
PHYKE_2454751493741331847e-15
PHYKE_6077188563221391828e-15
SDRG_17448138489262831809e-15
PYAP_18138991732681171801e-14
PYU1_G005872161732971431811e-14
PHALS_04411944962621351791e-14
PHYCA_6388711612941481801e-14
PHYRA_93650463492311181771e-14
PYU1_G005871944962841431801e-14
SDRG_154261258855231371821e-14
PYAP_243381012312671611792e-14
PHYCA_12942213313531011812e-14
PHYKE_744597873691561812e-14
PHYCA_14560574613001701792e-14
PYIR_26867868821631571732e-14
PYIR_2048117292771641782e-14
PHYRA_77290574613091721792e-14
PHYKE_2539161732581591772e-14
PHYCA_1512473982941531792e-14
PPTG_10186161732701571782e-14
PHYCA_122958161732601551772e-14
PYU1_G001475823952721561772e-14
PYIW_2196497752651311773e-14
PHALS_10635341192961301783e-14
PHYRA_8063173983201411783e-14
PHYCA_1865738072951161773e-14
PHYCA_132255434681281101693e-14
PHALS_0648053461159571713e-14
PHALS_02044930992371131753e-14
PITG_1194297802711761764e-14
PHYRA_78174188562791611764e-14
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001738

Length=226
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001738                                                          445        1e-160
PYU1_G001739                                                          250        4e-83 
PYIW_18788                                                            216        5e-70 
PPTG_17123                                                            193        1e-61 
PHYRA_81105                                                           192        4e-61 
PHYCA_537323                                                          192        4e-61 
PITG_18452                                                            202        2e-59 
PYAP_22273                                                            177        2e-54 
PYIR_25089                                                            177        2e-54 
PHYCA_14369                                                           176        3e-54 
PPTG_10636                                                            176        4e-54 
PHYRA_84190                                                           174        5e-54 
PHYSO_353401                                                          172        8e-54 
PYVX_18173                                                            181        2e-53 
HYAP_07096                                                            174        2e-53 
PHYRA_85631                                                           173        4e-53 
PYU1_G001740                                                          172        4e-53 
PPTG_10635                                                            171        7e-53 
PHYSO_341599                                                          170        2e-52 
PYU1_G001742                                                          170        5e-52 
PHALS_00498                                                           168        1e-51 
PHYSO_536424                                                          167        3e-51 
PHYSO_507031                                                          167        3e-51 
PHYCA_102550                                                          169        4e-51 
PYU1_G001744                                                          167        7e-51 
PHYKE_7718                                                            167        8e-51 
PYU1_G001741                                                          166        1e-50 
PPTG_10634                                                            164        5e-50 
PYIW_18791                                                            163        7e-50 
PHYCA_102624                                                          163        8e-50 
PPTG_10643                                                            164        2e-49 
PYAR_24096                                                            162        5e-49 
PHYKE_3446                                                            160        2e-48 
PHYCA_129425                                                          160        3e-48 
PHYCA_102852                                                          159        4e-48 
PYIR_26626                                                            158        1e-47 
PHYKE_8389                                                            157        2e-47 
PPTG_15264                                                            157        2e-47 
PPTG_17366                                                            157        2e-47 
PHYKE_8388                                                            154        4e-46 
PHYRA_82864                                                           153        8e-46 
PHYSO_284086                                                          153        1e-45 
PHYRA_81106                                                           152        2e-45 
PHYRA_81107                                                           151        4e-45 
PPTG_10048                                                            149        2e-44 
PHYSO_477820                                                          149        5e-44 
PHALS_03284                                                           147        9e-44 
PHYCA_511409                                                          147        2e-43 
PPTG_17122                                                            147        2e-43 
PPTG_17121                                                            146        7e-43 
PYAP_22279                                                            146        9e-43 
PYIR_26546                                                            143        2e-41 
PITG_18450                                                            140        9e-41 
PYAP_22278                                                            141        4e-40 
PYVX_18174                                                            134        5e-38 
PYVX_18176                                                            132        2e-37 
PPTG_08820                                                            131        1e-36 
PHYSO_499978                                                          128        3e-36 
PHYSO_501575                                                          128        3e-36 
PPTG_14254                                                            126        2e-35 
PHYCA_510817                                                          126        3e-35 
PITG_10499                                                            127        3e-34 
PHYKE_9185                                                            125        5e-34 
PPTG_14255                                                            122        5e-33 
PHYSO_343376                                                          119        1e-32 
PHYSO_417649                                                          119        1e-32 
PITG_13520                                                            118        2e-32 
PHYCA_536934                                                          124        1e-31 
PHYSO_262732                                                          114        1e-30 
PHYSO_254168                                                          109        4e-29 
PHYSO_342364                                                          107        6e-28 
PHYKE_8390                                                            100        4e-26 
PYU1_G007476                                                          102        5e-26 
PYIR_16435                                                            103        2e-25 
PHYSO_341596                                                          102        2e-25 
PHYSO_527908                                                          100        3e-25 
PHYCA_534473                                                          106        3e-25 
PPTG_04622                                                            102        4e-25 
PYAP_18711                                                            99.8       9e-25 
PHYRA_73584                                                           101        1e-24 
PHYRA_73607                                                           101        2e-24 
PHYSO_340369                                                          98.2       2e-24 
PHYCA_14368                                                           98.2       4e-24 
PYIW_27477                                                            96.7       7e-24 
PYAP_18131                                                            97.8       7e-24 
PYAR_14256                                                            97.1       7e-24 
PHYRA_74651                                                           99.8       1e-23 
PITG_05271                                                            98.2       1e-23 
PYVX_14662                                                            101        1e-23 
PYU1_G014690                                                          98.2       2e-23 
PYVX_16138                                                            100        3e-23 
PHYSO_533903                                                          95.5       3e-23 
PHYKE_2937                                                            98.6       3e-23 
PHYKE_6001                                                            97.1       4e-23 
PPTG_04647                                                            97.8       4e-23 
PYAP_24689                                                            95.1       9e-23 
PHYRA_73606                                                           97.1       1e-22 
PHYSO_459106                                                          93.2       3e-22 
PITG_04948                                                            93.2       4e-22 
PHYKE_2809                                                            93.6       8e-22 
PPTG_04618                                                            94.4       8e-22 
PYIR_16443                                                            93.2       1e-21 
PHYCA_127270                                                          93.2       1e-21 
PYU1_G005323                                                          92.0       1e-21 
PHYCA_531163                                                          93.2       2e-21 
PYIW_19151                                                            92.0       2e-21 
PHYSO_340333                                                          92.0       3e-21 
PHYSO_533682                                                          91.7       3e-21 
PITG_04947                                                            92.0       3e-21 
PHYSO_485524                                                          91.3       5e-21 
PHYCA_534296                                                          91.7       5e-21 
PHYSO_340332                                                          91.7       5e-21 
PHYCA_69583                                                           89.7       6e-21 
PHYCA_130365                                                          90.1       1e-20 
PHYSO_438103                                                          89.7       1e-20 
SDRG_08129                                                            88.6       1e-20 
PHYSO_484051                                                          90.1       2e-20 
PHYRA_78689                                                           90.1       2e-20 
PPTG_04620                                                            90.9       2e-20 
PITG_04949                                                            90.5       2e-20 
PHYSO_533747                                                          87.8       2e-20 
SDRG_07565                                                            89.4       2e-20 
PHYKE_10578                                                           88.6       2e-20 
PHYSO_483955                                                          90.1       3e-20 
PYIR_16444                                                            87.0       3e-20 
PHYSO_324715                                                          89.0       3e-20 
PHALS_03177                                                           88.6       3e-20 
PHYRA_86016                                                           88.2       3e-20 
PPTG_04619                                                            88.6       4e-20 
SDRG_08137                                                            88.6       5e-20 
PHALS_03176                                                           87.0       6e-20 
PHYRA_86752                                                           88.6       6e-20 
PHYRA_73581                                                           88.2       8e-20 
PYAP_18709                                                            87.0       9e-20 
PHYRA_73583                                                           90.1       9e-20 
PPTG_14221                                                            87.8       9e-20 
PHYRA_83499                                                           89.4       1e-19 
SPRG_22161                                                            87.0       2e-19 
PYU1_G005324                                                          84.7       2e-19 
PYU1_G005326                                                          84.7       2e-19 
PYU1_G005328                                                          84.7       2e-19 
PYAR_20617                                                            85.9       4e-19 
PYU1_G001527                                                          85.5       6e-19 
PYU1_G001523                                                          85.5       6e-19 
PHYSO_246676                                                          83.6       7e-19 
H310_06362                                                            83.6       8e-19 
SPRG_19917                                                            84.3       9e-19 
SPRG_19916                                                            85.5       9e-19 
PHALS_03179                                                           86.3       9e-19 
PHYKE_3913                                                            85.1       2e-18 
PYU1_G007364                                                          85.1       2e-18 
PYAP_18713                                                            82.4       2e-18 
PHYRA_73582                                                           84.7       2e-18 
PYAR_14260                                                            82.8       3e-18 
CCA17179                                                              81.6       3e-18 
PYIW_21963                                                            84.0       5e-18 
PHALS_05392                                                           84.0       6e-18 
PYIR_19612                                                            82.8       6e-18 
SDRG_17318                                                            82.0       6e-18 
PHYSO_255056                                                          82.4       8e-18 
PHYCA_97965                                                           82.4       1e-17 
SDRG_17317                                                            78.2       1e-17 
H257_13550                                                            81.6       2e-17 
PYU1_G001526                                                          82.4       2e-17 
PYU1_G005325                                                          80.1       2e-17 
CCI47381                                                              80.1       2e-17 
PYIR_24743                                                            81.6       4e-17 
PYIR_23585                                                            79.7       5e-17 
SPRG_04679                                                            79.0       8e-17 
PHALS_05394                                                           80.1       8e-17 
SDRG_08782                                                            80.9       1e-16 
PPTG_07507                                                            79.7       1e-16 
PPTG_07509                                                            79.7       1e-16 
PHYRA_86241                                                           77.8       1e-16 
PHYKE_9024                                                            79.3       2e-16 
PYAP_24691                                                            75.9       2e-16 
PHYRA_80750                                                           79.0       2e-16 
PHYCA_12943                                                           78.6       2e-16 
PHYKE_6002                                                            76.6       3e-16 
SPRG_07627                                                            79.7       3e-16 
PHYRA_79140                                                           79.0       4e-16 
PHYRA_78175                                                           78.2       5e-16 
PHYRA_77971                                                           76.6       5e-16 
PHYRA_83500                                                           78.6       6e-16 
PHYRA_85794                                                           76.6       6e-16 
PYAR_18165                                                            77.0       6e-16 
PPTG_03139                                                            77.8       7e-16 
PHYSO_488921                                                          77.4       7e-16 
PYIW_15526                                                            77.0       7e-16 
PYIR_22134                                                            77.4       7e-16 
PITG_11936                                                            77.8       8e-16 
PYIW_18792                                                            73.6       8e-16 
PPTG_04617                                                            78.6       8e-16 
PHYSO_329293                                                          77.4       1e-15 
PHYSO_476077                                                          76.6       1e-15 
PHYSO_472009                                                          76.6       1e-15 
PYIW_24288                                                            75.5       1e-15 
PYAP_23672                                                            76.3       1e-15 
SPRG_07795                                                            77.0       1e-15 
PHYKE_7717                                                            77.8       2e-15 
PHYCA_19611                                                           77.4       2e-15 
PHYRA_83494                                                           75.1       2e-15 
PITG_08892                                                            76.3       2e-15 
PYAP_22257                                                            75.5       2e-15 
PYU1_G005868                                                          75.9       2e-15 
PYIR_14463                                                            76.6       2e-15 
PYVX_24563                                                            75.1       4e-15 
PYIW_24289                                                            73.6       4e-15 
SPRG_07797                                                            75.5       4e-15 
PITG_20312                                                            74.7       5e-15 
PHYCA_112615                                                          73.6       5e-15 
PPTG_06256                                                            75.5       5e-15 
PHYRA_84732                                                           74.3       6e-15 
PITG_20631                                                            74.7       6e-15 
PHYKE_10295                                                           74.7       6e-15 
PHYCA_103479                                                          75.1       6e-15 
PHYKE_3912                                                            74.3       7e-15 
PHYCA_15125                                                           75.1       7e-15 
PHYCA_10471                                                           74.7       7e-15 
PHYKE_2454                                                            75.5       7e-15 
PHYKE_6077                                                            74.7       8e-15 
SDRG_17448                                                            73.9       9e-15 
PYAP_18138                                                            73.9       1e-14 
PYU1_G005872                                                          74.3       1e-14 
PHALS_04411                                                           73.6       1e-14 
PHYCA_6388                                                            73.9       1e-14 
PHYRA_93650                                                           72.8       1e-14 
PYU1_G005871                                                          73.9       1e-14 
SDRG_15426                                                            74.7       1e-14 
PYAP_24338                                                            73.6       2e-14 
PHYCA_12942                                                           74.3       2e-14 
PHYKE_7445                                                            74.3       2e-14 
PHYCA_14560                                                           73.6       2e-14 
PYIR_26867                                                            71.2       2e-14 
PYIR_20481                                                            73.2       2e-14 
PHYRA_77290                                                           73.6       2e-14 
PHYKE_2539                                                            72.8       2e-14 
PHYCA_15124                                                           73.6       2e-14 
PPTG_10186                                                            73.2       2e-14 
PHYCA_122958                                                          72.8       2e-14 
PYU1_G001475                                                          72.8       2e-14 
PYIW_21964                                                            72.8       3e-14 
PHALS_10635                                                           73.2       3e-14 
PHYRA_80631                                                           73.2       3e-14 
PHYCA_18657                                                           72.8       3e-14 
PHYCA_132255                                                          69.7       3e-14 
PHALS_06480                                                           70.5       3e-14 
PHALS_02044                                                           72.0       3e-14 
PITG_11942                                                            72.4       4e-14 
PHYRA_78174                                                           72.4       4e-14 
PHYRA_78176                                                           72.8       4e-14 
PITG_08202                                                            70.9       4e-14 
PYAP_19707                                                            71.6       5e-14 
PYAP_18221                                                            71.2       5e-14 
H310_05432                                                            72.4       5e-14 
PYIR_24421                                                            70.9       6e-14 
PYIW_24287                                                            72.4       7e-14 
PHYCA_120062                                                          70.5       7e-14 
PYVX_18175                                                            68.9       8e-14 
PYAP_19712                                                            71.2       9e-14 
PPTG_06249                                                            71.2       1e-13 
PPTG_06253                                                            71.2       1e-13 
PHYCA_15126                                                           71.6       1e-13 
PYIW_25463                                                            70.1       1e-13 
HYAP_14170                                                            70.9       1e-13 
PHYCA_98479                                                           70.9       1e-13 
PHYRA_84947                                                           70.9       1e-13 
PHYRA_78161                                                           71.6       1e-13 
PHYSO_262844                                                          70.5       2e-13 
PHYSO_337515                                                          70.9       2e-13 
PHYSO_524101                                                          70.5       2e-13 
PYU1_G001517                                                          70.5       2e-13 
PHYKE_6079                                                            70.5       3e-13 
HYAP_01683                                                            70.5       3e-13 
PHYKE_1913                                                            70.1       3e-13 
PHYSO_426658                                                          68.9       3e-13 
PYIR_16375                                                            69.7       3e-13 
PPTG_03153                                                            70.1       3e-13 
PHYSO_374518                                                          66.2       4e-13 
PHYKE_6076                                                            69.3       5e-13 
SDRG_16534                                                            69.7       5e-13 
PYU1_G006404                                                          68.9       6e-13 
PHYRA_78625                                                           69.7       7e-13 
PYU1_G005866                                                          67.4       8e-13 
PYIW_18065                                                            68.9       8e-13 
PHYRA_78626                                                           69.7       8e-13 
PYU1_G001519                                                          68.6       9e-13 
PYAP_18226                                                            67.8       9e-13 
PYU1_G005869                                                          68.2       1e-12 
PYU1_G001528                                                          68.2       1e-12 
PHYSO_525121                                                          67.4       1e-12 
PYU1_G006405                                                          68.6       1e-12 
PYU1_G001514                                                          68.9       2e-12 
PYIR_22136                                                            68.2       2e-12 
PPTG_04801                                                            67.8       2e-12 
PYIW_16810                                                            67.0       2e-12 
PYIR_22135                                                            68.2       2e-12 
H257_11264                                                            67.8       2e-12 
PITG_11937                                                            67.8       2e-12 
PPTG_03145                                                            67.8       2e-12 
PPTG_01153                                                            68.2       2e-12 
PYU1_G001518                                                          68.2       2e-12 
PYU1_G001524                                                          67.8       2e-12 
PYVX_21297                                                            67.4       2e-12 
PYU1_G005873                                                          66.6       2e-12 
PPTG_03147                                                            67.4       2e-12 
PHYRA_78168                                                           67.8       2e-12 
H257_11265                                                            67.4       3e-12 
PYVX_20789                                                            67.4       3e-12 
PYAR_24818                                                            66.2       3e-12 
PHALS_02041                                                           67.0       3e-12 
PHYCA_562062                                                          66.6       3e-12 
PYAR_25093                                                            65.9       3e-12 
PYAR_17307                                                            66.6       3e-12 
PPTG_07521                                                            67.0       3e-12 
PHYCA_19598                                                           67.8       3e-12 
PHYCA_19612                                                           68.2       3e-12 
PPTG_04803                                                            67.0       3e-12 
PYVX_20783                                                            67.0       3e-12 
PHYCA_123316                                                          67.0       4e-12 
PHYSO_246481                                                          67.0       4e-12 
PPTG_03144                                                            67.0       5e-12 
PYIW_18790                                                            62.8       5e-12 
PHYSO_375794                                                          63.5       5e-12 
PHYRA_86751                                                           64.3       6e-12 
PYIW_18794                                                            65.9       6e-12 
PHYRA_80632                                                           66.6       6e-12 
PITG_11944                                                            66.2       7e-12 
PHALS_08575                                                           66.2       7e-12 
PITG_21641                                                            66.6       7e-12 
PYU1_G001516                                                          66.2       7e-12 
H257_11271                                                            66.6       8e-12 
PHYSO_255975                                                          64.3       9e-12 
PPTG_03148                                                            65.5       1e-11 
PHYKE_5749                                                            65.5       1e-11 
PPTG_01148                                                            65.5       2e-11 
PYIR_23689                                                            64.3       2e-11 
PHYKE_6078                                                            65.5       2e-11 
PHYRA_78167                                                           65.1       2e-11 
PYU1_G001525                                                          65.1       2e-11 
PHYCA_10470                                                           65.1       2e-11 
PPTG_07516                                                            65.1       2e-11 
PPTG_03138                                                            65.1       2e-11 
PPTG_07520                                                            64.7       2e-11 
PHYSO_454780                                                          63.2       3e-11 
PYAR_24113                                                            63.2       3e-11 
PHYRA_77293                                                           64.7       3e-11 
PHYRA_78165                                                           64.7       3e-11 
PHYKE_2379                                                            64.3       3e-11 
PPTG_06106                                                            64.3       3e-11 
PYVX_21174                                                            60.8       3e-11 
PYIR_20483                                                            64.3       3e-11 
PYU1_G006403                                                          63.9       3e-11 
PYAP_20161                                                            63.5       4e-11 
PHYRA_78162                                                           64.7       4e-11 
SDRG_16535                                                            64.3       4e-11 
PHYKE_10296                                                           64.7       4e-11 
PPTG_18166                                                            64.7       4e-11 
PYVX_19277                                                            64.3       4e-11 
HYAP_11923                                                            64.7       4e-11 
PPTG_03143                                                            64.3       4e-11 
PHYRA_78164                                                           63.9       5e-11 
PHYSO_374025                                                          63.9       5e-11 
PYIR_25334                                                            63.5       5e-11 
PYAR_15391                                                            62.0       5e-11 
PYAP_18584                                                            62.8       6e-11 
PYU1_G006672                                                          58.5       7e-11 
PYAR_14261                                                            61.2       7e-11 
PHYSO_318683                                                          63.5       7e-11 
PYU1_G005985                                                          62.0       8e-11 
PHYCA_123476                                                          63.2       9e-11 
PYVX_22509                                                            63.2       1e-10 
PYAP_16994                                                            62.8       1e-10 
PHYCA_18729                                                           63.5       1e-10 
PHYKE_9023                                                            62.8       1e-10 
PHALS_05110                                                           61.6       1e-10 
H257_11306                                                            63.2       1e-10 
SPRG_07796                                                            62.8       1e-10 
PYIR_22634                                                            62.4       1e-10 
PITG_08895                                                            61.2       1e-10 
PHYRA_86201                                                           62.4       1e-10 
PITG_01966                                                            62.8       1e-10 
PYVX_22511                                                            62.4       2e-10 
PYIR_16437                                                            62.4       2e-10 
PHYSO_525076                                                          62.8       2e-10 
PYVX_16673                                                            63.2       2e-10 
PYAP_23673                                                            62.4       2e-10 
PYIR_25999                                                            62.4       2e-10 
PHALS_02037                                                           62.4       2e-10 
H257_11258                                                            62.4       2e-10 
HYAP_01682                                                            62.0       2e-10 
PYAP_16338                                                            61.6       3e-10 
PYVX_22508                                                            61.6       3e-10 
PYVX_23997                                                            60.5       3e-10 
PYAR_21271                                                            60.8       3e-10 
PPTG_07511                                                            60.1       4e-10 
PITG_11957                                                            61.2       5e-10 
PYIW_25573                                                            60.5       6e-10 
PPTG_03156                                                            61.2       6e-10 
PYIR_22133                                                            61.2       6e-10 
PPTG_13879                                                            60.8       7e-10 
PYAP_22462                                                            59.7       7e-10 
PYU1_G001520                                                          60.8       7e-10 
PPTG_03140                                                            60.8       7e-10 
PHALS_01293                                                           60.8       7e-10 
PPTG_03160                                                            60.8       8e-10 
SPRG_07799                                                            60.8       8e-10 
PYVX_24274                                                            59.7       8e-10 
H310_05438                                                            60.5       8e-10 
PHYKE_6066                                                            60.1       8e-10 
PHYCA_12944                                                           58.5       1e-09 
PYIR_15187                                                            59.3       1e-09 
PHYCA_14559                                                           59.7       1e-09 
PHYSO_488139                                                          59.7       1e-09 
PPTG_10073                                                            58.5       1e-09 
PYAP_14265                                                            60.1       1e-09 
PHYRA_78172                                                           60.5       1e-09 
PHYRA_78177                                                           60.1       1e-09 
PHYRA_78169                                                           60.1       1e-09 
PHYRA_79881                                                           59.3       1e-09 
H310_05433                                                            60.1       1e-09 
PYIW_20715                                                            59.3       2e-09 
PYIW_16208                                                            59.3       2e-09 
PYAR_16493                                                            58.9       2e-09 
PYVX_18179                                                            57.0       2e-09 
PHYRA_77291                                                           58.9       2e-09 
PYIW_26655                                                            58.9       2e-09 
PPTG_18176                                                            58.9       2e-09 
PYVX_22510                                                            59.7       2e-09 
PYIR_24867                                                            59.3       2e-09 
PYU1_G005867                                                          57.8       3e-09 
PYAP_20456                                                            58.9       3e-09 
PYAR_17163                                                            55.8       3e-09 
PHYCA_19608                                                           58.2       4e-09 
PYU1_G005878                                                          54.3       5e-09 
PYAR_17166                                                            55.5       5e-09 
PYIR_17978                                                            57.8       6e-09 
PYVX_21643                                                            57.8       6e-09 
SDRG_00948                                                            58.2       6e-09 
PPTG_20376                                                            56.6       6e-09 
PHYCA_552912                                                          58.2       6e-09 
PYAR_21940                                                            57.4       7e-09 
PYAR_22574                                                            54.3       7e-09 
PITG_11943                                                            56.2       7e-09 
PHYKE_7443                                                            57.8       7e-09 
PYIW_23030                                                            57.0       9e-09 
PPTG_03161                                                            57.4       1e-08 
PYIW_17867                                                            57.4       1e-08 
PHYSO_489485                                                          55.1       1e-08 
PYIR_20482                                                            55.1       1e-08 
PYAP_23455                                                            57.0       1e-08 
PHYCA_19606                                                           56.6       2e-08 
PHYRA_75781                                                           56.2       2e-08 
PYIR_22187                                                            56.2       2e-08 
PYIR_26312                                                            54.3       2e-08 
PYIW_13243                                                            56.2       2e-08 
PYIW_19601                                                            55.1       3e-08 
PYVX_21438                                                            55.5       4e-08 
PITG_01969                                                            55.5       4e-08 
PPTG_01147                                                            55.5       4e-08 
PPTG_09880                                                            54.3       5e-08 
PYIR_24935                                                            55.1       5e-08 
PYAP_16347                                                            53.9       5e-08 
PHYSO_257305                                                          53.9       7e-08 
PHALS_02296                                                           54.3       8e-08 
PPTG_01152                                                            54.3       9e-08 
PYU1_G007242                                                          53.9       1e-07 
PHALS_01460                                                           54.3       1e-07 
PHYKE_6069                                                            54.3       1e-07 
PHYKE_7446                                                            54.3       1e-07 
PHYCA_19599                                                           53.9       2e-07 
PHYSO_324755                                                          53.1       2e-07 
PHYRA_95184                                                           53.9       2e-07 
SPRG_07826                                                            53.1       3e-07 
PYU1_G005862                                                          52.0       3e-07 
PYAR_15784                                                            51.6       3e-07 
PYIR_20850                                                            52.0       4e-07 
PYU1_G007250                                                          51.2       4e-07 
PYAR_23252                                                            52.0       4e-07 
PHYSO_342361                                                          50.8       4e-07 
PHYCA_559281                                                          50.4       5e-07 
PHALS_02295                                                           52.4       5e-07 
HYAP_11925                                                            51.6       7e-07 
PYU1_G007254                                                          50.8       7e-07 
PHYKE_6067                                                            51.6       8e-07 
PHYSO_318693                                                          52.0       8e-07 
PYVX_21644                                                            50.8       1e-06 
PYIR_23622                                                            50.8       1e-06 
PYU1_G003057                                                          50.4       1e-06 
PYIR_22549                                                            50.8       1e-06 
PHYCA_122138                                                          50.1       1e-06 
PITG_11946                                                            50.1       2e-06 
SPRG_07825                                                            50.4       2e-06 
PHYRA_77292                                                           49.7       2e-06 
PYAR_22058                                                            49.7       2e-06 
PYIW_14247                                                            50.1       2e-06 
PYAR_24939                                                            48.9       3e-06 
PHYKE_9025                                                            50.1       3e-06 
PYAP_20077                                                            49.3       4e-06 
PYIW_15528                                                            49.7       4e-06 

>PYU1_G001738
Length=226

 Score = 445 bits (1145),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/226 (100%), Positives = 226/226 (100%), Gaps = 0/226 (0%)

Query  1    MAPWFHPTvalallsavavhaQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSD  60
            MAPWFHPTVALALLSAVAVHAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSD
Sbjct  1    MAPWFHPTVALALLSAVAVHAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSD  60

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCE  120
            FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCE
Sbjct  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCE  120

Query  121  VWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVS  180
            VWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVS
Sbjct  121  VWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVS  180

Query  181  LRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLELFWS  226
            LRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLELFWS
Sbjct  181  LRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLELFWS  226

>PYU1_G001739
Length=266

 Score = 250 bits (639),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 151/207 (73%), Gaps = 3/207 (1%)

Query  1    MAPWFHPTvalal--lsavavhaQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADV  58
            MAP F PT+A+     ++V V A   +++PEPF+LVDG +AQ  P+A LE QG+ TSADV
Sbjct  1    MAPSFLPTLAVTALGAASVVVDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADV  60

Query  59   SDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118
            + FMKQKGYANLRA++DD+KLY VN DAL ECGYTDPT ESQPIP T    STGY  +GP
Sbjct  61   AGFMKQKGYANLRALMDDEKLYEVNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGP  120

Query  119  CEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            CEVWLDD+KVMS  NCH K+PG  F LDYSSCKGSC LRWYWLG++ + + YSWQ+YK C
Sbjct  121  CEVWLDDVKVMSGDNCHDKFPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKEC  180

Query  179  VSLRGNGVQSSETPTPIAVASATPTTA  205
            VSL  N   S+   TP A  +  P  A
Sbjct  181  VSLSDNASGSASASTP-ATTTKVPVKA  206

>PYIW_18788
Length=244

 Score = 216 bits (551),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 1/185 (1%)

Query  24   KVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVN  83
            KV YPEPF+L+DGD   +A VA LE+Q + TSADV+ F+KQKGYA+LRAMLDD+ LY+VN
Sbjct  29   KVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88

Query  84   PDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF  143
             D++ ECGYTDPT ESQPIP       TGY+ +GPCE+W+DDLK++S  NC   +PGT+ 
Sbjct  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148

Query  144  MLDYSSCKGSCMLRWYWLGI-QPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATP  202
             LDYSSCKG C LRWY L + +    +YSW+VYK CV+L      ++E P   + A  T 
Sbjct  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTATTEAPEDTSEALTTV  208

Query  203  TTAEA  207
              A A
Sbjct  209  DNAAA  213

>PPTG_17123
Length=201

 Score = 193 bits (491),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 0/157 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL+P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GY +LRAMLDD+ LY V  
Sbjct  39   VLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE  98

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCEVWLDD KV S  NCHT++P     
Sbjct  99   EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHE  158

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  +C L WYWLGI+ +   YSWQVYK CV L
Sbjct  159  VDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGL  195

>PHYRA_81105
Length=201

 Score = 192 bits (489),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 114/157 (73%), Gaps = 0/157 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL+P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GYA+LR+MLDD+ LY V  
Sbjct  39   VLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTE  98

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            +A+ +CG T P  E+Q IP  ++F S+GY L+GPCEVWLDD K  +  NCHT++P     
Sbjct  99   EAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYS+C  +CMLRWYWLGI+ V   YSWQVYK C++L
Sbjct  159  IDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195

>PHYCA_537323
Length=200

 Score = 192 bits (488),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 111/157 (71%), Gaps = 0/157 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V +P PF++VDG + Q   +A+L+EQG+ TS +   +M+Q GY +LRAMLDD+ LY V  
Sbjct  38   VQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTE  97

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCEVWLDD KV +  NCHT++P     
Sbjct  98   EAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQHQ  157

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  SC L WYWLGI+ V   YSWQVYK CV L
Sbjct  158  VDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGL  194

>PITG_18452
Length=856

 Score = 202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 116/160 (73%), Gaps = 0/160 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL+P PF++VDG + Q   +A+L+EQGI TS +   +M+Q+GY++LRAMLDD+ LY V  
Sbjct  694  VLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVTE  753

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            +A+ ECG T P  E+QPIP  N+F ++GY L+GPCE+WLDD KV S  NCHT++P     
Sbjct  754  EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQHQ  813

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184
            +DYSSC GSC L WYWLGI+ V   YSWQVYK CV L  N
Sbjct  814  VDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLSKN  853

>PYAP_22273
Length=268

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 110/197 (56%), Gaps = 5/197 (3%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
              +V +PE  Y +   +    P A LE QG KT+ D + ++   GY  LR  +D    Y 
Sbjct  26   HQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYK  85

Query  82   VNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGT  141
             N  A  ECGYTDP    QPIP    F ++GY   GPCE+W+DD+ V S  NCH      
Sbjct  86   ANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEK  145

Query  142  NFM--LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL---RGNGVQSSETPTPIA  196
             F   +DYS+CKG CML+WYWLGI+P+ + YSWQ+YK C+ L    G G   ++ PTP  
Sbjct  146  AFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLADKNGGGNNKTKVPTPTN  205

Query  197  VASATPTTAEAPGKGKA  213
             A A PT A AP K  A
Sbjct  206  KAPAKPTKAPAPKKDDA  222

>PYIR_25089
Length=262

 Score = 177 bits (450),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 103/160 (64%), Gaps = 0/160 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P + V     Q  P+A LE QG KT+AD   + K KGY  LRA +DD+  Y V  
Sbjct  31   VILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKVAD  90

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  ECG+T      QPIP  +   STGY  +GPCEVWLD  +V+   NCH+++PGT F 
Sbjct  91   GADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGTTFK  150

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184
            +DYSSCKGSC+LRWYW+GI+ +   YSWQVYK CV + G+
Sbjct  151  IDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVTGS  190

>PHYCA_14369
Length=248

 Score = 176 bits (447),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 107/169 (63%), Gaps = 1/169 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE QG KT  D + +  + GY +LR  +D  K Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRAK-YTVTN  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPT  193
            +DYSSCKG+C LRWYWLG++ +   YSWQVYK C+ L G+G  S  TP+
Sbjct  150  VDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLAGSGGASGPTPS  198

>PPTG_10636
Length=246

 Score = 176 bits (446),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 119/210 (57%), Gaps = 20/210 (10%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE QG KT  D   +  +  Y +LR  +D+ K Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAK-YEVTS  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL----------RGNGVQSSE----  190
            +DYSSCKG+C LRWYWLGI+ +   YSWQVYK C+ L           G+G Q +E    
Sbjct  150  VDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGEATPTTSGSGTQGTERTMQ  209

Query  191  -TPTPIAVASATPTTAEAPGKGKAAKSDWG  219
             TP P + A A    AE P  G  A + WG
Sbjct  210  ATPAPESQAPA----AETPSWGGNAPTTWG  235

>PHYRA_84190
Length=206

 Score = 174 bits (442),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 4/187 (2%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE +G  T  D + +  + GY +LR  +D+ K Y+V  
Sbjct  14   VLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNAK-YSVTN  72

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  73   GADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYT  132

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETP---TPIAVASAT  201
            +DYSSCKG+C LRWYW+G++ + ETYSWQVYK C+ L G    S   P    P    S+T
Sbjct  133  VDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLTGGSGTSESAPATDAPSTEGSST  192

Query  202  PTTAEAP  208
             + A  P
Sbjct  193  GSPATDP  199

>PHYSO_353401
Length=146

 Score = 172 bits (435),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 101/138 (73%), Gaps = 0/138 (0%)

Query  44   VAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP  103
            +A+L+EQG+ TS +   +M++ GYA+LRAMLDD+ LY V  +AL +CG T P  E+QPIP
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIP  62

Query  104  VTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGI  163
              ++F ++GY L+GPCEVWLDD KV +  NCHT++P     +DYS+C  SC L WYWLGI
Sbjct  63   SNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLGI  122

Query  164  QPVNETYSWQVYKVCVSL  181
            + V   YSWQVYK CV+L
Sbjct  123  KYVEGAYSWQVYKNCVAL  140

>PYVX_18173
Length=500

 Score = 181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 115/162 (71%), Gaps = 0/162 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VLYP PF++VDG + + +PVA+LE+QG+ T+ +   ++ ++GYA LRA++DD  LY+V  
Sbjct  40   VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            + L +CG T P  E+QPIP   +FI++GY L+GPCE+W+D+   ++  NCHT++P  +  
Sbjct  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGV  186
            +DYS C  SC + W+WLGI+   E YSWQV+K C++L  + +
Sbjct  160  IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLSASAL  201

 Score = 159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P Y V+G + +  P+A LE Q   T+ D   ++   G+ +LRA +DD  LY+VN 
Sbjct  238  VILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNA  297

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP      STGY  +GPCEVWLDD +V+   NCH    G  + 
Sbjct  298  SADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD  356

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            LDYS+C GSC L WYWLG++ + + YSWQVYK CV +
Sbjct  357  LDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393

>HYAP_07096
Length=251

 Score = 174 bits (441),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 107/161 (66%), Gaps = 1/161 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VLYP P ++VD    Q   +A+L+EQGI TS +   + ++ GY +LRAMLDDQ LY+V+ 
Sbjct  88   VLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSK  147

Query  85   DALDECGYTD-PTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF  143
            DA+ +CG+T  P+   Q IP      S+GY L+GPCEVW DD +V S  NC T++P    
Sbjct  148  DAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207

Query  144  MLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184
             +DYSSC  SC LRWYWLGIQ ++  YSWQVYK C+ L  N
Sbjct  208  QVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLGRN  248

>PHYRA_85631
Length=228

 Score = 173 bits (438),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 112/191 (59%), Gaps = 11/191 (6%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE +G  T  D + +  + GY +LR  +D+ K YNV  
Sbjct  31   VLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAK-YNVAD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVAS-----  199
            +DYSSCKG+C LRWYWLGI+ +   YSWQVYK C+ L G    S   P   A ++     
Sbjct  150  VDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLTGGSGTSESAPATEAPSTEGSST  209

Query  200  -----ATPTTA  205
                  TPTTA
Sbjct  210  GSQAWGTPTTA  220

>PYU1_G001740
Length=206

 Score = 172 bits (436),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 105/157 (67%), Gaps = 2/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P + V   + + +P+A LE QG KT+AD + + K KGY +LRA +DD+K Y VN 
Sbjct  31   VILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNS  90

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
            +A  ECGYT+     QPIP    F +TGY  +GPCEVWLD+ KV+S  NCH  +PG    
Sbjct  91   NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            + Y++CKGSC LRWYW+GI+ +   +SWQVYK CV L
Sbjct  149  MSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PPTG_10635
Length=199

 Score = 171 bits (434),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 101/159 (64%), Gaps = 1/159 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE QG KT  D   +  + GY +LR  +D  K Y V  
Sbjct  14   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAK-YEVTS  72

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  73   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  132

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRG  183
            +DYSSCKGSC LRWYWLG++ +  +YSWQVYK C+ L G
Sbjct  133  VDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLTG  171

>PHYSO_341599
Length=185

 Score = 170 bits (430),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 104/165 (63%), Gaps = 1/165 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE QG KT  D + + K+ GY +LR  +D  K Y+V  
Sbjct  14   VLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRAK-YDVTS  72

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  N   STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  73   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  132

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSS  189
            +DYSSCKG+C LRWYWLG++ +   YSWQVYK C+ L    + S+
Sbjct  133  VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAST  177

>PYU1_G001742
Length=213

 Score = 170 bits (430),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 101/160 (63%), Gaps = 1/160 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P + V     Q  P+A LE QG KT+ D + + K KGY  LRA +DD K Y V  
Sbjct  31   VMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKVAA  90

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+T    + QPIP      STGY  +GPCEVWLD  +VM   NCH+++PGT F 
Sbjct  91   GADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTTFK  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184
            +DYSSCKGSC LRWYW+GI+ +   YSWQVYK CV + G 
Sbjct  150  IDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGGK  189

>PHALS_00498
Length=199

 Score = 168 bits (425),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 102/157 (65%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE Q  KT+ D   + KQ  +  LR  +D+ K Y V  
Sbjct  31   VLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAK-YTVVK  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVWL++ +V+S  NCH K+PG ++ 
Sbjct  90   GADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSCK +C+LRWYWLG++ + E YSWQVYK C+ L
Sbjct  150  IDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPL  186

>PHYSO_536424
Length=197

 Score = 167 bits (423),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 103/165 (62%), Gaps = 1/165 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE +G  T  D + + K+ GY +LR  +D  K Y+V  
Sbjct  26   VLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK-YDVTS  84

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  N   STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  85   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  144

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSS  189
            +DYSSCKG+C LRWYWLG++ +   YSWQVYK C+ L    + S+
Sbjct  145  VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAST  189

>PHYSO_507031
Length=197

 Score = 167 bits (423),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 103/165 (62%), Gaps = 1/165 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE +G  T  D + + K+ GY +LR  +D  K Y+V  
Sbjct  26   VLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK-YDVTS  84

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  N   STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  85   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  144

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSS  189
            +DYSSCKG+C LRWYWLG++ +   YSWQVYK C+ L    + S+
Sbjct  145  VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTSGSMAST  189

>PHYCA_102550
Length=268

 Score = 169 bits (428),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 100/161 (62%), Gaps = 1/161 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P +  D  + Q  P+A LE QG KT  D + +  + GY +LR  +D  K Y V  
Sbjct  31   VLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRAK-YTVRN  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CGYTDP    QPIP  NA  STGY  +GPCEVW+DD  VM   NCH K+PG  + 
Sbjct  90   GADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKGYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
            +DYS CKG C L WYWLG++ +  +YSWQVYK C+ L G+G
Sbjct  150  IDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLAGSG  190

>PYU1_G001744
Length=213

 Score = 167 bits (422),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 102/159 (64%), Gaps = 1/159 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P + V     Q  P+A LE QG KT+AD + + K KGY +LRA +DD+K Y V  
Sbjct  31   VMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKVAA  90

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+T    + QPIP      STGY  +GPCEVWLD+  VM   NCH+++PGT   
Sbjct  91   GADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTTHK  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRG  183
            + Y+SCKGSC LRWYW+GI+ +   YSWQVYK CV + G
Sbjct  150  ISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIGG  188

>PHYKE_7718
Length=220

 Score = 167 bits (422),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 109/179 (61%), Gaps = 1/179 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE +G     D + +  + GY +LR  +D+ K Y+V  
Sbjct  35   VLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK-YSVTS  93

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  NA  STGY  +GPCEVW+DD   M + NCH  +PG ++ 
Sbjct  94   GADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKDYT  153

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPT  203
            +DYS+CKG+C LRWYWLG++ +  +YSWQVYK C+ L G+G  +      +A  SA  T
Sbjct  154  IDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLTGSGGGAPVASGSLATNSAPST  212

>PYU1_G001741
Length=199

 Score = 166 bits (419),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 97/155 (63%), Gaps = 1/155 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P + V     Q  P+A LE QG +T+AD + + K KGY  LRA +DD+K Y V  
Sbjct  30   VMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTVAS  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  ECG+T      Q IP      STGY  +GPCEVWLD  +VM   NCHT++ GT   
Sbjct  90   GADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTTHT  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCV  179
            +DYSSCKGSC LRWYW+GI+ +   YSWQVYK CV
Sbjct  149  IDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCV  183

>PPTG_10634
Length=208

 Score = 164 bits (415),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 101/157 (64%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE +G  T  D + + K+ GY +LR  LD+ K Y V  
Sbjct  31   VLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPVTD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  90   GADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSCKG+C L WYWLG++ +   YSWQVYK C+ L
Sbjct  150  VDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYIW_18791
Length=194

 Score = 163 bits (413),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 110/170 (65%), Gaps = 2/170 (1%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
               V  P+P + V       AP++ LE+ G+KTS  V  FMK KGY+ LRA++DD KLY 
Sbjct  22   HQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYK  81

Query  82   VNPDALD-ECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140
             N +A +  CGYTDP+  SQ IP  +   +TGY   GPCEVW+DD +V++  NCH +   
Sbjct  82   TNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN  141

Query  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSE  190
            T   +DYS+CKG C +RWYWLG++ + + +SWQVYK C++L G+G   S+
Sbjct  142  TT-KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALTGDGAAISK  190

>PHYCA_102624
Length=195

 Score = 163 bits (413),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P+P +  D  + Q  P+  LE  G KT AD + + K+ GY +LR  +D+ K Y V+ 
Sbjct  31   VLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPVSE  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+TDP    QPIP  NA  STGY  +GPCEVW+DD  VM   NCH K+PG ++ 
Sbjct  90   GADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYS CKG C L WYWLG++ +   YSWQVYK C+ L
Sbjct  150  IDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPL  186

>PPTG_10643
Length=250

 Score = 164 bits (416),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 103/168 (61%), Gaps = 1/168 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE QG K   D + + K+ GY +LR  +D  K Y V P
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRAK-YEVTP  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+P    QPIP      STGY  +GPCEV+LDD  V+   NCH K+PG +  
Sbjct  90   GADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKDCP  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETP  192
            +DYSSCKG+C LRWYWLGI+ +   YSWQVYK C+ L G+G  S   P
Sbjct  150  IDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPLVGSGGVSQTAP  197

>PYAR_24096
Length=227

 Score = 162 bits (411),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 2/162 (1%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
              +V  P+  Y V        P A LE+QG KT+AD + ++K   Y  LR  +D    Y 
Sbjct  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86

Query  82   VNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGT  141
             N  A  ECG+TDP   +QPIP   AF ++GY   GPCE+W+DD++V    NCH     T
Sbjct  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146

Query  142  NFM--LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
             F   +DYS+CKG+CML+WYWLGI+P  ++YSWQ+YK C+ L
Sbjct  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

>PHYKE_3446
Length=199

 Score = 160 bits (405),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 99/157 (63%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  E +  P+A LE QG  T  D + + +  GY  LRA +D  K Y V  
Sbjct  31   VLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAK-YQVTE  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP   +QPIP   A  STGY  +GPCEVW+D+ +V+   NCH    G ++ 
Sbjct  90   GADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYS+C+G+CMLRWYWLG++ +  +YSWQVYK C+ L
Sbjct  150  IDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPL  186

>PHYCA_129425
Length=204

 Score = 160 bits (404),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 95/157 (61%), Gaps = 2/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D  + + AP+A LE QG KT  D + + +  GY  LRA +D  K Y V  
Sbjct  31   VLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTVTD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     QPIP      STGY  +GPCEVWLD  +V+   NCH  +PG  + 
Sbjct  90   GADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            LDYSSCKGSCMLRWYWLG + +   +SWQVYK C+ L
Sbjct  149  LDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPL  185

>PHYCA_102852
Length=195

 Score = 159 bits (402),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE +G  T  D + +  + GY +LR  +D  K Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRAK-YPVTE  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+TDP    QPIP  NA  STGY  +GPCEVWLDD  V+   NCH K+PG  + 
Sbjct  90   GADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKGYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSCKG+C L W+WLG++ +   YSWQVYK C+ L
Sbjct  150  IDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PYIR_26626
Length=212

 Score = 158 bits (400),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 104/167 (62%), Gaps = 3/167 (2%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
               V+ P P +          P+A LE QG KT+AD + ++K KGY  LRA +DD+K Y 
Sbjct  28   HQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87

Query  82   VNPDALD-ECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG  140
            V+    + ECGYT+   + QPIP      STGY  +GPCEVWLD+ KVMS  NC+  +PG
Sbjct  88   VDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146

Query  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187
                + Y+SCKGSC LRWYW+G++ +   +SWQVYK CV + G+G +
Sbjct  147  KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI-GSGRR  192

>PHYKE_8389
Length=204

 Score = 157 bits (398),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 97/163 (60%), Gaps = 1/163 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D  + + AP+A LE QG +T  D + + +  GY  LRA +D  K Y V  
Sbjct  30   VLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTD  88

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     Q IP  NA  STGY  +GPCEVWLD  +V++  NCH    G ++ 
Sbjct  89   GADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187
            +DYSSC G+C LRWYWLG++ +   YSWQVYK CV L  +  +
Sbjct  149  IDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSASARR  191

>PPTG_15264
Length=194

 Score = 157 bits (396),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 99/159 (62%), Gaps = 3/159 (2%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE QG +T  D + + +  GY  LR  +D  K Y V  
Sbjct  28   VLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK-YTVTE  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP   A  STGY  +GPCEVWLDD++V+   NCH   PG ++ 
Sbjct  87   GADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYT  146

Query  145  LDYSSC--KGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  KG C+LRWYWLG++ +  +YSWQVYK C+ L
Sbjct  147  IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PPTG_17366
Length=194

 Score = 157 bits (396),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 99/159 (62%), Gaps = 3/159 (2%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE QG +T  D + + +  GY  LR  +D  K Y V  
Sbjct  28   VLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRAK-YTVTE  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP   A  STGY  +GPCEVWLDD++V+   NCH   PG ++ 
Sbjct  87   GADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYT  146

Query  145  LDYSSC--KGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  KG C+LRWYWLG++ +  +YSWQVYK C+ L
Sbjct  147  IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PHYKE_8388
Length=205

 Score = 154 bits (390),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 95/161 (59%), Gaps = 1/161 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D    + AP+A LE+QG  T  D + +    GYA+LRA  DD   Y V+ 
Sbjct  31   VLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTVSD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TD    +QPIP  NA  STGY  +GPCEVWLDD  VM   NCH    G ++ 
Sbjct  90   GADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
            +DYSSC  +C L W+W+G++ +   YSWQVYK CV L  + 
Sbjct  150  IDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSASA  190

>PHYRA_82864
Length=193

 Score = 153 bits (387),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  D  + +  P+A LE QG  T  D + + +  GY  LR  +D  K Y V  
Sbjct  31   VLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRAK-YTVTE  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  N   STGY  +GPCEVWLD+ +V+   NCH ++P  ++ 
Sbjct  90   GADYFCGWTDPNGTPQPIPAGN-MRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKDYP  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSCKG+C L WYW+G++ +  +YSWQVYK C+SL
Sbjct  149  IDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISL  185

>PHYSO_284086
Length=204

 Score = 153 bits (386),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 94/157 (60%), Gaps = 2/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D    + AP+A LE QG +T  D + + + KGY  LRA +D    Y V  
Sbjct  31   VLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTVAD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TD    +QPIP      STGY  +GPCEVWLD  +V+   NCH  + G  + 
Sbjct  90   GADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            LDYSSCKGSC LRWYWLG++ +   YSWQVYK CV L
Sbjct  149  LDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPL  185

>PHYRA_81106
Length=202

 Score = 152 bits (385),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 96/163 (59%), Gaps = 1/163 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D  + + AP+A LE QG +T  D + + +  GY  LRA +D  K Y V  
Sbjct  31   VLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTVAD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     Q IP  NA  STGY  +GPCEVWLD  +V++  NCH    G ++ 
Sbjct  90   GADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT  149

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187
            +DYSSC G+C L WYW+G++ +   YSWQVYK CV L  +  +
Sbjct  150  IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSASARR  192

>PHYRA_81107
Length=202

 Score = 151 bits (382),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 96/161 (60%), Gaps = 1/161 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D    + AP+A LE+QG  T  D + + ++ GY +LRA  DD   Y V+ 
Sbjct  28   VLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTVSD  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TD   + Q IP  NA  STGY  +GPCEVWLDD  VM   NCH    G ++ 
Sbjct  87   GADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKDYT  146

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
            +DYSSC  +C L W+W+G++ +N  YSWQVYK CV L  + 
Sbjct  147  IDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSASA  187

>PPTG_10048
Length=190

 Score = 149 bits (377),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 93/160 (58%), Gaps = 1/160 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL+P P ++ D  + Q  P+A LE QG KT  D   +  Q GY  LR  ++  K Y V  
Sbjct  28   VLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAK-YTVTE  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+P    QPIP      STGY   GPCE+W+ D +V    NCH   PG  + 
Sbjct  87   GADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKEYP  146

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN  184
            +DYS CKG+C+L WYWLG++ +  +YSWQVYK C+ L  N
Sbjct  147  IDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLTTN  186

>PHYSO_477820
Length=202

 Score = 149 bits (375),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 92/157 (59%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D    + AP+A LE+QG  T  D + +    GY +LRA  +D   Y V  
Sbjct  28   VLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRA-FNDGASYTVAD  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+   E QPIP  NA  STGY  +GPCEVWLDD  VM   NCH    G ++ 
Sbjct  87   GADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGKDYT  146

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  +C L W+WLG++ +   YSWQ+YK CV L
Sbjct  147  IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

>PHALS_03284
Length=188

 Score = 147 bits (372),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 101/170 (59%), Gaps = 5/170 (3%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            +L PEP +  +  + +  P+A LE Q   TSAD   ++K+  Y +LR  L  +  Y V  
Sbjct  17   ILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLK-RANYTVTE  75

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A  +CG+TDP    QPIP  N    TGY  +G CE+WLDD KV+S  NCH  +PG +  
Sbjct  76   GADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKDCP  135

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTP  194
            +DYSSCK +C++ WYWL ++ +   YSWQVYK C+ L     +S +T TP
Sbjct  136  VDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPL----TRSGKTGTP  181

>PHYCA_511409
Length=204

 Score = 147 bits (372),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 98/174 (56%), Gaps = 1/174 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D    + AP+A LE+QG  T  D + + +  GY +LRA  +D   Y V+ 
Sbjct  30   VLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTVSD  88

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+   + Q IP  NA  STGY  +GPCEVWLDD  VM   NCH    G ++ 
Sbjct  89   GADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKDYT  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVA  198
            +DYSSC  +C L W+WLG++ +   YSWQ+YK CV L  +  +        A+A
Sbjct  149  IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSASARRLEGAANESAIA  202

>PPTG_17122
Length=204

 Score = 147 bits (371),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 93/163 (57%), Gaps = 2/163 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D  + + AP+A LE QG +T  D + + +  GY  LR  +D  K Y V  
Sbjct  31   VLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDRAK-YTVTD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     QPIP      STGY  +GPCEVWLD  +V+   NCH    G  + 
Sbjct  90   GADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN  148

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187
            LDYSSC G+C LRWYWLG++ +   YSWQ+YK C+ L  +  +
Sbjct  149  LDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLSASARR  191

>PPTG_17121
Length=202

 Score = 146 bits (368),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 93/157 (59%), Gaps = 1/157 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL   P Y  D  + + AP+A LE+QG  T  D + + K  GY +LRA  +D   Y V+ 
Sbjct  28   VLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRA-FNDGASYTVSD  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+   + QPIP  NA  STGY  +GPCEVWLDD  VM   NCH    G  + 
Sbjct  87   GADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKYYT  146

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYSSC  +C L W+WLG++ +   YSWQ+YK CV L
Sbjct  147  IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPL  183

>PYAP_22279
Length=223

 Score = 146 bits (369),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 102/172 (59%), Gaps = 6/172 (3%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
              ++  P P    D + A + P+A LE QG+K + D++ +++QKG   LR  +D++  Y 
Sbjct  22   HQRITIPAPTLTTDRNTA-TNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  82   VNP-DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDM--NCHTKY  138
            V    A  ECGYTDP    QPIP      STGY  +GPCEVWLD+ +V+     +CH   
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  139  PG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQS  188
                 ++ +D+S CKG+CMLRWYWL  + +   +SWQVYK CV L+G+  +S
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPLKGSAARS  192

>PYIR_26546
Length=239

 Score = 143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 102/172 (59%), Gaps = 3/172 (2%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQ-GIKTSADVSDFMKQKGYANLRAMLDDQKLYNVN  83
            V+ P+P + ++G   Q  P+A+LE Q G   + D + ++  KG+  +R  +D+ KLY   
Sbjct  31   VVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYRPV  90

Query  84   PDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYP-GTN  142
             DA  +CGYT    E QPIP  +   +TGY   GPCE+WLDD+KV    NCH     G N
Sbjct  91   SDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVASGMN  150

Query  143  FM-LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPT  193
            F  LD+SSC G C + WYW+GI+   ++ SWQ+YK C+ L G+G  +S   T
Sbjct  151  FQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPLIGHGGTASTPKT  202

>PITG_18450
Length=203

 Score = 140 bits (353),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 92/163 (56%), Gaps = 5/163 (3%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P P Y  D  + + AP+  LE QG +T  D + + +  GY  LR  ++    Y V  
Sbjct  31   VLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTVAD  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     QP P   A  STGY  +GPCEVWLD  +V+   NCH    G  + 
Sbjct  87   GADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN  145

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ  187
            LDYSSCKG+C LRWYWLG++ +   YSWQ+YK C+ L  +  +
Sbjct  146  LDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLSASARR  188

>PYAP_22278
Length=289

 Score = 141 bits (356),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 98/171 (57%), Gaps = 6/171 (4%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
              +V  P P +  +       P+A LE QG+K   D++ F++ KG   LR  +D++  Y 
Sbjct  25   HQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYK  84

Query  82   VNPDALD-ECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDM--NCHTKY  138
            +       ECGYT+P    QPIP      STGY  +GPCEVWLD+ +V+     NCH   
Sbjct  85   IEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDV  144

Query  139  --PGTNFMLDYSSCKGSCMLRWYWLGIQPV-NETYSWQVYKVCVSLRGNGV  186
                 ++ +D+S CKG+CMLRWYWLG + +  + +SWQ+YK CV L+G+G 
Sbjct  145  GNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPLKGSGT  195

>PYVX_18174
Length=204

 Score = 134 bits (336),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 92/158 (58%), Gaps = 4/158 (3%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ PEP +     +   AP+A LE+QG +T  D + + +  GY  LRA +D Q  Y V  
Sbjct  31   VILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMD-QASYTVTD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+     QPIP    F STGY  +GPCE+WLD  +V ++ NCH    G +  
Sbjct  90   GADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKDTA  147

Query  145  LDYS-SCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +DYS    G+C L WYW+G++ +N  YSWQVYK CV L
Sbjct  148  IDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPL  185

>PYVX_18176
Length=201

 Score = 132 bits (331),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 92/173 (53%), Gaps = 2/173 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V+ P P +  D  +   AP+A LE+QG  T  D + +    GY +LRA +D    Y V  
Sbjct  28   VILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTVTD  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+T+    +Q +P      STGY   GPCEVWLDD  V+   NCH    G  + 
Sbjct  87   GADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKTYD  145

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAV  197
            LDYSSC  +C L W+W+G++ +N  YSWQVYK CV L  +  +        AV
Sbjct  146  LDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSASARRLEGAANASAV  198

>PPTG_08820
Length=250

 Score = 131 bits (329),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 93/162 (57%), Gaps = 5/162 (3%)

Query  25   VLYPEPFYL--VDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLY-N  81
            +L PEP +   ++  + +  P+A LE QG    AD + +  Q GY NLR  +D  K   +
Sbjct  31   ILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYTTS  90

Query  82   VNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGT  141
            V P A   CG T+     +PIP      STGY  +GPC V+LDD  V+   NCH K PG 
Sbjct  91   VTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLPGK  150

Query  142  NFMLDYSSC--KGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            ++ +DYSSC  KG C L W+WLGI+ V   +SWQVYK CV L
Sbjct  151  SYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

>PHYSO_499978
Length=174

 Score = 128 bits (321),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 1/136 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE QG  T  D  ++  + GY  LR  +D  K Y V  
Sbjct  31   VLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-YTVTK  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  +A  STGY  +GPCEVW+D+ +V+   NCH K     + 
Sbjct  90   GADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT  149

Query  145  LDYSSCKGSCMLRWYW  160
            +DYS+CKG+C LRWYW
Sbjct  150  IDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 128 bits (321),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 80/136 (59%), Gaps = 1/136 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  E +  P+A LE QG  T  D  ++  + GY  LR  +D  K Y V  
Sbjct  31   VLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHGK-YTVTK  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  +A  STGY  +GPCEVW+D+ +V+   NCH K     + 
Sbjct  90   GADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT  149

Query  145  LDYSSCKGSCMLRWYW  160
            +DYS+CKG+C LRWYW
Sbjct  150  IDYSACKGTCTLRWYW  165

>PPTG_14254
Length=188

 Score = 126 bits (316),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 81/139 (58%), Gaps = 1/139 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P++ LE++G KT  + + F    GY +LR  +D  K Y V   A   CG+TDP    Q I
Sbjct  49   PLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMDRAK-YKVTEGADQACGWTDPKGIPQKI  107

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P      +TGY  +GPCE+++ +   +S +NCH   P   F LDYS C  SC+L WYWLG
Sbjct  108  PEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLG  167

Query  163  IQPVNETYSWQVYKVCVSL  181
            ++ +   YSWQVYK C+ +
Sbjct  168  VRKLKGKYSWQVYKECIPI  186

>PHYCA_510817
Length=188

 Score = 126 bits (316),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 1/139 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P++ LE++G KT  + + +    GY +LR  ++  K Y V+  A   CG++DP    Q I
Sbjct  49   PLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMEKAK-YKVSDGADQACGWSDPKGIPQQI  107

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P      ++GY  +GPCE+W+ D   +S +NCH   P   F LDYS C  SC+L WYWLG
Sbjct  108  PSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLG  167

Query  163  IQPVNETYSWQVYKVCVSL  181
            ++ +   YSWQVYK C+ L
Sbjct  168  VRKLKGKYSWQVYKECIPL  186

>PITG_10499
Length=323

 Score = 127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 91/159 (57%), Gaps = 5/159 (3%)

Query  28   PEPFYL--VDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQK-LYNVNP  84
            PEP +   ++  + +  P+A LE QG     D + +  + GY +LR  +D  K + +V P
Sbjct  4    PEPIWKPGINDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTP  63

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG T+     +PIP   A  STGY  +GPC ++LDD  VM   NCH   PG  + 
Sbjct  64   GADQTCGLTELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYK  123

Query  145  LDYSSC--KGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            +D+SSC  KG C L W+WLGI+ V   +SWQVYK C+SL
Sbjct  124  IDFSSCQKKGGCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYKE_9185
Length=281

 Score = 125 bits (314),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 94/165 (57%), Gaps = 7/165 (4%)

Query  23   HKVLY-PEPFYLVDGDEAQSA-----PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDD  76
            H+V+Y P P +      ++       P++ LE++GIKT  + + +     YA+LR  +D 
Sbjct  25   HQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMDK  84

Query  77   QKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHT  136
             K Y V+  A   CG+TDP    Q IP      ++GY  +GPCE+++ D   +S +NCH 
Sbjct  85   AK-YKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  143

Query  137  KYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
                  F LDYS+C  SC+L WYWLG++ +  +YSWQ+YK C+ L
Sbjct  144  SITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PPTG_14255
Length=268

 Score = 122 bits (307),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 86/144 (60%), Gaps = 2/144 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P++ LE++G  T  + + +    GY +LR  +D+ K Y+V   A   CG+TDP    Q I
Sbjct  48   PLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDNAK-YSVTDGADQACGWTDPKGVPQQI  106

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P      ++GY  +GPCE+++ D   +S +NCH       F LDYS+C  SC+L WYWLG
Sbjct  107  PEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLG  166

Query  163  IQPVNETYSWQVYKVCVSL-RGNG  185
            ++ + + YSWQVYK C+ L  G+G
Sbjct  167  VRYLKKKYSWQVYKECIPLYSGSG  190

>PHYSO_343376
Length=172

 Score = 119 bits (297),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 72/123 (59%), Gaps = 1/123 (1%)

Query  38   EAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTV  97
            E +  P+A LE QG  T  D   +  + GY  LR  +D  K Y V   A   CG+TDP  
Sbjct  42   ETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGK-YTVTKGADFSCGWTDPKG  100

Query  98   ESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLR  157
              QPIP  +A  STGY  +GPCEVW+D+ +V+   NCH K     + +DYS+CKG+C LR
Sbjct  101  TPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLR  160

Query  158  WYW  160
            WYW
Sbjct  161  WYW  163

>PHYSO_417649
Length=185

 Score = 119 bits (298),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 89/165 (54%), Gaps = 7/165 (4%)

Query  23   HKVLY-PEPFYLVDGDEAQSA-----PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDD  76
            H+V+Y P P +      A        P++ LE++G KT  + + +    GY +LR  ++ 
Sbjct  21   HQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMER  80

Query  77   QKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHT  136
             K Y +   A   CG+TDP    Q IP      ++GY  +GPCE+++ D   +S +NCH 
Sbjct  81   AK-YKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  139

Query  137  KYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
                  F LDYS C  SC+L WYWLG++ +   +SWQVYK C+ L
Sbjct  140  SITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PITG_13520
Length=171

 Score = 118 bits (295),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 1/127 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +     + +  P+A LE QG KT  D   +  + GY +LR  +D  K Y+V  
Sbjct  31   VLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRAK-YDVTS  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP   A  STGY  +GPCEVWLDD  V+   NCH K+PG ++ 
Sbjct  90   GADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYT  149

Query  145  LDYSSCK  151
            +DYSSCK
Sbjct  150  VDYSSCK  156

>PHYCA_536934
Length=983

 Score = 124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 1/139 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P++ LE++G  T  + + +    GY NLR  +D+ K Y V   A   CG++DP    Q I
Sbjct  65   PLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQI  123

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P      ++GY  +GPCE+W+ D   +S +NCH       F LDYS C  SC+L WYWLG
Sbjct  124  PEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLG  183

Query  163  IQPVNETYSWQVYKVCVSL  181
            ++ + + YSWQVYK C+ L
Sbjct  184  VRYLKKKYSWQVYKECIPL  202

>PHYSO_262732
Length=188

 Score = 114 bits (285),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 92/179 (51%), Gaps = 22/179 (12%)

Query  23   HKVLY-PEPFYLVDGDEAQSA-----PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDD  76
            H+V+Y P P +      A        P+A LE QG +T              +LR  +D+
Sbjct  22   HQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQT--------------HLRDFMDN  67

Query  77   QKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHT  136
             K Y V   A   CG+TDP   +Q IP      ++GY  +GPCE+++ D   +S +NCH 
Sbjct  68   AK-YTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  126

Query  137  KYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL-RGNGVQSSETPTP  194
                  F LDYS C  SC L WYWLG++ +N  YSWQVYK C+ +  G+G  ++ T  P
Sbjct  127  SITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPIYSGSGGGATMTTNP  185

>PHYSO_254168
Length=170

 Score = 109 bits (273),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 82/150 (55%), Gaps = 18/150 (12%)

Query  34   VDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYT  93
            V+  + +  P+A LE QG  T        +  GY  LR  +D  K Y V   A   CG+T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGK-YTVTQGADYFCGWT  86

Query  94   DPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSC--K  151
            +P    QPIP      STGY  +GPCE+WLDD++V+       + P     +DYSSC  K
Sbjct  87   NPKGTPQPIPR-----STGYTHDGPCEIWLDDVRVLE------RSP----TIDYSSCEKK  131

Query  152  GSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            G C + WYWLG++ +  +YSWQVYK C+ L
Sbjct  132  GGCTMHWYWLGVRFLKNSYSWQVYKECIPL  161

>PHYSO_342364
Length=194

 Score = 107 bits (267),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 15/125 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            Y +LR +LD+  +Y  N      CGYT+P    QPIP    A  S G +  GPCE+WLDD
Sbjct  75   YKDLRTLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK--GSCMLRWYWLGIQPVNETYSWQVYKV  177
             KVM+  +C++KY  +N      F +DYS CK  G CM+R+YWLG Q + +   WQ YK 
Sbjct  129  KKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKN  188

Query  178  CVSLR  182
            C+ L+
Sbjct  189  CIPLK  193

>PHYKE_8390
Length=130

 Score = 100 bits (250),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 0/95 (0%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL P PF++VDG + Q   +A+L+EQG+ TS +   +M   GY +LRAMLDD+ LY V  
Sbjct  33   VLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE  92

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPC  119
            +AL +CG T P  E+Q IP  + F ++GY ++GPC
Sbjct  93   EALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PYU1_G007476
Length=195

 Score = 102 bits (254),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 75/135 (56%), Gaps = 17/135 (13%)

Query  57   DVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP----VTNAFISTG  112
            D +   KQKGY  LR+ L+++            CGYT+P    + IP    V  A  + G
Sbjct  65   DFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVG  115

Query  113  YVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETY  170
            +V  GPCE+WLD+  ++   NC   +PG   ++  D+SSCKG+CMLR YWLG Q  ++  
Sbjct  116  FVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQ--DQGQ  173

Query  171  SWQVYKVCVSLRGNG  185
             WQ YK CV ++  G
Sbjct  174  RWQTYKYCVPVKKGG  188

>PYIR_16435
Length=304

 Score = 103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 73/129 (57%), Gaps = 14/129 (11%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTGYV  114
            A+ +   K+KGY+ LR+ ++D+            CG T+P    + IP  N    S   V
Sbjct  65   ANFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIV  115

Query  115  LNGPCEVWLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETYSW  172
              GPCE+WLDD +VM D NC   +      + +D+SSCKGSCMLRW+WLG+Q   E   W
Sbjct  116  HPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGE--RW  173

Query  173  QVYKVCVSL  181
            QVYK CV L
Sbjct  174  QVYKNCVPL  182

>PHYSO_341596
Length=231

 Score = 102 bits (253),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 1/101 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P+A LE QG +T  D + +  + GY +LR  +D  K Y V   A   CG+TDP    QPI
Sbjct  41   PLAFLENQGFETQEDFASWRDKNGYKSLRDFMDKAK-YTVTSGADFSCGFTDPKGTPQPI  99

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF  143
            P  +A  STGY  +GPCEVWLDD KV+   NCH K+PG ++
Sbjct  100  PAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPGKDY  140

>PHYSO_527908
Length=174

 Score = 100 bits (248),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 70/124 (56%), Gaps = 1/124 (1%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P+A LE QG  T A+ + FM   GY +LR  +D+   Y+V   A   CG+TDP    Q I
Sbjct  48   PLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQI  106

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P      ++G+  + PCE+++ D   +S  NCH       F LDYS+C  SC+L WYWLG
Sbjct  107  PEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLG  166

Query  163  IQPV  166
            ++ +
Sbjct  167  VRFI  170

>PHYCA_534473
Length=1050

 Score = 106 bits (264),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 77/133 (58%), Gaps = 16/133 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
              +  GY+++R +LD D  LY  N      CG+TDP V ++  P T +A  S G V  GP
Sbjct  844  LKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVHAGP  897

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCKGS-CMLRWYWLGIQPVNETY  170
            CE+WLDD KV+S+ +C T Y  GT         +DYSSC  S CMLR+YWL  Q V+   
Sbjct  898  CEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKI  957

Query  171  SWQVYKVCVSLRG  183
             WQVYK CV L G
Sbjct  958  VWQVYKDCVPLTG  970

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
              K     ++R M+D D KLY       ++CG TDP  + +  P T +A  S G V  GP
Sbjct  539  LKKSNNVKDIRTMIDADPKLYG------EDCGNTDPKAKPKDPPSTGDATFSRGIVHAGP  592

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSCK-GSCMLRWYWLGIQPVNETY  170
            CE+WLDD  V+ + +C + Y  GT   +      DYSSC  G CM R+YWL +Q  +   
Sbjct  593  CEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKT  652

Query  171  SWQVYKVCVSL  181
             WQVYK C+ L
Sbjct  653  LWQVYKNCIPL  663

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 79/163 (48%), Gaps = 29/163 (18%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPCEVWLDDL  126
            ++R +LD D KLY        +CGYT+P V  +  P    A  S G V  GPCE+WLDD 
Sbjct  284  DIRTLLDSDTKLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDK  337

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+S+ +C + Y  GT   +      DYSSC  G CM R+YWL +Q ++   + Q     
Sbjct  338  MVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGGGASQTTPST  397

Query  179  VSLRGNGVQSSE-------------TPTPIAVASATPTTAEAP  208
             S   +G ++S+             TP P + A  TP    AP
Sbjct  398  GSGESDGSKTSQSAPTSGSSESTQSTPAPESPAVDTPEVTPAP  440

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 19/116 (16%)

Query  60   DFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI-PVTN--AFISTGYVLN  116
            +   +  Y ++R ++D   +Y       ++CG+TDP  +  P+ P T+  A  S G V  
Sbjct  69   ELAAKNNYKDVRTLMDGNPVYG------EDCGFTDP--KGTPVDPPTDGTATFSRGIVHA  120

Query  117  GPCEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQ  164
            GPCE+WLDD  V+ + +C   Y  GT   +      DYSSC  G CMLR+YWL +Q
Sbjct  121  GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQ  176

>PPTG_04622
Length=273

 Score = 102 bits (253),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 75/131 (57%), Gaps = 16/131 (12%)

Query  63   KQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
            +  GY+++RA+LD D  LY  N      CG+TDP    +  P T +A  S G V  GPCE
Sbjct  74   ESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRGMVHAGPCE  127

Query  121  VWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCK-GSCMLRWYWLGIQPVNETYSW  172
            +WLDD  V+S+ +C T Y  GT         +DYSSC  G CMLR+YWL  Q V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMVW  187

Query  173  QVYKVCVSLRG  183
            QVYK CV L G
Sbjct  188  QVYKDCVPLTG  198

>PYAP_18711
Length=210

 Score = 99.8 bits (247),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 15/133 (11%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFIST  111
             +T A      K++G  NLRA L+ +           ECG T+P  + +PIP ++  I  
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLESKG---------PECGRTNPNAKRKPIP-SDGLIKF  104

Query  112  GYVLN--GPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNE  168
            G  +   GPCEVW D+  V S+++C  ++   T F +DYS CKG+CMLR+YWLG+Q   +
Sbjct  105  GSSMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGK  164

Query  169  TYSWQVYKVCVSL  181
               WQ YK CV +
Sbjct  165  --RWQSYKNCVPI  175

>PHYRA_73584
Length=287

 Score = 101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 76/135 (56%), Gaps = 16/135 (12%)

Query  59   SDFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLN  116
            S   K  GY+++R +LD D  LY  N      CG+T+P   ++  P T +A  S G V  
Sbjct  67   SSLKKSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRGMVHA  120

Query  117  GPCEVWLDDLKVMSDMNCHTKY------PGTNFM-LDYSSCKGS-CMLRWYWLGIQPVNE  168
            GPCE+WLDD  V+S+ +C T Y        + F  +DYSSC  S CMLR+YWL  Q V+ 
Sbjct  121  GPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  180

Query  169  TYSWQVYKVCVSLRG  183
               WQVYK CV L G
Sbjct  181  KTVWQVYKDCVPLTG  195

>PHYRA_73607
Length=343

 Score = 101 bits (251),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 76/135 (56%), Gaps = 16/135 (12%)

Query  59   SDFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLN  116
            S      GY+++R +LD D  LY  +      CG+T+P   ++  P T +A  S G V  
Sbjct  70   SSLKSSNGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVHV  123

Query  117  GPCEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCKGS-CMLRWYWLGIQPVNE  168
            GPCE+WLDD KV+S+ NC   Y  GT         +DYSSC  S CMLR+YWL  Q V+ 
Sbjct  124  GPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDS  183

Query  169  TYSWQVYKVCVSLRG  183
            +  WQVYK CV L G
Sbjct  184  SMVWQVYKNCVPLTG  198

>PHYSO_340369
Length=200

 Score = 98.2 bits (243),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 72/142 (51%), Gaps = 15/142 (11%)

Query  43   PVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI  102
            P+A+ E+QG  TS++ + +    G+  LR  +D+      +P               Q I
Sbjct  51   PLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGNYSVTSP---------------QQI  95

Query  103  PVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLG  162
            P  N   + GY  +GPCE+WLD+    S ++C    P   + LDYS C  SC++ WY LG
Sbjct  96   PDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLG  155

Query  163  IQPVNETYSWQVYKVCVSLRGN  184
            +   +  YSW+VYK C+ L  N
Sbjct  156  VAKPDRVYSWEVYKECIPLYMN  177

>PHYCA_14368
Length=219

 Score = 98.2 bits (243),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 78/169 (46%), Gaps = 47/169 (28%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +  + +  P+A LE QG KT  D + +  +  Y +LR  +D+ K Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAK-YTVTD  89

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP                                              ++ 
Sbjct  90   GADFSCGFTDPK---------------------------------------------DYT  104

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGN-GVQSSETP  192
            +DYSSCKG+C LRWYWLGI+ +   YSWQVYK C+ L G+ G ++  TP
Sbjct  105  VDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLSGSGGTEAGTTP  153

>PYIW_27477
Length=180

 Score = 96.7 bits (239),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 14/126 (11%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IST  111
            K  A+ +   K+KG+  LR+ ++D+           +CG TDP  +++ IP  N    S 
Sbjct  36   KDPANFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSR  86

Query  112  GYVLNGPCEVWLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNET  169
              V  GPCE+W+DD +VM D NC   +      + +D+S+CKG CMLRW+WLG+Q  +  
Sbjct  87   AIVHPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQ--DSG  144

Query  170  YSWQVY  175
              WQVY
Sbjct  145  KRWQVY  150

>PYAP_18131
Length=226

 Score = 97.8 bits (242),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 69/118 (58%), Gaps = 7/118 (6%)

Query  74   LDDQKLYNVNP-DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDM  132
            +DD+  Y V    A  ECG TDP    QPIP      STG+  +G   VW+D+ +V+   
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  133  --NCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGV  186
              NCH        ++ +D+S CKG CM+RWYWLG++ + + +SWQVYK C+ +R +G 
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPIRASGT  116

>PYAR_14256
Length=199

 Score = 97.1 bits (240),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 84/171 (49%), Gaps = 15/171 (9%)

Query  22   QHKVLYPEPFYLVDGDEAQSAPVAHLE---EQGIKTSADVSDFMKQKGYANLRAMLDDQK  78
            Q  V   +P        ++S+ VA      +   +T A  +     KG+ NLRA L+D+ 
Sbjct  18   QAHVYLTQPLAEFKAGASKSSWVAEFSPPWDGTFRTGAQYAAVAPDKGFKNLRAFLEDKG  77

Query  79   LYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKY  138
                       CG T P  + +P       +++     GPCE+WLDD     D +C  K+
Sbjct  78   ---------PTCGNTLPNAKPKPXXXXLIKLASTIEHPGPCEIWLDDSLAFHDDDCEKKF  128

Query  139  -PGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQS  188
               T+F +D+S+CKGSCMLR+YWLG+Q  N    WQ YK C+ L G   +S
Sbjct  129  GSATSFKVDFSACKGSCMLRFYWLGLQ--NSGKRWQSYKNCIPLGGAQSRS  177

>PHYRA_74651
Length=344

 Score = 99.8 bits (247),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 74/133 (56%), Gaps = 16/133 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
              +  GY+++R +LD D  LY        +CG+TDP    +  P T +A  S G V  GP
Sbjct  72   LKESNGYSDIRTLLDSDTSLYGA------DCGFTDPNATPKDPPSTGDATFSRGMVHAGP  125

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSC-KGSCMLRWYWLGIQPVNETY  170
            CE+WLDD KV+S+ NC   Y  GT         +DYSSC  G C LR+YWL  Q ++ + 
Sbjct  126  CEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSST  185

Query  171  SWQVYKVCVSLRG  183
             WQVYK CV L G
Sbjct  186  VWQVYKNCVPLTG  198

>PITG_05271
Length=278

 Score = 98.2 bits (243),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 73/128 (57%), Gaps = 15/128 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP  ++QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q V+    WQ YK 
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  178  CVSLRGNG  185
            C+ L G+G
Sbjct  189  CIPLEGSG  196

>PYVX_14662
Length=540

 Score = 101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 74/132 (56%), Gaps = 15/132 (11%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPC  119
               +KG   +R++LDD  +Y        +CG+TDP   +Q IP    A  S G V  GPC
Sbjct  70   LAAEKGVTEIRSLLDDTSIYG------QDCGFTDPDGTAQDIPTDGKATFSRGMVHVGPC  123

Query  120  EVWLDDLKVMSDMNCHTKYPGTN------FMLDYSSCK-GSCM-LRWYWLGIQPVNETYS  171
            E+WLDD  V+ D +C++ Y G +      F +DYSSC  G C  +R+YWL  Q V+    
Sbjct  124  EIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGDTV  183

Query  172  WQVYKVCVSLRG  183
            WQVYK C+ L+G
Sbjct  184  WQVYKNCIPLKG  195

>PYU1_G014690
Length=295

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 88/176 (50%), Gaps = 36/176 (20%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IST  111
            K  A+ +   K+KG+  LR+ ++D+            CG TDP    + IP  N    S 
Sbjct  58   KDPANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSR  108

Query  112  GYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF---MLDYSSCKGSCMLRWYWLGIQPVNE  168
              V  GPCE+WLDD +VM D +C   + G       +D+SSCK +CMLR++WLG+Q  + 
Sbjct  109  PIVHPGPCEIWLDDKRVMQDDDCEATF-GDEIPVWNIDFSSCKSNCMLRFFWLGLQ--DS  165

Query  169  TYSWQVYKVCVSLRG-------------------NGVQSSETPTPIAVASATPTTA  205
               WQVYK CV L+G                   +   SS+TP P A A+ TP+ A
Sbjct  166  GTRWQVYKNCVPLKGLGGNGSSSSTTPAATTKAPSATSSSKTPAP-APATKTPSPA  220

>PYVX_16138
Length=559

 Score = 100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 72/126 (57%), Gaps = 15/126 (12%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV-TNAFISTGYVLNGPC  119
              ++KG   +R++LDD  +Y        +CGYTDP   +Q IP  + A  S G V  GPC
Sbjct  70   LAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPC  123

Query  120  EVWLDDLKVMSDMNCHTKYPGTN------FMLDYSSC--KGSCMLRWYWLGIQPVNETYS  171
            E+WLDD  V+ D +C++ Y G +      F +DYSSC   G  M+R+YWL  Q V++   
Sbjct  124  EIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETV  183

Query  172  WQVYKV  177
            WQVY V
Sbjct  184  WQVYSV  189

>PHYSO_533903
Length=208

 Score = 95.5 bits (236),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 76/126 (60%), Gaps = 16/126 (13%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ MLDD  LY   PD    CG+TDP    QPIP    A  S G +  GPCE WLDD
Sbjct  76   FKDLKTMLDDTSLYG--PD----CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDD  129

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK-GSC-MLRWYWLGIQPVNETYS-WQVYK  176
             KV+   +C+++Y  +N      F +DYSSC+ G C M+R+YWLG Q +++  + WQ YK
Sbjct  130  KKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYK  189

Query  177  VCVSLR  182
             C+ L+
Sbjct  190  DCIPLQ  195

>PHYKE_2937
Length=366

 Score = 98.6 bits (244),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 76/135 (56%), Gaps = 16/135 (12%)

Query  59   SDFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLN  116
            +      GY+++R +LD D  LY        +CGYT+P   ++  P T +A  S G V  
Sbjct  74   TSLKSSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHV  127

Query  117  GPCEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCKGS-CMLRWYWLGIQPVNE  168
            GPCE+WLDD  V+S+ +C T Y  GT         +DYSSC  S CMLR+YWL  Q V+ 
Sbjct  128  GPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDS  187

Query  169  TYSWQVYKVCVSLRG  183
            +  WQVYK CV L G
Sbjct  188  SMVWQVYKDCVPLTG  202

>PHYKE_6001
Length=289

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 73/139 (53%), Gaps = 15/139 (11%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPC  119
              K   Y +L+ ++DD  +Y        +CG+TDP    QPIP    A  S      GPC
Sbjct  69   LKKANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPSDGKATYSRAIQHVGPC  122

Query  120  EVWLDDLKVMSDMNCHTKYPGTN------FMLDYSSCK-GSCM-LRWYWLGIQPVNETYS  171
            E+WLDD  V SD +C+ KY   N      F +DYSSC  G C  +R+YWL  Q V+    
Sbjct  123  EIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTV  182

Query  172  WQVYKVCVSLRGNGVQSSE  190
            WQ YK C+ L G+G  +S+
Sbjct  183  WQSYKNCIPLEGSGGGTSQ  201

>PPTG_04647
Length=327

 Score = 97.8 bits (242),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
                 GY+++R +LD D  LY        +CGYT+P   ++  P T +A  S G V  GP
Sbjct  71   LKSSNGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGP  124

Query  119  CEVWLDDLKVMSDMNCHTKYPGTNFM-------LDYSSCKGS-CMLRWYWLGIQPVNETY  170
            CE+WLDD  V+S+ NC T Y             +DYSSC  S CMLR+YWL  Q V+   
Sbjct  125  CEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKM  184

Query  171  SWQVYKVCVSLRG  183
             WQVYK CV L G
Sbjct  185  VWQVYKDCVPLTG  197

>PYAP_24689
Length=252

 Score = 95.1 bits (235),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 15/133 (11%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFIST  111
            I+T A      K+ G   LRA L+ +            CG T+P  + +PIP  +  I  
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIP-RDGLIKF  107

Query  112  GYVLN--GPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNE  168
            G  +   GPCE+W D+ +V  D +C+ ++   T F +DYS C+G C+LR+YWLG+Q  + 
Sbjct  108  GSSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQ--DG  165

Query  169  TYSWQVYKVCVSL  181
               WQ YK CV L
Sbjct  166  GKRWQSYKNCVPL  178

>PHYRA_73606
Length=366

 Score = 97.1 bits (240),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 74/131 (56%), Gaps = 16/131 (12%)

Query  63   KQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
               GY+++R +LD D  LY        +CGYT+P   ++  P T +A  S G V  GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCE  127

Query  121  VWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCKGS-CMLRWYWLGIQPVNETYSW  172
            +WLDD  V+S+ +C T Y  GT         +DYSSC  S CMLR+YWL  Q V+    W
Sbjct  128  IWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSEIVW  187

Query  173  QVYKVCVSLRG  183
            QVYK CV L G
Sbjct  188  QVYKDCVPLTG  198

>PHYSO_459106
Length=223

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
              K     ++R M+D D KLY       ++CG+TDP  + Q  P T +A  S G V  GP
Sbjct  70   LKKANNVKDIRTMIDSDTKLYG------EDCGFTDPKGKPQDPPTTGDATFSRGIVHAGP  123

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETY  170
            CE+WLDD  V+ + +C + Y  GT   L      DYSSC  G CM R+YWL +Q  +   
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKT  183

Query  171  SWQVYKVCVSLRG  183
             WQVYK C+ L G
Sbjct  184  YWQVYKNCIPLTG  196

>PITG_04948
Length=232

 Score = 93.2 bits (230),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 81/152 (53%), Gaps = 17/152 (11%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPCEVWLDDL  126
            ++R +LD D  LY        +CGYT+P V  +  P    A  S G V  GPCE+WLDD 
Sbjct  78   DIRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDK  131

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+ + +C + Y  GT   +      DYSSC  G CMLR+YWL +Q ++    WQVYK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYWQVYKNC  191

Query  179  VSLRG-NGVQSSETPTPIAVASATPTTAEAPG  209
            + L G  G  +S+T       S+T  T+ A G
Sbjct  192  IPLSGPAGGGASQTTPSTGDGSSTSQTSPASG  223

>PHYKE_2809
Length=291

 Score = 93.6 bits (231),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 89/182 (49%), Gaps = 26/182 (14%)

Query  33   LVDGDEAQSAPVAHLEEQ------GIKTSADVSDFMKQKGYAN----LRAMLD-DQKLYN  81
            +V+G E+ SA V  ++ Q        K    +    K+   AN    +R MLD D KLY 
Sbjct  19   MVEGTESPSAWVVQIDPQWKGAWQDAKGDEGLVSLYKELKAANNVKDIRTMLDSDTKLYG  78

Query  82   VNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEVWLDDLKVMSDMNCHTKY-P  139
                   +CG+TDP    +  P   A   S G V  GPCE+WLDD  V+ + +C + Y  
Sbjct  79   ------QDCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGD  132

Query  140  GTNFML------DYSSCK-GSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETP  192
            GT   +      DYSSC  G CM R+YWL +Q ++    WQVYK CV L G G   +   
Sbjct  133  GTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQVYKNCVPLSGPGSGGASQT  192

Query  193  TP  194
            +P
Sbjct  193  SP  194

>PPTG_04618
Length=326

 Score = 94.4 bits (233),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 79/149 (53%), Gaps = 17/149 (11%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPT-VESQPIPVTNAFISTGYV  114
            A   +   +  Y ++R+++D   +Y       ++CG+TDP    S+P     A  S G V
Sbjct  65   ATFKELAPKNNYKDVRSLMDGNPVYG------EDCGFTDPKGTPSEPPSDGTATFSRGIV  118

Query  115  LNGPCEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPV  166
              GPCE+WLDD  V+ + +C + Y  GT   +      DYSSC  G CMLR+YWL +Q +
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  167  NETYSWQVYKVCVSLRG--NGVQSSETPT  193
            +    WQ YK C+ L G   G  S +TP+
Sbjct  179  DGKTVWQAYKNCIPLTGPAGGGASQQTPS  207

>PYIR_16443
Length=275

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 65/116 (56%), Gaps = 14/116 (12%)

Query  63   KQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEV  121
            KQKG+  LR+ ++D+            CG T+P    + IP  +    S   V  GPCE+
Sbjct  69   KQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEI  119

Query  122  WLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            WLDD +VM D NC   +      + +D+SSCKGSCMLRW+WLG+Q  +    WQVY
Sbjct  120  WLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQ--DSGKRWQVY  173

>PHYCA_127270
Length=279

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 82/154 (53%), Gaps = 15/154 (10%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSC-KGSC-MLRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q +++   WQ YK 
Sbjct  129  KKVLYEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKD  188

Query  178  CVSLRGNGVQSSETPTPIAVASATPTTAEAPGKG  211
            C+ L+G+G   S T      +S+T   ++    G
Sbjct  189  CIPLKGSGGGGSSTTQKSQTSSSTGDVSQTTSSG  222

>PYU1_G005323
Length=251

 Score = 92.0 bits (227),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (56%), Gaps = 15/133 (11%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFIST  111
             +T A  +     KGY +L++ L+D+            CG + P  +++PIP ++  I  
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIP-SDGVIKL  103

Query  112  GYVLN--GPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNE  168
               +   GPCEVW DD++   D +C   +   T+F +D+S+CKGSCMLR+YWLG+Q  + 
Sbjct  104  ASTIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQ--DG  161

Query  169  TYSWQVYKVCVSL  181
               WQ YK C+ L
Sbjct  162  GKRWQSYKNCIPL  174

>PHYCA_531163
Length=314

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query  63   KQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
               GY+++R +LD D  LY        +CGYT+    ++  P T +A  S G V  GPCE
Sbjct  74   SSNGYSDIRTLLDSDTSLYGA------DCGYTNADATAKDPPSTGDATFSRGMVHVGPCE  127

Query  121  VWLDDLKVMSDMNCHTKYPGTNFM-------LDYSSCKGS-CMLRWYWLGIQPVNETYSW  172
            +WLDD  V+S+ +C T Y             +DYSSC  S CMLR+YWL  Q V+    W
Sbjct  128  IWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSAIVW  187

Query  173  QVYKVCVSLRG  183
            QVYK CV L G
Sbjct  188  QVYKDCVPLTG  198

>PYIW_19151
Length=248

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 79/146 (54%), Gaps = 14/146 (10%)

Query  63   KQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEV  121
            K+KG++ LR+ L+D+            CG+TDP V  + IP       S      GPCE+
Sbjct  66   KEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCEL  116

Query  122  WLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCV  179
            ++DD +V  + +C + + G   ++ +D+S CKG CM+R+YWLG+Q       WQVYK CV
Sbjct  117  YIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASGT--RWQVYKSCV  174

Query  180  SLRGNGVQSSETPTPIAVASATPTTA  205
             +  + V ++ T  P +  S   T A
Sbjct  175  PVSSSAVATATTTKPPSKTSKPTTKA  200

>PHYSO_340333
Length=284

 Score = 92.0 bits (227),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 69/125 (55%), Gaps = 15/125 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q V+    WQ YK 
Sbjct  129  KKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  178  CVSLR  182
            C+ L+
Sbjct  189  CIPLK  193

>PHYSO_533682
Length=278

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 71/130 (55%), Gaps = 15/130 (12%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPC  119
            F     + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S G +  GPC
Sbjct  69   FKSVNNFKDLKTLMDDTSVYG------QDCGFTDPNGTPQPIPTDGKATFSRGLIHVGPC  122

Query  120  EVWLDDLKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWLGIQPVNETYS  171
            E+WLDD KV+S+ +C++KY   N      F +DYSSC  G C  +R Y LG Q + +   
Sbjct  123  EIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTV  182

Query  172  WQVYKVCVSL  181
            WQ YK C+ L
Sbjct  183  WQSYKNCIPL  192

>PITG_04947
Length=298

 Score = 92.0 bits (227),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query  61   FMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGP  118
              K     ++R M+D D KLY       ++CG TDP    +  P T +A  S G V  GP
Sbjct  45   LKKSNNIKDIRTMIDGDAKLYG------EDCGNTDPKATPKDPPTTGDATFSRGIVHAGP  98

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCK-GSCMLRWYWLGIQPVNETY  170
            CE+WLDD  V+ + +C + Y  GT         +DYSSCK G CM R+YWL +Q  ++  
Sbjct  99   CEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKT  158

Query  171  SWQVYKVCVSL  181
             WQVYK C+ L
Sbjct  159  LWQVYKNCIPL  169

>PHYSO_485524
Length=278

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 75/138 (54%), Gaps = 20/138 (14%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDP--TVESQPIPVTNAFISTGYVLNGPCEVWLDD  125
            ++R +LD D KLY  N      CGYT+P  T E  P   T  F S G V  GPCE+WLDD
Sbjct  78   DIRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATF-SRGIVHAGPCEIWLDD  130

Query  126  LKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKV  177
              V+ + +C + Y  GT   +      DYSSC  G CM R+YWL +Q ++    WQVYK 
Sbjct  131  KMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKN  190

Query  178  CVSLRG--NGVQSSETPT  193
            C+ L G   G  S  TP+
Sbjct  191  CIPLSGPAGGGASQSTPS  208

>PHYCA_534296
Length=309

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 15/126 (12%)

Query  65   KGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWL  123
              + +L+ ++DD  +Y        +CG+T+P+  +QPIP    A  S   V  GPCE+WL
Sbjct  47   NNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWL  100

Query  124  DDLKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWLGIQPVNETYSWQVY  175
            DD KV+ + +C++KY   N      F +DYSSC  G C  +R+YWL  Q V+    WQ Y
Sbjct  101  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  160

Query  176  KVCVSL  181
            K C+ L
Sbjct  161  KDCIPL  166

>PHYSO_340332
Length=295

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 15/124 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q V+    WQ YK 
Sbjct  129  KKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKD  188

Query  178  CVSL  181
            C+ L
Sbjct  189  CIPL  192

>PHYCA_69583
Length=224

 Score = 89.7 bits (221),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 82/158 (52%), Gaps = 24/158 (15%)

Query  63   KQKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPC  119
            K+ GYAN +R +LD D  LY  N      CG+++P  +++  P    A    G   +GPC
Sbjct  73   KEAGYANNIRKLLDSDTNLYGAN------CGFSNPDAKAKDPPSDGTATFERGLAHHGPC  126

Query  120  EVWLDDLKVMSDMNCHTKYPGTNFM--------LDYSSCKGS-CMLRWYWLGIQ-PVNET  169
            E+WLDD  V+ + +C   +   ++M        +DYSSC  S CM R+YWL  Q   +  
Sbjct  127  EIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  170  YSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEA  207
            Y WQ+YK C+ L G G   S T     V ++  +T EA
Sbjct  187  YVWQIYKDCIPLTGPGAGKSST-----VGASNSSTPEA  219

>PHYCA_130365
Length=266

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 88/175 (50%), Gaps = 22/175 (13%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPT-VESQPIPVTNAFISTGYV  114
            A   +      Y ++R+M+D   +Y       ++CG+TDP      P     A  S G V
Sbjct  64   ATFKELAASNNYKDVRSMMDGNSVYG------EDCGFTDPNGTPVDPPTDGTATFSRGIV  117

Query  115  LNGPCEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPV  166
              GPCE+WLDD  V+ + +C + Y  GT   +      DYSSC  G CMLR+YWLG+Q +
Sbjct  118  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRL  177

Query  167  NETYSWQVYKVCVSL-----RGNGVQSSETPTPIAVASATPTTAE--APGKGKAA  214
            +    WQ YK C+ L      G    + ++ +P +  S +P+T +  +P KG  A
Sbjct  178  DGKTVWQAYKNCIPLTGPAGGGGSPSTGDSNSPSSGNSDSPSTDDSGSPSKGDEA  232

>PHYSO_438103
Length=238

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 84/169 (50%), Gaps = 34/169 (20%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S   V  GPCE+WLD+
Sbjct  74   FKDLKTLMDDTSVYG------QDCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDN  127

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK-GSCM-LRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q ++    WQ YK 
Sbjct  128  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKD  187

Query  178  CVSLR-----------------GNGVQ--SSETPTPIAVASATPTTAEA  207
            C+ L+                  N  Q  +S++ TP +  SATP  A A
Sbjct  188  CIPLQGSGGGSTNTTSTSTESVSNEAQTPTSDSNTPSSGNSATPAPASA  236

>SDRG_08129
Length=218

 Score = 88.6 bits (218),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 81/169 (48%), Gaps = 31/169 (18%)

Query  54   TSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI----  109
             +A  S F  Q  +  LR ML+ Q            CG + P    + IP   A      
Sbjct  58   VAAFTSAFKVQSQFKTLRDMLEPQG---------PACGNSLPNASKKTIPSDGAMTWRNP  108

Query  110  --STGYVLN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWL  161
                G++ +  GPCEVWLDD +V  + +C T +   P  +  +DYSSC G  CMLR+YWL
Sbjct  109  DTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWL  168

Query  162  GI-QPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPG  209
             + QP      WQVYK CV L+GNG    +    I     +PT A APG
Sbjct  169  ALHQP-----QWQVYKNCVPLQGNG----QAVKAIKADKPSPTMAPAPG  208

>PHYSO_484051
Length=285

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 71/131 (54%), Gaps = 16/131 (12%)

Query  63   KQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
            +  GY+++R +LD D  LY        +CG+T+P    +  P T +   S   V   PCE
Sbjct  74   ESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCE  127

Query  121  VWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCKGS-CMLRWYWLGIQPVNETYSW  172
            +WLDD  V+S+ +C T Y  GT         +DYSSC  S CMLR+YWL  Q V+    W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  173  QVYKVCVSLRG  183
            QVYK CV L G
Sbjct  188  QVYKDCVPLTG  198

>PHYRA_78689
Length=296

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 68/124 (55%), Gaps = 15/124 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP    QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK-GSC-MLRWYWLGIQPVNETYSWQVYKV  177
             KV+ + +C +KY   N      F +DYSSC  G C  +R+YWL  Q ++    WQ YK 
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKD  188

Query  178  CVSL  181
            C+ L
Sbjct  189  CIPL  192

>PPTG_04620
Length=342

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 16/132 (12%)

Query  60   DFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNG  117
            +  K     ++R M+D D KLY       ++CG TDP    +  P T +A  S G V  G
Sbjct  71   ELKKSNNVKDIRTMIDGDAKLYG------EDCGNTDPKATPKDPPSTGDATFSRGIVHAG  124

Query  118  PCEVWLDDLKVMSDMNCHTKY-PGTNFM------LDYSSCK-GSCMLRWYWLGIQPVNET  169
            PCE+WLDD  V+ + +C + Y  GT         +DYSSCK G CM R+YWL +Q  +  
Sbjct  125  PCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSK  184

Query  170  YSWQVYKVCVSL  181
              WQVYK C+ L
Sbjct  185  TLWQVYKNCIPL  196

>PITG_04949
Length=337

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 73/137 (53%), Gaps = 15/137 (11%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVE-SQPIPVTNAFISTGYV  114
            A   +   +  + ++R+++D   ++       +ECG+TDP  + S+P     A  S G V
Sbjct  65   ATFKELAPKNNFKDVRSLMDGNPVFG------EECGFTDPKGKPSEPPSDGTATFSRGIV  118

Query  115  LNGPCEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSCK-GSCMLRWYWLGIQPV  166
              GPCE+WLDD  V+ + +C + Y  GT   +      DYSSC  G CMLR+YWL +Q +
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRL  178

Query  167  NETYSWQVYKVCVSLRG  183
                 WQ YK C+ L G
Sbjct  179  KGKTVWQAYKNCIPLTG  195

>PHYSO_533747
Length=206

 Score = 87.8 bits (216),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 81/150 (54%), Gaps = 19/150 (13%)

Query  39   AQSAPVAHLEEQGIKTSADVSDFMKQK---GYANLRAMLDDQKLYNVNPDALDECGYTDP  95
             Q  PV   ++    T+  V  F   K    + +L+ MLDD  LY   PD    CG+TDP
Sbjct  45   VQIDPVWKSDDWYGNTAKSVEVFKSLKVANNFKDLKTMLDDTSLYG--PD----CGFTDP  98

Query  96   TVESQPIPVT-NAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTN------FMLDYS  148
                QPIP    A  S G +  GPCE WLDD KV+   +C+++Y  +N      F +DYS
Sbjct  99   NGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYS  158

Query  149  SCK-GSC-MLRWYWLGIQPVNETYS-WQVY  175
            SC+ G C M+R+YWLG Q +++  + WQ Y
Sbjct  159  SCENGGCKMMRFYWLGFQALDDKKTVWQTY  188

>SDRG_07565
Length=278

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 82/168 (49%), Gaps = 33/168 (20%)

Query  55   SADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TNAF  108
            +A  + F  Q  +  LR ML+ Q            CG + P    + IP        N  
Sbjct  121  AAFTTAFKAQSQFKTLRDMLEPQG---------PACGNSLPNASKKTIPSDGTMTWLNPD  171

Query  109  ISTGYVLN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKGS-CMLRWYWLG  162
               G++ +  GPCEVWLDD +V  D +C T +   P  +  +DYSSC GS CMLR+YWL 
Sbjct  172  TGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWLA  231

Query  163  I-QPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPG  209
            + QP      WQVYK CV L+GNG          AV  ++P+ A  PG
Sbjct  232  LHQP-----QWQVYKNCVPLQGNGQAVK------AVGPSSPSMAPTPG  268

>PHYKE_10578
Length=239

 Score = 88.6 bits (218),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 69/133 (52%), Gaps = 18/133 (14%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG+T    + QP+P     +     + G+   GPCEV++DD  V+   NC  +YPG   
Sbjct  85   KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPD  144

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPI  195
                 +   +DYSSC G CML +YWLG Q  NE   WQ Y  CV L G+G  +   P+  
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQ--NE--QWQSYVNCVPLTGSGKSTGAQPSG-  199

Query  196  AVASATPTTAEAP  208
              A+  P++ E P
Sbjct  200  NQATEAPSSDEEP  212

>PHYSO_483955
Length=320

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 79/140 (56%), Gaps = 21/140 (15%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI-PVTN--AFISTGYVLNGPCEVWL  123
            Y ++R+++D   +Y       ++CG+TDP  + +P+ P T+  A  S G V  GPCE+WL
Sbjct  76   YKDVRSLMDGNPVYG------EDCGFTDP--KGKPVAPPTDGTATFSRGIVHAGPCEIWL  127

Query  124  DDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVY  175
            DD  V+ + +C + Y  GT   +      DYSSC  G CMLR+YWL +Q ++    WQ Y
Sbjct  128  DDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAY  187

Query  176  KVCVSLRG--NGVQSSETPT  193
            K C+ L G   G  S  TP+
Sbjct  188  KNCIPLTGPAGGGASQTTPS  207

>PYIR_16444
Length=182

 Score = 87.0 bits (214),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 74/135 (55%), Gaps = 16/135 (12%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFIST  111
            K   + +   KQKG+  LR+ ++++            CG T+     +PIP       S 
Sbjct  59   KDPKNFAKVAKQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFSR  109

Query  112  GYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF---MLDYSSCKGSCMLRWYWLGIQPVNE  168
              V  GPCE+WLD+ +V  + NC   + G+      +D+SSCKG+CMLR++WLG+Q  ++
Sbjct  110  AIVHPGPCELWLDNKRVYQNDNCEGVF-GSKIPVWKIDWSSCKGNCMLRFFWLGLQ--DQ  166

Query  169  TYSWQVYKVCVSLRG  183
               WQVYK CV ++G
Sbjct  167  GKRWQVYKNCVPVKG  181

>PHYSO_324715
Length=274

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 90/182 (49%), Gaps = 33/182 (18%)

Query  63   KQKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQ-PIPVTNAFISTGYVLNGPC  119
            K +GY N +R +LD D KLY        +CGY+DP    + P     A  S G   +GPC
Sbjct  64   KAEGYENNIRKLLDGDTKLYGA------DCGYSDPNASPKDPSTDGTATFSRGIAHHGPC  117

Query  120  EVWLDDLKVMSDMNCHTKYPGTNFM--------LDYSSCKGS-CMLRWYWLGIQPV---N  167
            E+WLDD  ++ D +C   +  +++         +DYSSC  + CML +YWL  Q     N
Sbjct  118  EIWLDDKMILHDDDCEETFGTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTGN  177

Query  168  ETYSWQVYKVCVSLRG----------NGVQSSETPTPIAVASATPTTAEAPGKGKAAKSD  217
              Y WQ+YK  V+L G          N  Q++E  +  A A+  P + +A    +A+ SD
Sbjct  178  SKYVWQIYKCYVALTGPAAGQVSTASNSTQTTEGSSADAPATNAPASGDA--TTQASSSD  235

Query  218  WG  219
             G
Sbjct  236  GG  237

>PHALS_03177
Length=259

 Score = 88.6 bits (218),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 72/129 (56%), Gaps = 11/129 (9%)

Query  65   KGYANLRAM--LDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEV  121
            K + +L+A     D K    NP    +CGY+DP  + QPIP    A  S   V  GPCE+
Sbjct  64   KAFQSLKAANNFKDLKTLMDNPVLGRDCGYSDPNGKPQPIPKDGKATFSRAMVHTGPCEM  123

Query  122  WLDDLKVMSDMNCHTKYPGTN------FMLDYSSC-KGSC-MLRWYWLGIQPVNETYSWQ  173
            WLD+ KV+ + +C++KY   +      F +DYSSC  G C  +R+YWL  Q +N    WQ
Sbjct  124  WLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQ  183

Query  174  VYKVCVSLR  182
             YK+C+ L+
Sbjct  184  SYKMCIPLQ  192

>PHYRA_86016
Length=236

 Score = 88.2 bits (217),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 18/134 (13%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYP----  139
            +CGYT   V+ QPIP             G+   GPCE+++DD  V+   +C  +YP    
Sbjct  21   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  80

Query  140  GTNFM----LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG-VQSSETPTP  194
            G+N M    +DYSSC G C L  YWL  Q       WQ Y  CV L+G+G    ++T T 
Sbjct  81   GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQTS  136

Query  195  IAVASATPTTAEAP  208
             A +SA   TAEAP
Sbjct  137  SAESSADQQTAEAP  150

>PPTG_04619
Length=276

 Score = 88.6 bits (218),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 73/137 (53%), Gaps = 18/137 (13%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDL  126
            ++R +LD D  LY        +CGYT+P V  +  P    A  S G V  GPCE+WLDD 
Sbjct  78   DIRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDK  131

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+ + +C + Y  GT   +      DYSSC  G CM R+YWL +Q ++    WQVYK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYWQVYKNC  191

Query  179  VSLRG--NGVQSSETPT  193
            + L G   G  S  TP+
Sbjct  192  IPLSGPAGGGTSQTTPS  208

>SDRG_08137
Length=282

 Score = 88.6 bits (218),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 81/168 (48%), Gaps = 31/168 (18%)

Query  55   SADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TNAF  108
            +A  S F  Q  +  LR ML+ Q            CG + P    + IP        N  
Sbjct  123  AAFTSAFKAQSQFKTLRDMLEPQG---------PACGNSLPNASKKTIPSDGTMTWRNPD  173

Query  109  ISTGYVLN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWLG  162
               G++ +  GPCEVWLDD +V  + +C T +   P  +  +DYSSC G  CMLR+YWL 
Sbjct  174  TGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWLA  233

Query  163  I-QPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPG  209
            + QP      WQVYK CV L+GNG    +    I     +PT A APG
Sbjct  234  LHQP-----QWQVYKNCVPLQGNG----QAVKAIKADKPSPTMAPAPG  272

>PHALS_03176
Length=207

 Score = 87.0 bits (214),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 78/150 (52%), Gaps = 19/150 (13%)

Query  54   TSADVSDFMKQKG---YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFI  109
            T   V  F K K    + +L+ ++D             +CG++DP  + QPIP    A  
Sbjct  59   TQKSVKTFQKLKAANKFKDLKTLMDTSAFG-------AKCGFSDPKGKPQPIPKDGKATF  111

Query  110  STGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTN------FMLDYSSC-KGSCM-LRWYWL  161
            S   V  GPCE+WLD+ KV+ + +C++KY   +      F +DYSSC  G C  +R+YWL
Sbjct  112  SRAIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWL  171

Query  162  GIQPVNETYSWQVYKVCVSLRGNGVQSSET  191
              Q VN    WQ YK C+ L+G+  ++  T
Sbjct  172  AFQGVNGKTVWQSYKNCIPLQGSSGKNGGT  201

>PHYRA_86752
Length=300

 Score = 88.6 bits (218),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 18/134 (13%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYP----  139
            +CGYT   V+ QPIP             G+   GPCE+++DD  V+   +C  +YP    
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  140  GTNFM----LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG-VQSSETPTP  194
            G+N M    +DYSSC G C L  YWL  Q       WQ Y  CV L+G+G    ++T T 
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPLKGSGSATQTQTQTS  200

Query  195  IAVASATPTTAEAP  208
             A +SA   TAEAP
Sbjct  201  SAESSADQQTAEAP  214

>PHYRA_73581
Length=293

 Score = 88.2 bits (217),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 18/137 (13%)

Query  59   SDFMKQKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVL  115
            +D  K+ GY N +R +LD D  LY  +      CGY+DP  + +  P    A  S G   
Sbjct  75   ADKAKESGYENDVRKLLDSDANLYGAD------CGYSDPDADPKDPPTDGTATFSRGIAH  128

Query  116  NGPCEVWLDDLKVMSDMNCHTKYPGTNFM--------LDYSSCKGS-CMLRWYWLGIQPV  166
            +GPCE+WLDD  V+ D +C   +   ++         +DYSSC  S CMLR+YWL  Q  
Sbjct  129  HGPCEIWLDDTMVLHDDDCAKTFGTADYATMKSVLKPIDYSSCSASGCMLRFYWLAFQGS  188

Query  167  NETYSWQVYKVCVSLRG  183
            N+ Y WQ+YK CV L G
Sbjct  189  NDGYVWQIYKHCVPLTG  205

>PYAP_18709
Length=235

 Score = 87.0 bits (214),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (52%), Gaps = 13/141 (9%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IS  110
             KT A  +     KG+ +LR+ L+D+            CG + P    +PIP      ++
Sbjct  54   FKTGAQYAAVAPGKGFKDLRSFLEDKG---------PTCGNSLPNASPKPIPSDGTIKLA  104

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            +     GPCEVWLD+ +   + +C   +   T+F +D+ +CKGSCMLR+YWLG+Q   + 
Sbjct  105  STIEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGKR  164

Query  170  YSWQVYKVCVSLRGNGVQSSE  190
              WQ YK C+ L     + S+
Sbjct  165  --WQSYKNCIPLNDKNDKKSQ  183

>PHYRA_73583
Length=630

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 69/125 (55%), Gaps = 16/125 (13%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDL  126
            ++R M+D D KLY        +CG+TDP    +  P T +A  S G V  GPCEVWLDD 
Sbjct  379  DIRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDE  432

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+ + +C + Y  GT   L      DYSSC  G CM R++WL +Q  +    WQVYK C
Sbjct  433  MVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTWWQVYKNC  492

Query  179  VSLRG  183
            V L G
Sbjct  493  VPLSG  497

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 74/137 (54%), Gaps = 18/137 (13%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDL  126
            ++R +LD D  LY  N      CGYT+P    +  P T +A  S G V  GPCE+WLDD 
Sbjct  78   DIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDK  131

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+ + +C + Y  GT   +      DYSSC  G CM R+YWL +Q ++    WQVYK C
Sbjct  132  MVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTWWQVYKNC  191

Query  179  VSLRG--NGVQSSETPT  193
            + L G   G  S  TP+
Sbjct  192  IPLSGPAGGGASQTTPS  208

>PPTG_14221
Length=275

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 68/125 (54%), Gaps = 15/125 (12%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+T+P    QPIP    A  S   V +GPC +WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK-GSC-MLRWYWLGIQPVNETYSWQVYKV  177
              V+ + +C  KY   N      F +DYSSC  G C  +R+YWL  Q +N+   WQ YK 
Sbjct  129  KMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKD  188

Query  178  CVSLR  182
            C+ L+
Sbjct  189  CIPLK  193

>PHYRA_83499
Length=473

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 69/134 (51%), Gaps = 18/134 (13%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYP----  139
            +CGYT   V+ QPIP             G+   GPCE+++DD  V+   +C  +YP    
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  140  GTNFM----LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG-VQSSETPTP  194
            G+N M    +DYSSC G C L  YWL  Q       WQ Y  CVSL+G+G    ++T T 
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVSLKGSGSATQTQTQTS  200

Query  195  IAVASATPTTAEAP  208
             A +SA   T EAP
Sbjct  201  SAESSADQQTTEAP  214

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 41/72 (57%), Gaps = 12/72 (17%)

Query  112  GYVLNGPCEVWLDDLKVMSDMNCHTKYPG--------TNFMLDYSSCKGSCMLRWYWLGI  163
            G  ++GPCE++LDD  ++   NC  +Y G        ++  +DYSSC G+C L  YWLG 
Sbjct  346  GTGISGPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGF  405

Query  164  QPVNETYSWQVY  175
            Q  NE   WQ Y
Sbjct  406  Q--NE--QWQAY  413

>SPRG_22161
Length=300

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 76/149 (51%), Gaps = 27/149 (18%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT------NAFISTGYV  114
            F  Q  +  LR MLD Q      PD    CG T      + IP        N     G++
Sbjct  67   FKAQTQFKTLRDMLDPQ-----GPD----CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFI  117

Query  115  LN--GPCEVWLDDLKVMSDMNCHTKYPG---TNFMLDYSSCKGS-CMLRWYWLGI-QPVN  167
             +  GPCEVW+D+ +V  + +C T +P     N  +DYSSC  + CMLR+YWL + +P+ 
Sbjct  118  PSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWLALHEPM-  176

Query  168  ETYSWQVYKVCVSLRGNGVQSSETPTPIA  196
                WQVYK CV L+GNG Q +  P P A
Sbjct  177  ----WQVYKNCVPLKGNGQQPTSAPKPTA  201

>PYU1_G005324
Length=191

 Score = 84.7 bits (208),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 13/148 (9%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IS  110
             +T A  +    +KGY +L++ LD +            CG T    +++ IP       +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKG---------PTCGNTLSNAKAKAIPKDGMLKFA  105

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            +     GPCE+WL + +   + +C   +   T+F +D+S+CKG+CMLR+YWLG+Q   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  170  YSWQVYKVCVSLRGNGVQSSETPTPIAV  197
              WQ YK CV L+ + ++S E    + V
Sbjct  165  -RWQSYKNCVPLKSSKLRSLEEVEDVTV  191

>PYU1_G005326
Length=191

 Score = 84.7 bits (208),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 13/148 (9%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IS  110
             +T A  +    +KGY +L++ LD +            CG T    +++ IP       +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKG---------PTCGNTLSNAKAKAIPKDGMLKFA  105

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            +     GPCE+WL + +   + +C   +   T+F +D+S+CKG+CMLR+YWLG+Q   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  170  YSWQVYKVCVSLRGNGVQSSETPTPIAV  197
              WQ YK CV L+ + ++S E    + V
Sbjct  165  -RWQSYKNCVPLKSSKLRSLEEVEDVTV  191

>PYU1_G005328
Length=191

 Score = 84.7 bits (208),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 77/148 (52%), Gaps = 13/148 (9%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IS  110
             +T A  +    +KGY +L++ LD +            CG T    +++ IP       +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKG---------PTCGNTLSNAKAKAIPKDGMLKFA  105

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            +     GPCE+WL + +   + +C   +   T+F +D+S+CKG+CMLR+YWLG+Q   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  170  YSWQVYKVCVSLRGNGVQSSETPTPIAV  197
              WQ YK CV L+ + ++S E    + V
Sbjct  165  -RWQSYKNCVPLKSSKLRSLEEVEDVTV  191

>PYAR_20617
Length=254

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 90/194 (46%), Gaps = 25/194 (13%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLE---EQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
            V   EP        ++S+ VA  +   E   KT A  +   K +G  +LR  L+D+    
Sbjct  25   VYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLEDKGPV-  83

Query  82   VNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEVWLDDLKVMSDMNCHTKY-P  139
                    CG +      + IP +    +++     GPCEVW DD+    D +C   +  
Sbjct  84   --------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDCEKTFGS  135

Query  140  GTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQ---------SSE  190
             T+F +D+S C GSC+LR+YWLG+Q  +    WQ YK CV L+G             +S 
Sbjct  136  ATSFAVDFSKCSGSCLLRFYWLGLQ--DGGKRWQSYKNCVPLKGGTGTGTPTTPSKPASN  193

Query  191  TPTPIAVASATPTT  204
            + TP A  +ATP T
Sbjct  194  STTPSATPNATPAT  207

>PYU1_G001527
Length=278

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 17/160 (11%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNA----FISTGYVLN--G  117
            Q  Y ++RA++D + ++   P    ECG T PT E QP+P          S G+  +  G
Sbjct  80   QSTYKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  118  PCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            PCEVW D++   S+ NC T YP     L  D S C G  ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  176  KVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAK  215
              C  L G     + +PT   VA  T  T   P    ++K
Sbjct  194  IACAPLAGGSSGGATSPT---VAPTTKPTTAKPAAATSSK  230

>PYU1_G001523
Length=278

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 17/160 (11%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNA----FISTGYVLN--G  117
            Q  Y ++RA++D + ++   P    ECG T PT E QP+P          S G+  +  G
Sbjct  80   QSTYKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  118  PCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            PCEVW D++   S+ NC T YP     L  D S C G  ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  176  KVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAK  215
              C  L G     + +PT   VA  T  T   P    ++K
Sbjct  194  IACAPLAGGSSGGATSPT---VAPTTKPTTAKPAAATSSK  230

>PHYSO_246676
Length=187

 Score = 83.6 bits (205),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 81/182 (45%), Gaps = 40/182 (22%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            VL PEP +  +    +  P+A LE QG KT  D + + K+ GY  LR  +D  K Y+V  
Sbjct  14   VLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDKAK-YDVTS  72

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFM  144
             A   CG+TDP    QPIP  N   STGY  +G     L    V+  M            
Sbjct  73   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASL----VLDGM------------  116

Query  145  LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSE-TPTPIAVASATPT  203
                                    +YSW+VYK C+ L G+G  S E T TP A ++++ T
Sbjct  117  ----------------------KNSYSWKVYKACIPLSGSGGTSQESTRTPNAPSNSSAT  154

Query  204  TA  205
            TA
Sbjct  155  TA  156

>H310_06362
Length=197

 Score = 83.6 bits (205),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 24/129 (19%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYVLN--G  117
            G+  LRAMLD        PD    CGYT   V ++PIP     +        G+V +  G
Sbjct  51   GFKTLRAMLDPH-----GPD----CGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSHTG  101

Query  118  PCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQV  174
            PCE+WLD+ +V  + NC   +   P     +D+SSC GSC +R+YWL +        WQV
Sbjct  102  PCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLWQV  157

Query  175  YKVCVSLRG  183
            YK C  L G
Sbjct  158  YKNCAPLVG  166

>SPRG_19917
Length=241

 Score = 84.3 bits (207),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 73/145 (50%), Gaps = 25/145 (17%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP------VTNAFISTGYV  114
            F  Q  Y  LRA+LD        PD    CG T   V  + IP        N     G++
Sbjct  67   FKAQSKYKTLRALLDQH-----GPD----CGNTLTNVARKEIPSNGKMTFQNPDTGEGFI  117

Query  115  LN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWLGIQPVNE  168
            L+  GPCEVWLD+ +V  + +C T +   P  N  +DYSSC    CMLR+YW+ +     
Sbjct  118  LSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALH----  173

Query  169  TYSWQVYKVCVSLRGNGVQSSETPT  193
            +  WQVYK CV L G G + ++ PT
Sbjct  174  SPRWQVYKNCVPLLGYGQKPAKKPT  198

>SPRG_19916
Length=305

 Score = 85.5 bits (210),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 73/144 (51%), Gaps = 27/144 (19%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT------NAFISTGYV  114
            F  Q  +  LR MLD Q      PD    CG T      + IP        N     G+V
Sbjct  67   FKAQTQFKTLRDMLDPQ-----GPD----CGNTLTNGAKKAIPTNGMMTWQNPDTGEGFV  117

Query  115  LN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWLGI-QPVN  167
             +  GPCEVW+DD +V  + +C T +   P  N  +DYSSC G  CMLR+YWL + +P+ 
Sbjct  118  PSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYWLALHEPM-  176

Query  168  ETYSWQVYKVCVSLRGNGVQSSET  191
                WQVYK CV L GNG + S T
Sbjct  177  ----WQVYKNCVPLEGNGQKPSPT  196

>PHALS_03179
Length=372

 Score = 86.3 bits (212),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 9/106 (8%)

Query  89   ECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML--  145
            ECG++DP  + QPIP    A +S   V  GPCE+WLD+ KV+ + +C+ KY   +  +  
Sbjct  131  ECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKS  190

Query  146  ----DYSSC-KGSCM-LRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
                DYSSC  G C  +R+YWL  Q +     WQ YK C+ L+G+G
Sbjct  191  VLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQSYKNCIPLQGSG  236

>PHYKE_3913
Length=321

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTN-AFISTGYVLNGPCEVWLDDL  126
            ++R + D D  LY  N      CG+T+P    +  P    A  S G V  GPCE+WLDD 
Sbjct  105  DIRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDK  158

Query  127  KVMSDMNCHTKY-PGTNFML------DYSSCK-GSCMLRWYWLGIQPVNETYSWQVYKVC  178
             V+ + +C + Y  GT   +      DYSSC  G CM R+YW+ +Q ++    WQVYK C
Sbjct  159  MVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQVYKNC  218

Query  179  VSLRGNGVQSSETPTP  194
            V L G G   +   +P
Sbjct  219  VPLTGPGSGGASQTSP  234

>PYU1_G007364
Length=316

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 69/136 (51%), Gaps = 23/136 (17%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TNAFISTGYV  114
            F     YA+LR +L             ++CG T      +PIP        N   + G+V
Sbjct  83   FQASGKYASLRDLLQGHG---------EDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFV  133

Query  115  LN--GPCEVWLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
             +  GPCE+WLDD  V+ + NC  ++PG      +D+SSC G C++R+YWL +Q      
Sbjct  134  PSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EP  189

Query  171  SWQVYKVCVSLRGNGV  186
            +WQ+YK C+ L G  V
Sbjct  190  AWQIYKNCIPLAGGEV  205

>PYAP_18713
Length=184

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 70/132 (53%), Gaps = 14/132 (11%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI-S  110
             KT A  +   K KG+ +LR+ L+D+            CG T+P  + + +P  +  + S
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKG---------PACGKTNPNAKPRNVPSDSKVVFS  107

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTN--FMLDYSSCKGSCMLRWYWLGIQPVNE  168
               V  GPCE+W+DD  V  + +C  ++      F +D+SSCKG CMLR+YWLG+Q  + 
Sbjct  108  RPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQ--DS  165

Query  169  TYSWQVYKVCVS  180
               WQ Y   ++
Sbjct  166  GKRWQSYSTYIA  177

>PHYRA_73582
Length=326

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 81/166 (49%), Gaps = 29/166 (17%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPT-VESQPIPVTNAFISTGYVLNGPCEVWLDD  125
            Y +L+ ++D        P+  ++CG+TDP    S P     A  S G V  GPCE+WLDD
Sbjct  76   YKDLKTLMD-------GPEFGEDCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDD  128

Query  126  LKVMSDMNCHTKY-PGTNFML------DYSSCK-GSCMLRWYWLGIQPVNETYSWQVYKV  177
              V+ + +C + Y  GT   +      DYS C  G C+LR+YWL +Q ++    WQ YK 
Sbjct  129  KMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKN  188

Query  178  CVSLRG--NGVQSSETPT-----------PIAVASATPTTAEAPGK  210
            C+ L G   G  S   P+           P +  S TP+T +A  K
Sbjct  189  CIPLTGPAGGGASQTAPSTGDGSNVSQTQPSSGESDTPSTGDASQK  234

>PYAR_14260
Length=212

 Score = 82.8 bits (203),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 15/140 (11%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFIST  111
             KT A  +     KG+ NLR+ L+ +      P     CG +  + + +PIP ++  +  
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESK-----GP----TCGNSLSSAKPKPIP-SDGMVKF  80

Query  112  GYVLN--GPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNE  168
               L   GPCE+WLD+       +C  ++   T+  +++S+CKGSCMLR+YWLG+Q  + 
Sbjct  81   ASTLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQ--DS  138

Query  169  TYSWQVYKVCVSLRGNGVQS  188
               WQ YK CV L G   +S
Sbjct  139  GTRWQSYKNCVPLGGGKSRS  158

>CCA17179
Length=185

 Score = 81.6 bits (200),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 72/146 (49%), Gaps = 23/146 (16%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI--  109
            I  +A   +      + NLR  L D+  Y         CG T+P  + +PIP  +A +  
Sbjct  31   IDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIPADHAIVWE  81

Query  110  ----STGYVLN--GPCEVWLDDLKVMSDMNC--HTKYPGTNFMLDYSSCKGSCMLRWYWL  161
                  G+V +  GPCEVWL++ +V  D NC  H +       +D+S+C   C+L+++WL
Sbjct  82   NPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNGCLLQFFWL  141

Query  162  GIQPVNETYSWQVYKVCVSLRGNGVQ  187
             +        WQVYK C+ +  NG++
Sbjct  142  ALH----EPQWQVYKNCIPIAPNGIK  163

>PYIW_21963
Length=326

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 82/163 (50%), Gaps = 18/163 (11%)

Query  58   VSDFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-------I  109
            + +F     + NL+ +++ +QK+ N   DA  +CG+TDP+  S+P+  ++          
Sbjct  70   IKNFKTDTRHPNLKTLVEKNQKVINAKADA--KCGWTDPSKTSEPLEGSSIIYGRNFEGT  127

Query  110  STGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTN----FMLDYSSCKGSCMLRWYWLGIQP  165
              G+V  GPCE W D++ V  +M+C  KY   N      +D + CKG+  L  YW+ +  
Sbjct  128  GEGFVHPGPCETWCDNVMVQQEMHCDEKYNVANKAAIIPIDAAKCKGAKQLTTYWIAMH-  186

Query  166  VNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAP  208
             NE   WQ+Y  CV L G     +   TP   + A  TT +AP
Sbjct  187  GNE---WQIYLDCVGLSGATSGGASGSTPATTSKAPATTPKAP  226

>PHALS_05392
Length=367

 Score = 84.0 bits (206),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 72/142 (51%), Gaps = 13/142 (9%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPI-PVTN--AFI  109
            ++S D       K  A      D + L + NP   ++CGYTDP     P+ P +N  A  
Sbjct  139  QSSGDEGLLSTFKELATANNFKDVRSLMDGNPVYGEDCGYTDPN--GTPVAPPSNGEATF  196

Query  110  STGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSCKG-SCMLRWYWL  161
            S G V  GPCE+WLDD  V+ + +C   Y  GT   +      DYSSC    CMLR+YWL
Sbjct  197  SRGIVHAGPCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWL  256

Query  162  GIQPVNETYSWQVYKVCVSLRG  183
             +Q ++    WQ YK C+ L G
Sbjct  257  ALQRLDGKTVWQAYKNCIPLNG  278

>PYIR_19612
Length=260

 Score = 82.8 bits (203),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 20/132 (15%)

Query  63   KQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEV  121
            K+KG+A LR+ L+D+            CG+TDP V  + IP       S      GPCE+
Sbjct  68   KEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFSRDISHPGPCEL  118

Query  122  WLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYK---  176
            W+DD +V  + +C + + G   ++ +D++ C G CM+R+YWL +Q       WQVY+   
Sbjct  119  WIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGT--RWQVYRSEL  176

Query  177  ---VCVSLRGNG  185
               +CV + G+G
Sbjct  177  TRDLCVPVSGSG  188

>SDRG_17318
Length=241

 Score = 82.0 bits (201),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 71/145 (49%), Gaps = 25/145 (17%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIP------VTNAFISTGYV  114
            F  Q  Y  LRAMLD        PD    CG T   V  + IP        N     G++
Sbjct  67   FKAQSKYKTLRAMLDPH-----GPD----CGNTLTNVARKEIPSNGKMTFQNPDTGEGFI  117

Query  115  --LNGPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWLGIQPVNE  168
                GPCEVWLD+ +V  + +C T +   P  N  +DYSSC    CMLR+YW+ +     
Sbjct  118  PSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALH----  173

Query  169  TYSWQVYKVCVSLRGNGVQSSETPT  193
            +  WQVYK CV L G G + ++ PT
Sbjct  174  SPRWQVYKNCVPLLGYGQKPAKKPT  198

>PHYSO_255056
Length=269

 Score = 82.4 bits (202),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 17/151 (11%)

Query  63   KQKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPC  119
            K+ GYAN +R +LD D  LY        +CG+++P  + +  P    A    G   +GPC
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFERGLAHHGPC  127

Query  120  EVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQ-PVNETYSWQVYKVC  178
            E+WLDD  V+ + +C   +     + DY S  G CM R+YWL  Q   +  Y WQ+YK C
Sbjct  128  EIWLDDTMVLHNDDCAKAFS----VEDYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNC  182

Query  179  VSLRGNGVQSSETPT--PIAVASATPTTAEA  207
            + L G G   + T T  P+   +  P T +A
Sbjct  183  IPLTGPGAGQTATVTNSPVWTNAPAPETVQA  213

>PHYCA_97965
Length=288

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 20/134 (15%)

Query  89   ECGYTDPTVESQPIPVTNAFI------STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG--  140
            +CGYT   V+ QPIP ++  +        G+   GPCE+++DD  V+   +C  ++PG  
Sbjct  87   KCGYTRTDVDPQPIP-SDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGA  145

Query  141  ------TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTP  194
                  +   +D+SSC G C L  YWL  Q  NE   WQ Y  CV L+G+G  +++T T 
Sbjct  146  KGSDKMSEMSVDFSSCNGKCTLTIYWLAFQ--NE--QWQSYVNCVPLQGDG-SATQTQTS  200

Query  195  IAVASATPTTAEAP  208
            +A ++    ++EAP
Sbjct  201  VAGSATKEKSSEAP  214

>SDRG_17317
Length=122

 Score = 78.2 bits (191),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 65/119 (55%), Gaps = 18/119 (15%)

Query  89   ECGYTDPTVESQPIPV------TNAFISTGYVLN--GPCEVWLDDLKVMSDMNCHTKY--  138
            +CG T  T   + IP        N     G+V +  GPCEVWLDD +V  + +C T +  
Sbjct  8    DCGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPA  67

Query  139  -PGTNFMLDYSSCKG-SCMLRWYWLGI-QPVNETYSWQVYKVCVSLRGNGVQSSETPTP  194
             P  +  +DYSSC G  CMLR+YWL + +P+     WQVYK CV L GNG + S T  P
Sbjct  68   KPAAHLPIDYSSCSGDGCMLRFYWLALHEPM-----WQVYKNCVPLEGNGEKPSPTDAP  121

>H257_13550
Length=266

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 73/142 (51%), Gaps = 28/142 (20%)

Query  63   KQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYVLN  116
            +  G+  LRAMLD Q      PD    CGY+   V ++PIP     +        G+V +
Sbjct  103  QATGFKTLRAMLDPQ-----GPD----CGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPS  153

Query  117  --GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
              GPCE+WLD+ +V  + +C T +   P  +  +D++SC GSC +R+YW+ +        
Sbjct  154  HTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALH----QDL  209

Query  172  WQVYKVCVSLRGNGVQSSETPT  193
            WQVYK C  L G     S TPT
Sbjct  210  WQVYKNCAPLVG----LSATPT  227

>PYU1_G001526
Length=334

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 69/138 (50%), Gaps = 14/138 (10%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNA----FISTGYVLN--G  117
            Q  Y ++RA++D + ++   P    ECG T PT E QP+P          S G+  +  G
Sbjct  80   QSTYKSVRALVDAKGVFQ--PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  118  PCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            PCEVW D++   S+ NC T YP     L  D S C G  ML++YWL +     + +WQ Y
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAY  193

Query  176  KVCVSLRGNGVQSSETPT  193
              C  L G     + +PT
Sbjct  194  IACAPLAGGSSGGATSPT  211

>PYU1_G005325
Length=207

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 69/132 (52%), Gaps = 13/132 (10%)

Query  52   IKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-IS  110
             +T A  +    +KGY +L++ LD +            CG T    +++ IP       +
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKG---------PTCGNTLSNAKAKAIPKDGMLKFA  105

Query  111  TGYVLNGPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            +     GPCE+WL + +   + +C   +   T+F +D+S+CKG+CMLR+YWLG+Q   + 
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK-  164

Query  170  YSWQVYKVCVSL  181
              WQ YK C+ L
Sbjct  165  -RWQSYKNCIPL  175

>CCI47381
Length=211

 Score = 80.1 bits (196),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 23/131 (18%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYVLN--GP  118
            +  LR  L D+  Y         CG T+P    +PIP  NA +        G+V +  GP
Sbjct  72   FRTLRDFLKDKGPY---------CGSTNPNASPKPIPADNAIVWENPDTREGFVASHMGP  122

Query  119  CEVWLDDLKVMSDMNC--HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYK  176
            CEVWL + +V  D NC  H         +++SSC G C+L+++WL +        WQVYK
Sbjct  123  CEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGGCLLQFFWLALHEPQ----WQVYK  178

Query  177  VCVSLRGNGVQ  187
             C+ +  NG++
Sbjct  179  NCIPIAPNGIR  189

>PYIR_24743
Length=357

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 63/132 (48%), Gaps = 24/132 (18%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYV  114
            F  Q  +  LR +L D            +CG + P    + IP     +        G+V
Sbjct  81   FQGQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQNPDTGEGFV  131

Query  115  --LNGPCEVWLDDLKVMSDMNC---HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
                GPCE+WLDD +V SD NC    T  P     +D+SSCK +CMLR+YWL +      
Sbjct  132  PSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLALHEP---  188

Query  170  YSWQVYKVCVSL  181
             +WQVYK CV L
Sbjct  189  -TWQVYKNCVPL  199

>PYIR_23585
Length=240

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 14/131 (11%)

Query  54   TSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTG  112
            ++AD +     KG+A  RA L+ +            CG T      +PIP  N    S  
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRG---------PTCGNTLANASPKPIPSDNTVKFSRA  108

Query  113  YVLNGPCEVWLDDLKVMSDMNCHTKYPGT--NFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
             V  GPCE+W+D+ +V  + +C   +  +   + +D+S+CKGSCMLR+YWLG+Q     +
Sbjct  109  IVHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF  168

Query  171  SWQVYKVCVSL  181
              Q Y  C++L
Sbjct  169  --QSYSKCLAL  177

>SPRG_04679
Length=226

 Score = 79.0 bits (193),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 86/179 (48%), Gaps = 41/179 (23%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TN  106
              +A  S F  Q  +  LR ML+ Q            CG + P    + IP        N
Sbjct  57   NVAAFTSAFKAQSQFKTLRDMLEPQG---------PACGNSLPNASKKTIPSDGTMTWLN  107

Query  107  AFISTGYVLN--GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKGS-CMLRWYW  160
                 G++ +  GPCEVWLDD +V  + +C T +   P  +  +DYSSC G+ CMLR+YW
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCGGAGCMLRFYW  167

Query  161  LGI-QPVNETYSWQVY---------KVCVSLRGNGVQSSETPTPIAVASATPTTAEAPG  209
            L + QP      WQVY         + CV L+GNG Q+ +   P    S++P+ A APG
Sbjct  168  LALHQP-----QWQVYSQLKQPVWNENCVPLQGNG-QAVKADGP----SSSPSMAPAPG  216

>PHALS_05394
Length=288

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 79/159 (50%), Gaps = 24/159 (15%)

Query  60   DFMKQKGYAN----LRAMLDDQKLYNVNPDALDECGYTDPT-VESQPIPVTNAFISTGYV  114
            D  K+ G AN     R+++D   +Y        +CGYTDP      P     A  S    
Sbjct  67   DTFKELGAANNFKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRPMK  120

Query  115  LNGPCEVWLDDLKVMSDMNCHTKYPGTNFM--------LDYSSCKG-SCMLRWYWLGIQP  165
              G CE+W++   V+ + +C + Y G   M        +DYSSCKG  C+LR+YWL +Q 
Sbjct  121  HAGLCEIWINKKMVLQNDDCQSAY-GDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQR  179

Query  166  VNETYSWQVYKVCVSLRGNG---VQSSETPTPIAVASAT  201
            + +   WQ YK C+S++G+    V     P+ +A A++T
Sbjct  180  IGDKTVWQAYKNCISIKGSSGGEVGRDADPSQLANANST  218

>SDRG_08782
Length=450

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 73/138 (53%), Gaps = 27/138 (20%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT------NAFISTGYV  114
            F  Q  +  LR MLD        PD    CGYT   V+ + IP        N     G++
Sbjct  66   FKAQSQFKTLRDMLDPHG-----PD----CGYTLTNVDKKAIPGNGQMTWKNPDTGEGFI  116

Query  115  --LNGPCEVWLDDLKVMSDMNCHTKYPGT---NFMLDYSSCKGS-CMLRWYWLGI-QPVN  167
                GPCEVW+D+ +V  + +C T +P +   N  +DYSSC  + CMLR+YWL + +P+ 
Sbjct  117  PSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGANGCMLRFYWLALHEPM-  175

Query  168  ETYSWQVYKVCVSLRGNG  185
                WQVYK CV L+GNG
Sbjct  176  ----WQVYKNCVPLKGNG  189

>PPTG_07507
Length=299

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 18/135 (13%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CGYT   V+ +PIP             G+   GPCE+++DD  V+   NC   +PG   
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPI  195
                 +   +D+SSC G C L  YWLG Q       WQ Y  CV L+G+G  +++T    
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPLQGSG-SATQTQAST  198

Query  196  AVASATPTTAEAPGK  210
              + A   T EAP K
Sbjct  199  GGSGAEQKTPEAPVK  213

>PPTG_07509
Length=299

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 65/135 (48%), Gaps = 18/135 (13%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CGYT   V+ +PIP             G+   GPCE+++DD  V+   NC   +PG   
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPI  195
                 +   +D+SSC G C L  YWLG Q       WQ Y  CV L+G+G  +++T    
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPLQGSG-SATQTQAST  198

Query  196  AVASATPTTAEAPGK  210
              + A   T EAP K
Sbjct  199  GGSGAEQKTPEAPVK  213

>PHYRA_86241
Length=195

 Score = 77.8 bits (190),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 19/127 (15%)

Query  64   QKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
            + GYAN +R +LD D  LY        +CG++DP  +++  P    A    G   +GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  121  VWLDDLKVMSDMNCHTKYPGTNFM--------LDYSSCKGS-CMLRWYWLGIQ-PVNETY  170
            +WLDD  V+ + +C   +   ++M        +DYSSC  S CM R+YWL  Q   +  Y
Sbjct  128  IWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKY  187

Query  171  SWQVYKV  177
             WQ+Y  
Sbjct  188  VWQIYSA  194

>PHYKE_9024
Length=299

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 72/145 (50%), Gaps = 10/145 (7%)

Query  60   DFMKQKGYANLRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118
            D    KGY +L A +  +Q+LY+   DA  +CG T     ++     +    +G+   GP
Sbjct  72   DTFPSKGYDSLGAFISKNQELYSSATDA--DCGLTVYKDSARSELPASKLTYSGFTHTGP  129

Query  119  CEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSWQVYK  176
            CEVW DD KV+ D +C TKYP     + Y  S C  +  L  YW+G+        WQVY 
Sbjct  130  CEVWCDDTKVLFDYDCQTKYPDIPATMSYDESLCANANRLTIYWIGLHGD----PWQVYT  185

Query  177  VCVSLRGNGVQSSETPTPIAVASAT  201
             CV L G G  S   PTP+   ++T
Sbjct  186  DCVWLEG-GSGSGSAPTPVGAGAST  209

>PYAP_24691
Length=145

 Score = 75.9 bits (185),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 4/72 (6%)

Query  117  GPCEVWLDDLKVMSDMNCHTKY-PGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            GPCE+W D+ +V  + +C  ++   T F +DYS CKG+C+LR+YWLG+Q   +   WQ Y
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQDGGK--RWQSY  62

Query  176  KVCVSLRGNGVQ  187
            K CV + GNG +
Sbjct  63   KNCVPI-GNGKR  73

>PHYRA_80750
Length=275

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 62/120 (52%), Gaps = 15/120 (13%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD   +        +CG+TDP+   QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FVDLKTLMDDTATFGA------DCGFTDPSGTPQPIPSDGKATFSRAIVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTN------FMLDYSSCK-GSCM-LRWYWLGIQPVNETYSWQVYKV  177
             KV  + +C + Y   N      F +DYS C  G C  +R+YWL  Q V+    WQ Y V
Sbjct  129  KKVFYEDDCFSTYGNENQDIKSVFPVDYSPCDGGGCKEMRFYWLAFQGVDGKTVWQSYNV  188

>PHYCA_12943
Length=287

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 75/141 (53%), Gaps = 26/141 (18%)

Query  89   ECGYTDPTVESQPIPVTNAFI------STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG--  140
            +CGYT   V+ QPIP ++  +        G+   GPCE+++DD  V+   +C  ++PG  
Sbjct  87   KCGYTRTDVDPQPIP-SDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGP  145

Query  141  ------TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTP  194
                  +   +D+SSC G C L  YWL  Q  NE   WQ Y  CV L+G+G  +++T T 
Sbjct  146  DGSDKMSEMSVDFSSCNGKCTLTIYWLAFQ--NE--QWQSYVNCVPLQGDG-SATQTQTS  200

Query  195  IAVAS------ATPTTAEAPG  209
            +A ++      ATP+T  + G
Sbjct  201  VAGSATEEQTPATPSTEGSSG  221

>PHYKE_6002
Length=197

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 75/162 (46%), Gaps = 18/162 (11%)

Query  25   VLYPEPFYLVDGDEA---QSAPVAHLEEQGIKTSADVSDF---MKQKGYANLRAMLDDQK  78
            +L PE  +  D   A   Q APV    +        V+ F    K   + +L+ ++DD  
Sbjct  27   MLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDLKTLMDDTS  86

Query  79   LYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDLKVMSDMNCHTK  137
            +Y        +CG+TDP+   QPIP    A  S      GPCE+WLD  K  S  NC   
Sbjct  87   VYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFSKDNCADM  140

Query  138  YPGTNFMLDYSSCK-GSCM-LRWYWLGIQPVNETYSWQVYKV  177
                 F +DYSSC  G C  +R+YWL  Q ++    WQ Y++
Sbjct  141  ---ETFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYRI  179

>SPRG_07627
Length=536

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/199 (31%), Positives = 88/199 (44%), Gaps = 33/199 (17%)

Query  33   LVDGDEAQSAPVAHLEEQGIKTS--ADVSDFMK-------QKGYANLRAMLDDQKLYNVN  83
             + G    S+P+A      ++T+  A +  F+        Q   AN       Q  Y   
Sbjct  14   FISGHGVISSPLAEFAPNIMRTTYVAIIQAFLPGKFDDSPQTNVANFNKAFAAQTQYKTL  73

Query  84   PDALD----ECGYTDPTVESQPIPV------TNAFISTGYV--LNGPCEVWLDDLKVMSD  131
             D LD    +CG T P V ++ IP        N     G++    GPCE+WLD  +V  +
Sbjct  74   RDLLDLHGPDCGNTLPNVAAKAIPSDGKMTWKNPDTGEGFIPSHTGPCEIWLDSTRVFQN  133

Query  132  MNCHTKYPG---TNFMLDYSSCK-GSCMLRWYWLGI-QPVNETYSWQVYKVCVSLRGN--  184
             +C T +P        +DY+ C    C+LR+YWL + QP      WQVYK CV L+GN  
Sbjct  134  NDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP-----QWQVYKNCVPLQGNDQ  188

Query  185  GVQSSETPTPIAVASATPT  203
            G   +  P P    S+ P+
Sbjct  189  GSAPAVAPAPTTTPSSAPS  207

>PHYRA_79140
Length=424

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 59/131 (45%), Gaps = 19/131 (15%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG TD +   QPIP             G+   GPCE++LDD  V+   NC   YPG   
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG--VQSSETPT  193
                 ++  +DYSSC G C L  YWL  Q       WQ Y  CV L G+G   Q+  T  
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQ----NAQWQAYVNCVPLSGSGSATQTQSTAG  200

Query  194  PIAVASATPTT  204
                A  TP T
Sbjct  201  SSTSAQETPAT  211

>PHYRA_78175
Length=319

 Score = 78.2 bits (191),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 62/124 (50%), Gaps = 13/124 (10%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTG------YVLNGPCE  120
            Y++L+  + D KL  VN +   ECGYT+P   +QP+P T    S G          GPCE
Sbjct  78   YSSLKEFMAD-KLVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTASHEGPCE  136

Query  121  VWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            VW DD +V  D NC   +P     L  D  +C GS  L  YW+ +     + SWQVY  C
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SASWQVYINC  192

Query  179  VSLR  182
             +L 
Sbjct  193  AALE  196

>PHYRA_77971
Length=230

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG+T   V+ QP+P     +       GY   GPCE+++DD  V+   NC   YPG   
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
                 +   +DYSSC G C    YWLG Q       WQ Y  CV L G G
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  191

>PHYRA_83500
Length=394

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 58/131 (44%), Gaps = 19/131 (15%)

Query  89   ECGYTDPTVESQPIPVTN-----AFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG TD +   QPIP             G+   GPCE++LDD  V+   NC   YPG   
Sbjct  85   KCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDV  144

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG--VQSSETPT  193
                 ++  +DYSSC G C L  YWL  Q       WQ Y  C  L G+G   Q+  T  
Sbjct  145  GSTQTSDMPVDYSSCNGKCTLTIYWLAFQNAQ----WQAYVNCAPLSGSGSATQTQSTAG  200

Query  194  PIAVASATPTT  204
                A  TP T
Sbjct  201  SSTSAQETPAT  211

>PHYRA_85794
Length=230

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 52/110 (47%), Gaps = 17/110 (15%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG+T   V+ QP+P     +       GY   GPCE+++DD  V+   NC   YPG   
Sbjct  86   KCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPN  145

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG  185
                 +   +DYSSC G C    YWLG Q       WQ Y  CV L G G
Sbjct  146  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPLSGTG  191

>PYAR_18165
Length=261

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 66/132 (50%), Gaps = 18/132 (14%)

Query  89   ECGYTDPTVESQPIP---VTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML  145
            +CG T+     QP P   V    IS  ++  GPCE+WLDD KV+S  +C  ++P     +
Sbjct  68   KCGKTNANAAVQPAPSDGVVAFAISAQHI--GPCEIWLDDTKVVSATDCWKQFPDKRIPV  125

Query  146  DYSSC--KGSCMLRWYWLGIQPVNETYSWQVYKVCVSL-RGNGVQSSE------TPTPIA  196
            D+S C  K SC LRW W+       T  W+ Y  CV +  G G  SS       TP+P  
Sbjct  126  DFSKCANKASCELRWIWMATH----TSPWEFYDNCVRVGTGAGGSSSNQPTNATTPSPRP  181

Query  197  VASATPTTAEAP  208
            V +ATPT    P
Sbjct  182  VPAATPTQTTLP  193

>PPTG_03139
Length=320

 Score = 77.8 bits (190),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (52%), Gaps = 13/124 (10%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT----NAFISTGYVLN--GPCE  120
            Y++L+  + D K+  V+ D   ECGYT+P    QP+P T    +     G+  +  GPCE
Sbjct  78   YSSLKEFMTD-KMVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCE  136

Query  121  VWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            VW DD +V  D NC   +P     L  D+ +C GS  L  YW+ +     + SWQVY  C
Sbjct  137  VWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH----SPSWQVYINC  192

Query  179  VSLR  182
             +L 
Sbjct  193  AALE  196

>PHYSO_488921
Length=296

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 77/172 (45%), Gaps = 35/172 (20%)

Query  59   SDFMKQKGYANLRAMLD------DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTG  112
            +D     GY +LR MLD         L    P  +D  GYT+  +  Q       FI++ 
Sbjct  68   NDHWNATGYKSLREMLDPIAPDYGHSLKTATP--VDVTGYTE--MWWQNDEYKEGFINS-  122

Query  113  YVLNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
               +GPCE W+DD+K+    NC  ++         DYSSCKG C+L +YWL +   N   
Sbjct  123  --HSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEPN---  177

Query  171  SWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLE  222
             WQ+YK CV +   G                 +T ++ GKG+   SD G  E
Sbjct  178  -WQIYKQCVPITNGGS----------------STTQSSGKGETDASDAGTTE  212

>PYIW_15526
Length=256

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 67/131 (51%), Gaps = 27/131 (21%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV-  114
            + GY +L+ MLD          ++  CGYT+P   + P+ V+        N     G++ 
Sbjct  74   KTGYTSLKEMLDK---------SVSGCGYTNP--NAAPVDVSGLKSMKYQNNEYKEGFLG  122

Query  115  -LNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
               GPCE W+D+ K+    +C   YPG      +DYS CKG+C L +YWL +     +  
Sbjct  123  SHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLAVH----SPK  178

Query  172  WQVYKVCVSLR  182
            WQVYK CV+++
Sbjct  179  WQVYKGCVAIK  189

>PYIR_22134
Length=300

 Score = 77.4 bits (189),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 81/176 (46%), Gaps = 26/176 (15%)

Query  28   PEPFYLVDGDEAQ-----SAPVAHLEEQGIKTSAD-------VSDFMKQKGYANLRAMLD  75
            P+P + + GD  Q       P       G+  + D        +  +K   Y ++RA+++
Sbjct  35   PKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTYDSVRALVE  94

Query  76   DQKLYNVNPDALDECGYTDPTVESQPIPVT----NAFISTGYVLN--GPCEVWLDDLKVM  129
             + ++     A  ECG T  T  +QP+P      +   S G+  +  GPCEVW D+ KV 
Sbjct  95   AKGVFISG--ATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVWCDNNKVF  152

Query  130  SDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRG  183
            SD NC   YP       +D++ C G+ +L+  WL +     + +WQ+Y  C  L G
Sbjct  153  SDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQIYINCAPLEG  204

>PITG_11936
Length=333

 Score = 77.8 bits (190),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 13/124 (10%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT----NAFISTGYVLN--GPCE  120
            Y +L+  ++D  +  VN D   ECGYT+P    QP+P T    +     G+ L+  GPCE
Sbjct  78   YKSLKEFMNDNMVL-VNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCE  136

Query  121  VWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            V+ D+ +V  D NC   +P     L  D+ +C GS  L  YW+ +     + SWQVY  C
Sbjct  137  VYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINC  192

Query  179  VSLR  182
              L 
Sbjct  193  APLE  196

>PYIW_18792
Length=125

 Score = 73.6 bits (179),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (54%), Gaps = 1/97 (1%)

Query  25   VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNP  84
            V  P P + V     Q  P+A LE QG K +AD + + K KGY NLR  +DD+K Y V+ 
Sbjct  27   VSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKVDG  86

Query  85   DALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEV  121
                ECG++      QPIP   A  STGY  +GP  +
Sbjct  87   GNF-ECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PPTG_04617
Length=496

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 60/118 (51%), Gaps = 16/118 (14%)

Query  76   DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDDLKVMSDMNC  134
            D KLY        +C Y+DP  + +  P    A  S G   +GPCE+WLDD  V+ D +C
Sbjct  59   DSKLYGA------DCEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDDDC  112

Query  135  HTKYPGTNFM--------LDYSSCKGS-CMLRWYWLGIQPVNETYSWQVYKVCVSLRG  183
               +   ++M        +DYSSC  S CM R+YW+  Q  +  Y  Q+Y+ CV L G
Sbjct  113  EKTFGTADYMTQKSVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLTG  170

>PHYSO_329293
Length=310

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 77/172 (45%), Gaps = 35/172 (20%)

Query  59   SDFMKQKGYANLRAMLD------DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTG  112
            +D     GY +LR MLD         L    P  +D  GYT+  +  Q       FI++ 
Sbjct  68   NDHWNATGYKSLREMLDPIAPDYGHSLKTATP--VDVTGYTE--MWWQNDEYKEGFINS-  122

Query  113  YVLNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
               +GPCE W+DD+K+    NC  ++         DYSSCKG C+L +YWL +   N   
Sbjct  123  --HSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEPN---  177

Query  171  SWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLE  222
             WQ+YK CV +   G                 +T ++ GKG+   SD G  E
Sbjct  178  -WQIYKQCVPITNGGS----------------STTQSSGKGETDASDAGTTE  212

>PHYSO_476077
Length=268

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 77/167 (46%), Gaps = 18/167 (11%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQ--KLYNVNPDA--LDECGYTDPTVESQPIPVTNAF  108
             T+   S F K  GY++LR MLD Q     N   D   +D  G T  T+  Q       F
Sbjct  68   NTATFTSSFAK-AGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLT--TMSWQNDQEQKGF  124

Query  109  ISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---TNFMLDYSSCKGSCMLRWYWLGIQP  165
            I + +   GPCEVW+DD  V    +C  KY          D+S C G C LR+YWL +  
Sbjct  125  IDSHH---GPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHE  181

Query  166  VNETYSWQVYKVCV-SLRGNGVQSSETPTPIAVASATPTTAEAPGKG  211
             N    WQ+YK CV  + G+G Q++     +  A +T  TA     G
Sbjct  182  PN----WQIYKQCVPVVSGSGAQTTMVQGTVVPAGSTTETANESDGG  224

>PHYSO_472009
Length=268

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 77/167 (46%), Gaps = 18/167 (11%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQ--KLYNVNPDA--LDECGYTDPTVESQPIPVTNAF  108
             T+   S F K  GY++LR MLD Q     N   D   +D  G T  T+  Q       F
Sbjct  68   NTATFTSSFAK-AGYSSLRDMLDQQVTDCANTRTDVSPVDVSGLT--TMSWQNDQEQKGF  124

Query  109  ISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---TNFMLDYSSCKGSCMLRWYWLGIQP  165
            I + +   GPCEVW+DD  V    +C  KY          D+S C G C LR+YWL +  
Sbjct  125  IDSHH---GPCEVWIDDTMVEHQDDCVAKYGSGYPAKVNADFSKCSGDCTLRFYWLALHE  181

Query  166  VNETYSWQVYKVCV-SLRGNGVQSSETPTPIAVASATPTTAEAPGKG  211
             N    WQ+YK CV  + G+G Q++     +  A +T  TA     G
Sbjct  182  PN----WQIYKQCVPVVSGSGAQTTMVQGTVVPAGSTTETANESDGG  224

>PYIW_24288
Length=201

 Score = 75.5 bits (184),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 62/129 (48%), Gaps = 14/129 (11%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT----NAFISTGYV--  114
            F  Q  Y NLR ++D   +++   D   ECG+T  T   QP+P      N  ++ G    
Sbjct  79   FGNQNRYRNLRELVDFTAVFSAGAD--KECGFTSATGAKQPLPAQYVEWNNRVNQGLAPT  136

Query  115  LNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSW  172
              GPCEVW D      D NC   + G    L Y  S C G+ ML++YWL +    ++  W
Sbjct  137  HEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREW  192

Query  173  QVYKVCVSL  181
            +VY  CV L
Sbjct  193  EVYINCVPL  201

>PYAP_23672
Length=257

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 78/177 (44%), Gaps = 18/177 (10%)

Query  47   LEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTN  106
             +E   KT   + DF+ +  Y N+    D          +  ECGY+DP    QP+P   
Sbjct  60   FDEAITKTGLSLKDFIMK--YQNMSGASDT--------GSTPECGYSDPKGTPQPLPEKI  109

Query  107  AFISTGYVLNGPCEVWLDDLKVMSDM-NCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQP  165
             F  TG++  GPCE + D++ V     +C   YPG     D + C G    ++YWLG+  
Sbjct  110  QF-HTGFMHWGPCEAYCDNVLVTKHAADCKVAYPGGAVPYDKAKCAGKKQFKFYWLGMDS  168

Query  166  VNETYSWQVYKVCVSLRGNGVQSSETPT-----PIAVASATPTTAEAPGKGKAAKSD  217
             N +  WQ Y  CV L G G  S    +     P +   A    ++AP K   A ++
Sbjct  169  GN-SAPWQAYVNCVPLSGAGASSDSNASDADDEPASSTPAVSKASKAPAKDTPATTN  224

>SPRG_07795
Length=335

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 67/143 (47%), Gaps = 22/143 (15%)

Query  49   EQGIKTSAD-VSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTN-  106
            EQG   + D  +   K   +  L+A LD       +P   D CG TDP   +QP+P T  
Sbjct  57   EQGPDWNTDQFTKHFKASSFKTLKAFLD------AHPTGGD-CGITDPNGPAQPLPSTVK  109

Query  107  ------AFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYW  160
                   FIS+     GPCE+W D+ +V  D NC   YP     +D S C G+  L   W
Sbjct  110  WANGELGFISS---HQGPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLW  166

Query  161  LGIQPVNETYSWQVYKVCVSLRG  183
            L +     T  WQVYK CV+L G
Sbjct  167  LALH----TPEWQVYKNCVNLSG  185

>PHYKE_7717
Length=568

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 4/80 (5%)

Query  138  YPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAV  197
            +PG ++ +DYS+CKG+C LRWYWLG++ +   YSWQVYK C+ L G G  + ET   +  
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLTGPGGGTPETSGSV--  59

Query  198  ASATPTTAEAPGKGKAAKSD  217
               T  T EAP    A  S+
Sbjct  60   --VTTETTEAPELTLAFNSE  77

>PHYCA_19611
Length=531

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 70/159 (44%), Gaps = 13/159 (8%)

Query  32   YLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECG  91
            Y+   D + S             +A+ +  M    Y +L+  ++D K+  VN +   ECG
Sbjct  250  YMATIDSSTSGFSGQFGGSPADNTANFNKGMAASKYTSLKEFMND-KMVLVNKEFTKECG  308

Query  92   YTDPTVESQPIPVTNAFISTG------YVLNGPCEVWLDDLKVMSDMNCHTKYP--GTNF  143
            YT+P    QP+P T    S G          GPCEVW DD +V  D NC   +P      
Sbjct  309  YTNPKEAPQPVPKTYVEWSHGDGEGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKM  368

Query  144  MLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLR  182
              D  +C GS  L  YW+ +     + SWQVY  C +L 
Sbjct  369  PYDRDACLGSSQLTIYWIALH----SPSWQVYINCAALE  403

 Score = 38.5 bits (88),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 31/69 (45%), Gaps = 6/69 (9%)

Query  116  NGPCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGIQPVNETYSWQ  173
            NGP  V      +  D NC   YP     +  D  +C G+  L +YWL +     + +WQ
Sbjct  77   NGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALH----SSTWQ  132

Query  174  VYKVCVSLR  182
            VY  C +L 
Sbjct  133  VYTNCAALE  141

>PHYRA_83494
Length=224

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 62/135 (46%), Gaps = 19/135 (14%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG TD +   Q +P             G+   GPCE+++DD  V+   NC   YPG   
Sbjct  22   KCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDV  81

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNG--VQSSETPT  193
                 ++  +DYSSC G C    YWL  Q       WQ Y  CV L G+G   Q++ + T
Sbjct  82   GSTVTSDMPVDYSSCNGDCTFTIYWLAFQNAQ----WQAYVNCVPLTGSGSTTQTAASST  137

Query  194  PIAVASATPTTAEAP  208
                 +++  T EAP
Sbjct  138  ETGSEASSSETTEAP  152

>PITG_08892
Length=309

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 72/145 (50%), Gaps = 14/145 (10%)

Query  62   MKQKGYANLRAML-DDQKLYN--VNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118
            +  KG  +L A++  +QKLY+  V+PD    CG T     ++     +    TG+   GP
Sbjct  74   LATKGGGSLGALIAKNQKLYSSEVDPD----CGLTTFKDSARSKLPASQLEYTGFTHPGP  129

Query  119  CEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYK  176
            CEVW DD KV+ D +C TK+PG  +    D S C  +  L  YWL +        WQVY 
Sbjct  130  CEVWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVH----GEQWQVYS  185

Query  177  VCVSLRGNGVQSSETPTPIAVASAT  201
             CV L G G    E P+ +   ++T
Sbjct  186  DCVWLEG-GSGKGEPPSTVGAGAST  209

>PYAP_22257
Length=247

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 22/135 (16%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TNAFISTGYV  114
            F  QK +  L+ M++ Q            CG +    + Q +         N    TG+V
Sbjct  65   FKSQKTFKTLKDMVEKQ--------LKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGFV  116

Query  115  --LNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
               +GPCE+W+DD +VM + NC  K+ G      ++YS CKG CMLR+YWL +       
Sbjct  117  SSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLALHEPE---  173

Query  171  SWQVYKVCVSLRGNG  185
             WQVYK CV +   G
Sbjct  174  -WQVYKNCVPIVNKG  187

>PYU1_G005868
Length=267

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 78/162 (48%), Gaps = 37/162 (23%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV--L  115
             Y +LR MLD          A+ +CG+T    +  P+ V+        N     G++   
Sbjct  74   SYKSLREMLDS---------AVPDCGFT--LTDGTPVDVSSLKSMKWQNDQEQKGFIDSH  122

Query  116  NGPCEVWLDDLKVMSDMNC---HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSW  172
            +GPCE+W+DD K+M   +C   +T YP     +DYS CKG C L +YWL +   N    W
Sbjct  123  HGPCELWIDDTKIMHSDDCRADYTAYPA-EIPVDYSVCKGKCQLTFYWLALHEPN----W  177

Query  173  QVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAA  214
            Q+YK CV ++ NG     + TP        TT +AP   K A
Sbjct  178  QIYKQCVPIQ-NGSGGGSSSTPA-------TTTKAPSTNKPA  211

>PYIR_14463
Length=369

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 59/126 (47%), Gaps = 24/126 (19%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYV  114
            F  Q  +  LR +L D            +CG + P    + IP     +        G+V
Sbjct  83   FNAQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQNPDSGEGFV  133

Query  115  --LNGPCEVWLDDLKVMSDMNC---HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
                GPCEVWLDD +V SD NC    T  P     +D+SSCKG CMLR+YWL +      
Sbjct  134  PSHTGPCEVWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLALHEP---  190

Query  170  YSWQVY  175
             +WQVY
Sbjct  191  -TWQVY  195

>PYVX_24563
Length=254

 Score = 75.1 bits (183),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 76/158 (48%), Gaps = 34/158 (22%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI--------STGYV--L  115
            GY +LRAM+D+         ++ +CG T   V   P+ +T   +          G+V   
Sbjct  77   GYTSLRAMIDE---------SVSDCGNTRTDVS--PVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  116  NGPCEVWLDDLKVMSDMNC---HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSW  172
            +GPCEVW+DD+ V    +C   +T YP  N   D+S C GSC LR+YWL +   N    W
Sbjct  126  HGPCEVWIDDVMVTHQDDCRAVYTSYPA-NVDADFSKCSGSCTLRFYWLALHEPN----W  180

Query  173  QVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGK  210
            Q+YK C       + +S+  T +       TTA+   +
Sbjct  181  QIYKQCAP-----ITNSDYSTTVGTVVPADTTADCNNR  213

>PYIW_24289
Length=196

 Score = 73.6 bits (179),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 13/119 (11%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV--TNAFISTGYVLNGPCEVWLD  124
            Y NLR ++D + +++   D   ECG+T+ T   QP+    T  F  T     GPCE+W D
Sbjct  87   YRNLRDLIDTKAVFSAGTD--KECGFTNVTSAKQPLSAHATGGFTPTH---QGPCEIWCD  141

Query  125  DLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
             + V  + NC   YP     L Y  S C G+ ML++YWL +  +     W+ Y  C  L
Sbjct  142  RVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINCAPL  196

>SPRG_07797
Length=318

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 64/134 (48%), Gaps = 21/134 (16%)

Query  57   DVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-------NAFI  109
            + +   K   +  L+A LD       +P   D CG TD    +QP+P T         FI
Sbjct  66   EFTKHFKASSFKTLKAFLD------AHPSGGD-CGITDANGPAQPLPSTVKWANGQEGFI  118

Query  110  STGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
            S+     GPCE+W D+++V  D NC   YP  +  +D S C G+  L   WL +     +
Sbjct  119  SS---HQGPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH----S  171

Query  170  YSWQVYKVCVSLRG  183
              WQVYK CV+L G
Sbjct  172  PQWQVYKNCVNLSG  185

>PITG_20312
Length=270

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 70/154 (45%), Gaps = 18/154 (12%)

Query  66   GYANLRAMLDDQ--KLYNVNPDA--LDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEV  121
            GY++LR MLD Q     N   D   +D  G +   +  Q       FI + +   GPCEV
Sbjct  80   GYSSLRDMLDQQVADCANTRTDGSPVDVSGLS--LINWQNDEEQKGFIDSHH---GPCEV  134

Query  122  WLDDLKVMSDMNC----HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKV  177
            W+DD  V    +C     T YP  N   D+S C G C LR+YWL +   N    WQ+YK 
Sbjct  135  WIDDTMVDHQEDCVATYGTGYPA-NIKADFSKCSGDCTLRFYWLALHEPN----WQIYKQ  189

Query  178  CVSLRGNGVQSSETPTPIAVASATPTTAEAPGKG  211
            CV +  N    S+    +  AS +  TA     G
Sbjct  190  CVPIMNNSGMQSQVQGTVMPASTSTETANDSDSG  223

>PHYCA_112615
Length=196

 Score = 73.6 bits (179),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 59/112 (53%), Gaps = 19/112 (17%)

Query  67   YANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCEVWLDD  125
            + +L+ ++DD  +Y        +CG+TDP  ++QPIP    A  S   V  GPCE+WLDD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGKATFSRAIVHVGPCEIWLDD  128

Query  126  LKVMSDMNCHTKYPGTNFMLDYSSC-KGSCM-LRWYWLGIQPVNETYSWQVY  175
             K +  +          F +DYSSC  G C  +R+YWL  Q V+    WQ Y
Sbjct  129  TKDIKSI----------FPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSY  170

>PPTG_06256
Length=318

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 14/145 (10%)

Query  62   MKQKGYANLRAML-DDQKLY--NVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118
            +  KG  +L A++  +QKLY  +V+PD    CG T     ++     +    TG+   GP
Sbjct  74   LPTKGGGSLGALIAKNQKLYSSDVDPD----CGLTTFKESARSKLPASQLEYTGFTHPGP  129

Query  119  CEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSWQVYK  176
            CEVW DD KV+ D +C TK+PG+   + Y  S C  +  L  YWL +        WQVY 
Sbjct  130  CEVWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVHGEQ----WQVYS  185

Query  177  VCVSLRGNGVQSSETPTPIAVASAT  201
             CV L G G    E P+ +   ++T
Sbjct  186  DCVWLEG-GSGKGEPPSTVGAGAST  209

>PHYRA_84732
Length=265

 Score = 74.3 bits (181),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 74/159 (47%), Gaps = 17/159 (11%)

Query  66   GYANLRAMLDDQ--KLYNVNPDA--LDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEV  121
            GY++LR MLD Q     N   D   +D  G T   +  Q       FI + +   GPCEV
Sbjct  80   GYSSLRDMLDQQVTDCANTRTDVSPVDVSGLT--VLNWQNDQEQKGFIDSHH---GPCEV  134

Query  122  WLDDLKVMSDMNCHTKYPG---TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            W+DD KV    +C   Y      +   D+S C G C LR+YWL +   N    WQVYK C
Sbjct  135  WIDDTKVDHQDDCVATYGSGYPASVSADFSKCSGDCTLRFYWLALHEPN----WQVYKQC  190

Query  179  VSLRGN-GVQSSETPTPIAVASATPTTAEAPGKGKAAKS  216
            V +  N G Q   T  P    + T   +++  + +A +S
Sbjct  191  VPVVNNSGTQVQGTVVPADTTAQTANESDSGCQTRALRS  229

>PITG_20631
Length=270

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 72/160 (45%), Gaps = 30/160 (19%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV--L  115
            GY++LR MLD Q         + +C  T    +  P+ V+        N     G++   
Sbjct  80   GYSSLRDMLDQQ---------VADCANT--RTDGSPVDVSGLSLMNWQNDEEQKGFIDSH  128

Query  116  NGPCEVWLDDLKVMSDMNC----HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
            +GPCEVW+DD  V    +C     T YP  N   D+S C G C LR+YWL +   N    
Sbjct  129  HGPCEVWIDDTMVDHQEDCVATYGTGYPA-NIKADFSKCSGDCTLRFYWLALHEPN----  183

Query  172  WQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKG  211
            WQ+YK CV +  N    S+    +   SA+  TA     G
Sbjct  184  WQIYKQCVPIMNNSGMQSQVQGTVMPTSASTETANDSDSG  223

>PHYKE_10295
Length=292

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 82/185 (44%), Gaps = 35/185 (19%)

Query  53   KTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT-------  105
            K +A  +    +  +  LRA++D      V PD    CG T   +   P+ V+       
Sbjct  61   KNTATFTSSFPKSQFKTLRALMD-----TVAPD----CGNT--ALTGSPVDVSALSSMKW  109

Query  106  -NAFISTGYV--LNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYW  160
             N     G++   +GPCE W+DD +VM   +C   YP       +DYSSC G C   +YW
Sbjct  110  QNDQEQKGFIDSHHGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYW  169

Query  161  LGIQPVNETYSWQVYKVCVSLRG--NGVQSSE------TPTPIAVASATPTTAEAPGKGK  212
            + +   N    WQVYK C  +     G QSS+      T T     +  P+T  AP   +
Sbjct  170  MALHEPN----WQVYKQCAPITNGSGGGQSSKTGASKSTTTDALSTTDAPSTTNAPSVTQ  225

Query  213  AAKSD  217
            +A +D
Sbjct  226  SASTD  230

>PHYCA_103479
Length=314

 Score = 75.1 bits (183),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 76/161 (47%), Gaps = 21/161 (13%)

Query  59   SDFMKQKGYANLRAMLD----DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYV  114
            +D     GY +LR M+D    D          +D  GYT+  +  Q       FI++   
Sbjct  68   ADHWNATGYKSLREMVDPIATDYGFSVKTATPVDVTGYTE--MWWQNDEYKEGFIAS---  122

Query  115  LNGPCEVWLDDLKVMSDMNCHTK---YPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
              GPCE W+DD ++    NC  +   YP      DYSSCKG C+  +YWL +   N    
Sbjct  123  HEGPCEGWIDDTRIFHYDNCAAQFKTYPA-KIPADYSSCKGDCLFSFYWLALHEPN----  177

Query  172  WQVYKVCVSLRGNGV-QSSETPTPIAVASATPT---TAEAP  208
            WQ+YK CV +  NG   ++ T  P+   +AT T   T EAP
Sbjct  178  WQIYKQCVPITNNGSGATTTTDAPVVTPAATTTKSGTTEAP  218

>PHYKE_3912
Length=252

 Score = 74.3 bits (181),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 63/125 (50%), Gaps = 16/125 (13%)

Query  69   NLRAMLD-DQKLYNVNPDALDECGYTDPTVESQ-PIPVTNAFISTGYVLNGPCEVWLDDL  126
            ++R + D D  LY  N      CG+TDP    + P  + +A  S G +  G CE+WLDD 
Sbjct  59   DIRTLPDSDNSLYGAN------CGFTDPNATPKDPPTIGDATFSCGMMHIGSCEIWLDDT  112

Query  127  KVMSDMNCHTKY------PGTNFM-LDYSSCKGSC-MLRWYWLGIQPVNETYSWQVYKVC  178
             V+S  +C   Y        + F  +D S C  S  MLR+YWL  Q V+    WQVYK C
Sbjct  113  MVLSSDDCQAAYRDDTQEKASVFTPIDCSLCSSSGYMLRFYWLAFQGVDSKVVWQVYKDC  172

Query  179  VSLRG  183
            V L G
Sbjct  173  VPLTG  177

>PHYCA_15125
Length=334

 Score = 75.1 bits (183),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 74/149 (50%), Gaps = 14/149 (9%)

Query  60   DFMKQ----KGYANLRAML-DDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYV  114
            +F K+    KGY +L A +  +Q+LY+   D   +CG T     ++     +    +G+ 
Sbjct  105  NFFKETFPTKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSKLPASELEYSGFT  162

Query  115  LNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSW  172
              GPCEVW DD KV+ D +C TKYP     L Y  S C  +  L  YW+G+        W
Sbjct  163  HTGPCEVWCDDTKVLFDYDCQTKYPTIPAKLPYDESKCANANRLTIYWIGLH----GDPW  218

Query  173  QVYKVCVSLRGNGVQSSETPTPIAVASAT  201
            QVY  CV L G G  S E P+ +   ++T
Sbjct  219  QVYTDCVWLEG-GSGSGEAPSAVGAGAST  246

>PHYCA_10471
Length=309

 Score = 74.7 bits (182),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 67/136 (49%), Gaps = 11/136 (8%)

Query  61   FMKQKGYANLRAMLDDQK-LYNVNP--DALDECGYTDPTVESQPIPVTNAFISTGYVLNG  117
            F   K Y++L+ + D    L +++P   A  ECG++ P   ++ +P    +   GY   G
Sbjct  74   FNASKKYSSLKDLADKTMVLQSLSPFGKATKECGFSLPNGTARALPAKVQWKDFGYSHQG  133

Query  118  PCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVY  175
            PCEVW DD    SD NC   YP    N   D   C G+ M++ YW+ +  +     WQ+Y
Sbjct  134  PCEVWCDDKLAFSDTNCALHYPEVPANLPYDVDVCTGAKMMQSYWIALHGL----PWQLY  189

Query  176  KVCVSLRG--NGVQSS  189
              CV L G  NG  ++
Sbjct  190  LNCVRLSGKTNGTDNA  205

>PHYKE_2454
Length=374

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 66/133 (50%), Gaps = 12/133 (9%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT---NAFISTG  112
            A  +   K   Y +L+A++DD+    V+   L  CG  DP+  +QP+P T   +   S G
Sbjct  65   ASFTKAFKASSYKSLKALIDDKAKITVSGATL-TCGSADPSAAAQPLPSTLEWSHSDSEG  123

Query  113  YV--LNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNE  168
            +     GPCE W DD++V  D NC   +P     + Y  SS  G+  L +YW+ +     
Sbjct  124  FTPSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP--  181

Query  169  TYSWQVYKVCVSL  181
              SWQVY  C +L
Sbjct  182  --SWQVYVNCAAL  192

>PHYKE_6077
Length=322

 Score = 74.7 bits (182),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 66/139 (47%), Gaps = 19/139 (14%)

Query  55   SADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT---------  105
            +A+ +  M    Y +L+  +   K    +P+   ECGYT+P   +QP+P T         
Sbjct  66   TANFNKGMAASKYTSLKEFMA-AKAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSG  124

Query  106  NAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLGI  163
              F S+     GPCEVW DD +V  D NC   +P     L  D  +C GS +L  YW+ +
Sbjct  125  EGFTSS---HEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL  181

Query  164  QPVNETYSWQVYKVCVSLR  182
                 + SWQVY  C +L 
Sbjct  182  H----SPSWQVYINCAALE  196

>SDRG_17448
Length=262

 Score = 73.9 bits (180),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 50/83 (60%), Gaps = 10/83 (12%)

Query  117  GPCEVWLDDLKVMSDMNCHTKY---PGTNFMLDYSSCKG-SCMLRWYWLGI-QPVNETYS  171
            GPCEVWLD+ +V  + +C T +   P  +  +DYSSC G  CMLR+YW+ + QP      
Sbjct  18   GPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSCAGDGCMLRFYWIALHQP-----E  72

Query  172  WQVYKVCVSLRGNGVQSSETPTP  194
            WQVYK CV L+GNG      P P
Sbjct  73   WQVYKNCVPLQGNGQNPGPAPQP  95

>PYAP_18138
Length=268

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 16/117 (14%)

Query  63   KQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAF-ISTGYVLNGPCEV  121
            KQ G  +LR+ +D +         + ECG +   V  +PIP TN           GPCE 
Sbjct  80   KQHGVKDLRSYIDAK---------ITECGDSLKDVSPKPIPKTNTVTFERALTHKGPCEF  130

Query  122  WLDDLKVMSDMNCHTKYPGTNFM-LDYSSCKG-SCMLRWYWLGIQPVNETYSWQVYK  176
            W+DD +V  + +C   +   + + LDYS C G +C+LR+YWLG+Q       WQVY+
Sbjct  131  WIDDTRVFQNNDCEPYFKEKSTVPLDYSPCTGKTCLLRFYWLGLQ----NSDWQVYR  183

>PYU1_G005872
Length=297

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 69/143 (48%), Gaps = 27/143 (19%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV-  114
            + GY +L+ M+D          A+  CGY++P     P+ V+        N     G++ 
Sbjct  77   KTGYKSLKQMMDK---------AVPGCGYSNPNA--APVDVSKMSAMKFQNNEYKEGFLG  125

Query  115  -LNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
              +GPCE W+D+ +V    +C  K+PG      + Y SCKG+C L +YWL +     +  
Sbjct  126  SHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH----SPK  181

Query  172  WQVYKVCVSLRGNGVQSSETPTP  194
            WQ YK CV+++ N      +  P
Sbjct  182  WQAYKSCVAIKNNAYSEERSSDP  204

>PHALS_04411
Length=262

 Score = 73.6 bits (179),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 66/135 (49%), Gaps = 15/135 (11%)

Query  60   DFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVES-QPIPVTNAFISTGYVLNGP  118
            +   +  Y N+R ++D       NP   ++CG+TDP  +   P     A  S G V  GP
Sbjct  69   ELAAKNNYKNVRTLMDG------NPAFGEDCGFTDPKGKPVDPPSDGTATFSRGIVHAGP  122

Query  119  CEVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSC-KGSCMLRWYWLGIQPVNETY  170
            CE+W +D  ++ + +C + Y  GT   +       YS C  G  +LR+YWL +Q +    
Sbjct  123  CELWCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQGKV  182

Query  171  SWQVYKVCVSLRGNG  185
             WQ YK C+ L G G
Sbjct  183  VWQAYKNCIPLTGPG  197

>PHYCA_6388
Length=294

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 73/148 (49%), Gaps = 12/148 (8%)

Query  58   VSDFMKQKGYANLRAMLD-DQKLYNVNPDALD-ECGYTDPTVESQPIPVTNAFISTGYVL  115
            + + +   G  +L+A++  +QKLYN   D +D ECG T     ++     +    TG+  
Sbjct  70   IKEKLSTTGGGSLKALISKNQKLYN---DKVDPECGLTAFKDSARSKLPASQLEFTGFTH  126

Query  116  NGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSWQ  173
             GPCEVW DD KV+ D NC  KYP     + Y  S C G+  L  +W+ +        WQ
Sbjct  127  PGPCEVWCDDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAVH----GEPWQ  182

Query  174  VYKVCVSLRGNGVQSSETPTPIAVASAT  201
            VY  CV L G G   + TP+     ++T
Sbjct  183  VYTDCVYLEG-GSGGAATPSSGGGGAST  209

>PHYRA_93650
Length=231

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 15/118 (13%)

Query  64   QKGYAN-LRAMLD-DQKLYNVNPDALDECGYTDPTVESQPIPVT-NAFISTGYVLNGPCE  120
            + GYAN +R +LD D  LY        +CG++DP  +++  P    A    G   +GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  121  VWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQ-PVNETYSWQVYKV  177
            +WLDD  V+ + +C   +     + DY S  G CM R+YWL  Q   +  Y WQ+YK 
Sbjct  128  IWLDDTMVLHNDDCAKAFS----VEDYMSING-CMFRFYWLAFQGSTSGKYVWQIYKA  180

>PYU1_G005871
Length=284

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 69/143 (48%), Gaps = 27/143 (19%)

Query  64   QKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV-  114
            + GY +L+ M+D          A+  CGY++P     P+ V+        N     G++ 
Sbjct  77   KTGYKSLKQMMDK---------AVPGCGYSNPNA--APVDVSKMSAMKFQNNEYKEGFLG  125

Query  115  -LNGPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
              +GPCE W+D+ +V    +C  K+PG      + Y SCKG+C L +YWL +     +  
Sbjct  126  SHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH----SPK  181

Query  172  WQVYKVCVSLRGNGVQSSETPTP  194
            WQ YK CV+++ N      +  P
Sbjct  182  WQAYKSCVAIKNNAYSEERSSDP  204

>SDRG_15426
Length=523

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 66/137 (48%), Gaps = 27/137 (20%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPV------TNAFISTGYV  114
            F  Q  Y  LR +LD        PD    CG T   V  +PIP        N     G++
Sbjct  40   FAAQSQYKTLRDLLDLS-----GPD----CGNTRTNVAPKPIPSDGMMTWQNPDTGEGFI  90

Query  115  --LNGPCEVWLDDLKVMSDMNCHTKYP---GTNFMLDYSSCK-GSCMLRWYWLGI-QPVN  167
                GPCE+WLD+ +V  + NC T +P        +DY+ C    CMLR+YWL + QP  
Sbjct  91   PSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQP--  148

Query  168  ETYSWQVYKVCVSLRGN  184
                WQVYK CV L+GN
Sbjct  149  ---QWQVYKNCVPLQGN  162

>PYAP_24338
Length=267

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 78/161 (48%), Gaps = 17/161 (11%)

Query  59   SDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGP  118
            ++F K K Y +L+  +   ++     +   ECG+T    E +  P+++    + +   GP
Sbjct  72   ANFPKSK-YESLKDFILGTQIMTPGLNGSPECGFTIKD-EKKRSPISSTVKHSSFFHPGP  129

Query  119  CEVWLDDLKVMSDMNCHTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            CEVW D+ K+   ++C + Y G++  +D S CKG+  L  YW  +        WQ Y  C
Sbjct  130  CEVWCDNTKLAYALDCQSTY-GSSIPIDASKCKGADRLTLYWTAVH----GSPWQNYIYC  184

Query  179  VSLRGNGVQS----------SETPTPIAVASATPTTAEAPG  209
            V L GN   +          S  P P   A+ATPT ++APG
Sbjct  185  VWLEGNKGGAPAAATAPAGLSSAPRPQNPATATPTLSKAPG  225

>PHYCA_12942
Length=353

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 51/101 (50%), Gaps = 12/101 (12%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CGYT      QPIP             G+   GPCE+++DD  V+   NC  ++ G   
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181
            ++  +DYSSC G+CML  YWLG Q       WQ Y  CV L
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAYVNCVPL  179

>PHYKE_7445
Length=369

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 75/156 (48%), Gaps = 12/156 (8%)

Query  56   ADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI---STG  112
            A  +   K   Y  L+A++DD+   +V P A   CG  DP    QP+P    +    S G
Sbjct  64   ASFTKAFKASKYKTLKALIDDKTKISV-PGATLTCGSADPNAAPQPLPAKLEWAHSDSEG  122

Query  113  YVLN--GPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNE  168
            +  +  GPCE W D  +V  D NC   +     ++ Y  S C G+  L ++W+ +     
Sbjct  123  FSPSHEGPCEAWCDTTRVFHDENCAAHFKTAPAVMPYEKSKCSGAKKLIFFWIAMH----  178

Query  169  TYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTT  204
              SWQVY  C +L G+G  +++T      ++ +P+T
Sbjct  179  GPSWQVYVNCATLSGSGGGATQTTPSTPSSNKSPST  214

>PHYCA_14560
Length=300

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 78/170 (46%), Gaps = 23/170 (14%)

Query  59   SDFMKQKGYANLRAMLD------DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTG  112
            +D     GY +LR MLD         L    P  +D  GYT+  +  Q       FI++ 
Sbjct  68   TDHWNATGYKSLREMLDPIAPDYGHSLKTATP--VDVSGYTE--MWWQNDEYKEGFIAS-  122

Query  113  YVLNGPCEVWLDDLKVMSDMNCHTK---YPGTNFMLDYSSCKGSCMLRWYWLGIQPVNET  169
                GPCE W+DD ++    NC  +   YP      DYSSCKG C+  +YWL +   +  
Sbjct  123  --HEGPCEAWIDDTRIFHYDNCAAQFKTYPA-KVPADYSSCKGDCLFVFYWLALHEPD--  177

Query  170  YSWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWG  219
              WQ+YK CV +  NG  +S T +  +  + TP T       K + SD G
Sbjct  178  --WQIYKQCVPITNNGKGTSTTQS--SGENETPETEAPSTTQKGSSSDTG  223

>PYIR_26867
Length=163

 Score = 71.2 bits (173),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 73/157 (46%), Gaps = 22/157 (14%)

Query  28   PEPFYLVDGDEAQ-----SAPVAHLEEQGIKTSAD-------VSDFMKQKGYANLRAMLD  75
            P+  + ++GD  Q     + P       G+  + D        +  +K   Y ++RA++D
Sbjct  4    PKTTFAINGDPTQFCATMNGPTTLTAPSGMSFTTDPASNTKAFTAALKASTYKSVRALVD  63

Query  76   DQKLYNVNPDALDECGYTDPTVESQPIP---VTNAFIST-GYV--LNGPCEVWLDDLKVM  129
             +  +     A  +CG T PT + QP+P   V  A  ST G+     GPCEVW DD    
Sbjct  64   AKGQFISG--ANKQCGVTSPTGDKQPLPAQYVEWAHSSTEGFTPSHQGPCEVWCDDKMAF  121

Query  130  SDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQ  164
            SD NC T YP     L Y  S C G+ ML+ YWL + 
Sbjct  122  SDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLALH  158

>PYIR_20481
Length=277

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 82/164 (50%), Gaps = 30/164 (18%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------NAFISTGYV--L  115
            GY +L+ MLD          ++  CG+T    +  P+ V+        N     G++   
Sbjct  74   GYKSLKEMLDL---------SVPGCGFT--LTDGAPVDVSGLKSMKWQNDQEQKGFIDSH  122

Query  116  NGPCEVWLDDLKVMSDMNC---HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSW  172
            +GPCEVW+D+ K+M   +C   +T YP     +DYS CKG C L +YWL +   N    W
Sbjct  123  HGPCEVWIDNTKIMHSDDCRADYTAYPA-EIPVDYSKCKGKCQLTFYWLALHEPN----W  177

Query  173  QVYKVCVSLR-GNGVQSSETPTPIAVASATPTTAEAPGKGKAAK  215
            Q+YK CV ++ G+G  S+ TP   A A +T    +AP  G   K
Sbjct  178  QIYKQCVPIQNGSGSGSATTPAATAKAPSTGGNTKAPSTGGNTK  221

>PHYRA_77290
Length=309

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 78/172 (45%), Gaps = 34/172 (20%)

Query  60   DFMKQKGYANLRAMLD------DQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGY  113
            D     GY +LR MLD         L   +P  +D  GY +  +  Q       FI++  
Sbjct  71   DHWNATGYKSLRDMLDPIAPGYGHSLETADP--VDVSGYKE--MWWQNDEYKEGFIAS--  124

Query  114  VLNGPCEVWLDDLKVMSDMNCHTK---YPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETY  170
               GPCE W+DD+++    NC  +   YP      D+SSCKG C+  +YWL +   N   
Sbjct  125  -HEGPCEAWVDDVQIFHHDNCAAQFKTYPA-KVPADFSSCKGDCLFVFYWLALHEPN---  179

Query  171  SWQVYKVCVSLRGNGVQSSETPTPIAVASATPTTAEAPGKGKAAKSDWGWLE  222
             WQ+YK CV +  +G             S++PTT  +   G AA +D G  E
Sbjct  180  -WQIYKQCVPITNSG-------------SSSPTTQSSGSGGTAASTDNGASE  217

>PHYKE_2539
Length=258

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 77/159 (48%), Gaps = 19/159 (12%)

Query  66   GYANLRAMLDDQ--KLYNVNPDA--LDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEV  121
            GY++LR MLD Q     N   D   +D  G T  T+  Q       FI + +   GPCEV
Sbjct  67   GYSSLRDMLDQQVTDCANTRTDVSPVDVSGLT--TMNWQNDQEQKGFIDSHH---GPCEV  121

Query  122  WLDDLKVMSDMNCHTKYPG---TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVC  178
            W+DD  V    +C   Y      +   D+S C G C LR+YW+ +   N    WQ+YK C
Sbjct  122  WIDDTLVDHQDDCVATYGSGYPASVNADFSKCSGDCTLRFYWIALHEPN----WQIYKQC  177

Query  179  VSLRGN-GVQSSETPTPIAVASATPTTAEAPGKGKAAKS  216
            V +  N G Q + T TP  +   T T +++  + +A +S
Sbjct  178  VPVVNNSGAQEAGTVTPADM--TTDTASDSGCQNRALRS  214

>PHYCA_15124
Length=294

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 76/153 (50%), Gaps = 16/153 (10%)

Query  61   FMKQK----GYANLRAMLD-DQKLYNVNPDALD-ECGYTDPTVESQPIPVTNAFISTGYV  114
            F+K+K    G  +L+A++  +QKLYN   D +D ECG T     ++     +    TG+ 
Sbjct  69   FIKEKLPTTGGGSLKALISKNQKLYN---DKVDPECGLTAFKDSARSKLPASQLEFTGFT  125

Query  115  LNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSW  172
              GPCEVW DD KV+ D +C  KYP     + Y  S C G+  L  +W+ +        W
Sbjct  126  HPGPCEVWCDDTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAVH----GEPW  181

Query  173  QVYKVCVSLRGNGVQSSETPTPIAVASATPTTA  205
            QVY  CV L G G   + TP+     ++T  T 
Sbjct  182  QVYTDCVYLEG-GSGGAATPSSGGGGASTVNTG  213

>PPTG_10186
Length=270

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 74/157 (47%), Gaps = 31/157 (20%)

Query  66   GYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI--------STGYV--L  115
            GY++LR MLD Q         + +C  T   V   P+ V+   +          G++   
Sbjct  80   GYSSLRDMLDQQ---------VTDCANTRTDVS--PVDVSGLSVMNWQNDQEQKGFIDSH  128

Query  116  NGPCEVWLDDLKVMSDMNC----HTKYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
            +GPCEVW+DD  V    +C     T YP +    D+S C G C LR+YWL +   N    
Sbjct  129  HGPCEVWIDDTMVDHQDDCVAAYGTGYPAS-VKADFSKCSGDCTLRFYWLALHEPN----  183

Query  172  WQVYKVCVSLRGN-GVQSSETPTPIAVASATPTTAEA  207
            WQ+YK CV +  N G+Q+    T +   S T T  E+
Sbjct  184  WQIYKQCVPIVNNSGMQTQVQGTVMPAGSTTETANES  220

>PHYCA_122958
Length=260

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 71/155 (46%), Gaps = 29/155 (19%)

Query  48   EEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNA  107
            ++  +  +A  +      GY++LR MLD Q         + +C  T   V   P+ V+  
Sbjct  59   DDNPVANAATFTSSFPNTGYSSLRNMLDQQ---------VSDCANTKTDVS--PVDVSGL  107

Query  108  FI--------STGYV--LNGPCEVWLDDLKVMSDMNCHTKYPGT---NFMLDYSSCKGSC  154
             +          G++   +GPCEVW+DD  V    +C   Y  +   N   DYS C G C
Sbjct  108  TVMNWQNDQEQKGFIDSHHGPCEVWIDDTMVDHQDDCVATYGSSYPANVKADYSQCSGDC  167

Query  155  MLRWYWLGIQPVNETYSWQVYKVCVSLRGN-GVQS  188
             LR+YWL +   N    WQ+YK CV +  N G QS
Sbjct  168  TLRFYWLALHEPN----WQIYKQCVPIVNNSGTQS  198

>PYU1_G001475
Length=272

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 71/156 (46%), Gaps = 11/156 (7%)

Query  30   PFYLVDGDEAQSAPVAHLEEQGIKTS--ADVSDFMKQKGYANLRAMLDDQKLYNVN-PDA  86
            P   +DG      P       G  T+  A V  F KQ  +  L+ ++ D+ + + N PD 
Sbjct  41   PLGTIDGPTVMPPPAGQSYAMGTDTNIKAYVEAFAKQTKWKTLKDLIMDKYVEDGNIPDR  100

Query  87   LDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFMLD  146
               CG TD T   QP+P        G    GPCEVW DD++V +D +C T YPG N   D
Sbjct  101  --ACGLTDKTY-MQPLPDKYVVWQAGQ-HPGPCEVWCDDVRVFADNDCATNYPGINLPYD  156

Query  147  YSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLR  182
             S C G  +L   +LG+        WQVY  C  + 
Sbjct  157  RSKCVGKKVLWSMFLGMH----VPQWQVYMGCTGIE  188

>PYIW_21964
Length=265

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 18/131 (14%)

Query  62   MKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFI------STGYVL  115
            +K   Y ++RA++DD+ ++    +A  ECG T PT   QP+P  + ++      S G+  
Sbjct  77   LKASTYKSMRALVDDKAVFIK--EANKECGVTSPTGAKQPLP--DKYVEWSHSSSEGFTP  132

Query  116  N--GPCEVWLDDLKVMSDMNCHTKYPG--TNFMLDYSSCKGSCMLRWYWLGIQPVNETYS  171
            +  GPCEVW DD    +D NC   Y        +D++ C G+ +L+  WL +     + +
Sbjct  133  SHQGPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SST  188

Query  172  WQVYKVCVSLR  182
            WQ+Y  C  L 
Sbjct  189  WQIYINCAPLE  199

>PHALS_10635
Length=296

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 12/130 (9%)

Query  61   FMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVTNA-FISTGYVLNGPC  119
              K+ G  N     D + L+  NP   +ECGYTDP       P   A   S G +  G C
Sbjct  59   LFKELGTKN--NFKDLRSLFEGNPIYGEECGYTDPKGPPADRPNDGAATFSRGILHAGTC  116

Query  120  EVWLDDLKVMSDMNCHTKY-PGTNFML------DYSSCK-GSCMLRWYWLGIQPVNETYS  171
            E+W DD  V+ + +C + Y  GT   +      DY  C    CMLR+YWL +Q +++T  
Sbjct  117  EIWFDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRIDKTV-  175

Query  172  WQVYKVCVSL  181
            WQVY+ C+ L
Sbjct  176  WQVYRNCIPL  185

>PHYRA_80631
Length=320

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 70/141 (50%), Gaps = 10/141 (7%)

Query  64   QKGYANLRAML-DDQKLYNVNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVW  122
             KGY +L A +  +Q+LY+   D   +CG T     ++     +    +G+   GPCEVW
Sbjct  76   DKGYDSLGAFIAKNQELYSSKTDP--DCGLTVYKDSARSELPASKLTYSGFTHTGPCEVW  133

Query  123  LDDLKVMSDMNCHTKYPGTNFMLDY--SSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVS  180
             DD KV+ D +C TKYP     + Y  S C  +  L  YW+G+        WQVY  CV 
Sbjct  134  CDDTKVLFDYDCQTKYPAIPATIPYDESKCADANRLTIYWIGLHGD----PWQVYTDCVW  189

Query  181  LRGNGVQSSETPTPIAVASAT  201
            L+G G  S   P+ +   ++T
Sbjct  190  LKG-GSGSGAAPSTVGAGAST  209

>PHYCA_18657
Length=295

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 54/116 (47%), Gaps = 17/116 (15%)

Query  89   ECGYTDPTVESQPIPVTNAFI-----STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            +CG+T   V+ +P+P     +       G+   GPCE+++DD  V+   +C   YPG   
Sbjct  171  KCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPN  230

Query  141  -----TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSET  191
                 +   +DYSSC G C    YWLG Q       WQ Y  CV L G G  +  +
Sbjct  231  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQ----NAQWQAYINCVPLSGTGATTQSS  282

>PHYCA_132255
Length=128

 Score = 69.7 bits (169),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 11/110 (10%)

Query  87   LDECGYTDPTVESQPIPVTNAFI---STGYVLNGPCEVWLDDLKVMSDMNCHTKYPG---  140
            + ECG T      QP+P T+ F+   S G    GPCE+W DD +V  + NC  +Y G   
Sbjct  5    IPECGNTKKNGTPQPLP-TDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVP  63

Query  141  TNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSE  190
            T+  +D  +CK S  L +YWL +Q       WQVY  CV L G+    ++
Sbjct  64   TSLPIDLDTCKSSSELVFYWLSLQGA----PWQVYINCVKLDGSAAAGND  109

>PHALS_06480
Length=159

 Score = 70.5 bits (171),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  25  VLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81
           VLYP PFY+VDG + Q   +A+LEEQGI TS +V  +MK   Y +LRAMLDD  LY 
Sbjct  37  VLYPAPFYVVDGLDFQGMALAYLEEQGINTSIEVQSWMKDHAYNSLRAMLDDDMLYK  93

>PHALS_02044
Length=237

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query  86   ALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML  145
            A +ECG++    + Q +P    + +  Y   GPCEVW DD +V  + NC   Y  T   L
Sbjct  98   ASNECGFSLVDGQPQELPEMVEWDAFSYSHMGPCEVWCDDKRVFQNWNCGVDYTETPAKL  157

Query  146  DY--SSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIA  196
             Y  +SC+G+ +L  YW+ +     T  WQ+Y  C  ++G G   S+  TP A
Sbjct  158  PYDKASCEGAAVLSCYWIAVH----TVPWQIYTNCAPIKGGGAGGSKPSTPAA  206

>PITG_11942
Length=271

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 82/176 (47%), Gaps = 22/176 (13%)

Query  30   PFYLVDGDEAQSAP--VAHLEEQGIKTSADVSDFMKQKGYANLRAML-DDQKLYNVNPDA  86
            P  ++D  +    P  +++  + G  T A  + F   K Y +L+ +  D QKL      A
Sbjct  43   PSGIIDPSDVLPVPSGMSYTTDPGSNTKAYWTAFNASK-YKSLKELSWDSQKLEG---SA  98

Query  87   LDECGYT--DPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGT--N  142
             +ECG++  D T    P  V   F +  +   GPCEVW DD  V  + NC   YP T  N
Sbjct  99   SNECGFSLVDGTPRDLPDEVQWDFFTASH--QGPCEVWCDDTLVFENWNCAVDYPETPAN  156

Query  143  FMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSLRG-----NGVQSSETPT  193
               D + CKG+ ML  YW+ +     T  WQVY  C  L G     N  Q++ TPT
Sbjct  157  LPYDKAKCKGAAMLTSYWIALH----TTPWQVYTNCAPLTGASSSSNTSQTATTPT  208

>PHYRA_78174
Length=279

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 75/161 (47%), Gaps = 20/161 (12%)

Query  54   TSADVSDFMKQKGYANLRAMLDDQKLYNVNPDALDECGYTDPTVESQPIPVT--------  105
            T+A    F   K Y +L+ M+ D      + D   ECGYT+P   +QP+P T        
Sbjct  65   TAAFAKGFEASK-YTSLKEMVSDLGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHGS  122

Query  106  -NAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNFML--DYSSCKGSCMLRWYWLG  162
               F S+     GPCEVW DD++V  D +C   Y      +  D+ +C G+  L +YWL 
Sbjct  123  GEGFTSS---HEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLA  179

Query  163  IQPVNETYSWQVYKVCVSLRGNGVQSSETPTPIAVASATPT  203
            +     + +WQVY  C +L       + +   +  + +TPT
Sbjct  180  LH----SSTWQVYTNCAALEKTTSTGAASKYAVGGSPSTPT  216

Lambda      K        H        a         alpha
   0.316    0.132    0.433    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11375263026

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40