Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G001737147531331337051e-96
PYIR_13452147536451273679e-41
PYIW_1997214753609993343e-36
PHYKE_8391147537781133231e-34
PHYCA_556160147536491173053e-32
PITG_18452147538561173037e-32
PYAP_17761990756221163011e-31
PHALS_0648114753644982815e-29
HYAP_0709514753613762271e-21
SPRG_1410314753628992226e-21
SDRG_1672014753628992191e-20
H310_08590147536401212121e-19
H257_0843614753642952093e-19
PYVX_181701475351028890.004
PYVX_1666417777620670.95
PYAP_15818163146758711.0
PHALS_11551345308159642.3
CCI4897116193317183672.5
PYAP_210069999544749663.7
PYAR_2345313626103346665.3
PHALS_02455180840954656.4
SDRG_1261713454336021647.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001737

Length=133
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001737                                                          276        1e-96
PYIR_13452                                                            145        9e-41
PYIW_19972                                                            133        3e-36
PHYKE_8391                                                            129        1e-34
PHYCA_556160                                                          122        3e-32
PITG_18452                                                            121        7e-32
PYAP_17761                                                            120        1e-31
PHALS_06481                                                           112        5e-29
HYAP_07095                                                            92.0       1e-21
SPRG_14103                                                            90.1       6e-21
SDRG_16720                                                            89.0       1e-20
H310_08590                                                            86.3       1e-19
H257_08436                                                            85.1       3e-19
PYVX_18170                                                            38.9       0.004
PYVX_16664                                                            30.4       0.95 
PYAP_15818                                                            32.0       1.0  
PHALS_11551                                                           29.3       2.3  
CCI48971                                                              30.4       2.5  
PYAP_21006                                                            30.0       3.7  
PYAR_23453                                                            30.0       5.3  
PHALS_02455                                                           29.6       6.4  
SDRG_12617                                                            29.3       7.7  

>PYU1_G001737
Length=133

 Score = 276 bits (705),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/133 (100%), Positives = 133/133 (100%), Gaps = 0/133 (0%)

Query  1    MAAARSPEHVGRKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQ  60
            MAAARSPEHVGRKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQ
Sbjct  1    MAAARSPEHVGRKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQ  60

Query  61   VLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVGG  120
            VLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVGG
Sbjct  61   VLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVGG  120

Query  121  CDALLATIRGSIS  133
            CDALLATIRGSIS
Sbjct  121  CDALLATIRGSIS  133

>PYIR_13452
Length=645

 Score = 145 bits (367),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 4/127 (3%)

Query  11   GRKRHASN--LMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQ  68
            GRKR A +  LM   N+++TLV  G  T YH+AGWRGC F++KA DV +AM+VLYPD + 
Sbjct  13   GRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72

Query  69   FTVHEFADRDAFRAWLDVSK--DDFATHFGATSPALTHTSSPFVWSNAGEFVGGCDALLA  126
            F +HEF DR+AFR WL  S   ++    FGA S ALTH SSPFVW+N   F+GGCD  LA
Sbjct  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANTRGFIGGCDDTLA  132

Query  127  TIRGSIS  133
              R  +S
Sbjct  133  LFRSGVS  139

>PYIW_19972
Length=609

 Score = 133 bits (334),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 2/99 (2%)

Query  11   GRKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFT  70
            G KR A+  MA+VN+++TLVR G   TYHIAGWRGC F++KA DV  AM+VLYPD +   
Sbjct  8    GTKREAT--MATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCE  65

Query  71   VHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPF  109
            +HEF DR+AFRAWL  S  DFA +FGA S A THTSSPF
Sbjct  66   IHEFPDREAFRAWLSASAADFAANFGADSKAATHTSSPF  104

>PHYKE_8391
Length=778

 Score = 129 bits (323),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 3/113 (3%)

Query  24   NLQDTLVRAG--SGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFR  81
            NL +TL  A   S TT+HI+GWR C  F KA +V +AMQ+LYPD + F  H F DRDAF+
Sbjct  136  NLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDAFK  195

Query  82   AWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSIS  133
             WL  SKD F  HFGA S A+TH +SPFVW SN  +FVGGCD LLA  R  ++
Sbjct  196  QWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVA  248

>PHYCA_556160
Length=649

 Score = 122 bits (305),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 4/117 (3%)

Query  20   MAS-VNLQDTLVRA--GSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFAD  76
            MAS V L +TLV +   S  T+HIAGW+ C  F KA +V +AMQ+LYPD + F +H F D
Sbjct  1    MASGVRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFED  60

Query  77   RDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSI  132
            R+AF+ WL  S+D+FAT FG  S A  H +SPFVW SN   FVGGCD LL   R  +
Sbjct  61   REAFKHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGV  117

>PITG_18452
Length=856

 Score = 121 bits (303),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (67%), Gaps = 3/117 (3%)

Query  19   LMASVNLQDTLVRAGSGT--TYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFAD  76
            + + VNL DTL  A S +  T++IAGW+ C+ F KA +V +AMQ+LYPD + F  H F D
Sbjct  1    MASGVNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFED  60

Query  77   RDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVGGCDALLATIRGSIS  133
            R+AF+ WL  S+DD   HFGA S A  H +SPFVWS+   FVGGCD LLA  R  I+
Sbjct  61   RNAFKQWLSASQDDITAHFGADSRATKHVTSPFVWSST-IFVGGCDELLAFFRSGIA  116

>PYAP_17761
Length=622

 Score = 120 bits (301),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 75/116 (65%), Gaps = 2/116 (2%)

Query  20   MASVNLQDTLVRAGSGT--TYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADR  77
            MA V+   ++V   SG   TY++AGW  C +++KA DV  AMQ+LY D +     EF  R
Sbjct  1    MAPVDFPQSVVPPASGAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESR  60

Query  78   DAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVGGCDALLATIRGSIS  133
            DAF+AWL  S   FA  FG  SPALTHTSSPFVWSNA  F+GGCDA LA  R  ++
Sbjct  61   DAFKAWLAESNAAFAQAFGTDSPALTHTSSPFVWSNARGFIGGCDATLAHFRSGVA  116

>PHALS_06481
Length=644

 Score = 112 bits (281),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 51/98 (52%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query  37   TYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFG  96
            T+++AGW+ C  F KA ++ +AMQ+LYPD L F +  F DR+ FR WL  S+ DFA  FG
Sbjct  31   TFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFG  90

Query  97   ATSPALTHTSSPFVW-SNAGEFVGGCDALLATIRGSIS  133
            A S A+ H +SPFVW SN   FVGGCD LL   R  I+
Sbjct  91   AKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIA  128

>HYAP_07095
Length=613

 Score = 92.0 bits (227),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 48/76 (63%), Gaps = 1/76 (1%)

Query  59   MQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW-SNAGEF  117
            M V+YP  + F  H F DRDAF+ WL  S +DF T FG  S A TH +SPFVW SN   F
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  118  VGGCDALLATIRGSIS  133
            VGGCD LLA  R  I+
Sbjct  61   VGGCDDLLAVFRSGIA  76

>SPRG_14103
Length=628

 Score = 90.1 bits (222),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (61%), Gaps = 3/99 (3%)

Query  34   SGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFAT  93
            S   YH+ GW+ C ++++A +V S+MQ L+P  ++ T+HE A + +F  WL+ S+  FAT
Sbjct  24   SSVNYHVVGWKSCPYYERAANVASSMQTLFPGQVKATIHEHATKQSFNDWLEASQATFAT  83

Query  94   HFGATSPALTHTSSPFVWSNAG---EFVGGCDALLATIR  129
             F   + A  H +SPF +   G   +FVGGCD  LA  R
Sbjct  84   QFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFR  122

>SDRG_16720
Length=628

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 59/99 (60%), Gaps = 3/99 (3%)

Query  34   SGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFAT  93
            S   YH+ GW+ C ++++A +V  +MQ L+P  ++ T+HE A + +F  WL+ S+  FAT
Sbjct  24   SSVNYHVVGWKSCPYYERAANVAVSMQTLFPGQVKATIHEHATKQSFNDWLETSQSTFAT  83

Query  94   HFGATSPALTHTSSPFVWSNAG---EFVGGCDALLATIR  129
             F   + A  H +SPF +   G   +FVGGCD  LA  R
Sbjct  84   QFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLAFFR  122

>H310_08590
Length=640

 Score = 86.3 bits (212),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query  12   RKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTV  71
            R+R  S++  S  L+    +  S   YH+ GW+ C ++ KA  V S+MQ L+P  ++ T+
Sbjct  12   RRRVTSSVWTSPPLRRQSSKM-STINYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATI  70

Query  72   HEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVW---SNAGEFVGGCDALLATI  128
            HE  ++++F  WL+ S+ +FA  F   +  L H SSPF +    +  +FVGGCD  LA  
Sbjct  71   HEHPNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFF  130

Query  129  R  129
            R
Sbjct  131  R  131

>H257_08436
Length=642

 Score = 85.1 bits (209),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 3/95 (3%)

Query  38   YHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGA  97
            YH+ GW+ C ++ KA  V S+MQ L+P  ++ T+HE  ++++F  WL+ S+ +FA  F  
Sbjct  41   YHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFDN  100

Query  98   TSPALTHTSSPFVW---SNAGEFVGGCDALLATIR  129
             +  L H SSPF +    +  +FVGGCD  LA  R
Sbjct  101  DARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFR  135

>PYVX_18170
Length=510

 Score = 38.9 bits (89),  Expect = 0.004, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 19/28 (68%), Gaps = 1/28 (4%)

Query  106  SSPFVW-SNAGEFVGGCDALLATIRGSI  132
            SSPFVW SN   FVGGCDALL   R  +
Sbjct  2    SSPFVWTSNPTAFVGGCDALLDRFRSQV  29

>PYVX_16664
Length=76

 Score = 30.4 bits (67),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  55  VGSAMQVLYPDHLQFTVHEF  74
           V SA+Q+L P+ LQF  HEF
Sbjct  20  VASAVQLLAPNSLQFNEHEF  39

>PYAP_15818
Length=467

 Score = 32.0 bits (71),  Expect = 1.0, Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query  5    RSPEHVGRKRHASNLMAS-VNLQDTLVRAGSG--TTYHIAGWRGCSFFQKACDVGSAM  59
            R+ E VG+  H     +  ++L +T +R   G  + Y+++GWR     + A D+G A+
Sbjct  78   RAAEWVGKNMHERIYQSGFISLFETTIRNMGGLLSAYYLSGWRQQQLLEAAKDLGEAL  135

>PHALS_11551
Length=81

 Score = 29.3 bits (64),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  27  DTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEFADRDAFRAWLD  85
           D  +RA +G T  + G  G S  Q  C  GSA+ + +P ++   +  F D       L+
Sbjct  19  DCKLRAKNGLTLRLKG--GVSLPQTHCTSGSAIPLTWPPNIAVKLVGFKDLTELNITLE  75

>CCI48971
Length=171

 Score = 30.4 bits (67),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 37/83 (45%), Gaps = 8/83 (10%)

Query  21   ASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFTVHEF------  74
            + V+L   ++R  S  ++HI   + C       ++ S  +   PD L+ + +EF      
Sbjct  55   SKVHLFHRMLR--SAQSFHITYAQYCEVKMDILNLWSRKEKTQPDRLRISRNEFNIIRLI  112

Query  75   ADRDAFRAWLDVSKDDFATHFGA  97
            A    FRAW   SKD  + +F  
Sbjct  113  ASLAEFRAWTSCSKDHPSKYFAV  135

>PYAP_21006
Length=447

 Score = 30.0 bits (66),  Expect = 3.7, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query  60   QVLYPDHLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSP  108
             VL+ +  ++TVH+F + D   A  DV+    ++H+ A  P L    +P
Sbjct  249  HVLFIELFKYTVHQFCEHDHTAASSDVTTASTSSHY-APRPTLHQAPAP  296

>PYAR_23453
Length=1033

 Score = 30.0 bits (66),  Expect = 5.3, Method: Composition-based stats.
 Identities = 16/46 (35%), Positives = 21/46 (46%), Gaps = 1/46 (2%)

Query  73   EFADRDAFRAWLDVSKDDFATHFG-ATSPALTHTSSPFVWSNAGEF  117
            EF +RDAFR W   S+D    ++  A  P     + P   S  G F
Sbjct  657  EFQERDAFRQWWLCSRDSLPPNYDVAPQPCSVLVAQPNAPSVGGRF  702

>PHALS_02455
Length=409

 Score = 29.6 bits (65),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 23/54 (43%), Gaps = 0/54 (0%)

Query  66   HLQFTVHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPFVWSNAGEFVG  119
            H   TVH  A +   +  LD S +D   H    S +     +P++    G FVG
Sbjct  309  HTTPTVHNTAQQIGGKKGLDTSDNDTVQHINTQSESSGPDGTPYIVLAVGGFVG  362

>SDRG_12617
Length=360

 Score = 29.3 bits (64),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)

Query  106  SSPFVWSNAGEFVGGCDALLA  126
            S+PF  ++ G+F GG DALLA
Sbjct  259  SNPFFMADVGQFPGGRDALLA  279

Lambda      K        H        a         alpha
   0.322    0.132    0.419    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3419512173

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40