Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G001736147551231236441e-87
PYIW_19970147551301194454e-57
PHYCA_11834147551341264142e-52
PYIR_13454147551291224099e-52
PYAP_17747147551341254091e-51
PHYRA_95903147551341264054e-51
PITG_18455147551321233779e-47
PHYSO_321155147551361253743e-46
PHALS_06479147551361253743e-46
PPTG_17126147551361253725e-46
PHYKE_8392147551381273657e-45
HYAP_07103147551641563512e-42
PYVX_18180147551351263441e-41
CCA17542147551201193315e-40
SPRG_06335147551231213263e-39
SDRG_01782147551231193186e-38
CCI44820147551231213186e-38
H257_06293147551231193003e-35
H310_09224147551231192812e-32
PHYKE_584111147121541048e-06
HYAP_0849911147108561003e-05
HYAP_085006526017256997e-05
PHALS_115641114710756907e-04
PITG_137391114710556880.001
PHYSO_3150171114710956880.002
CCI442321114710554870.002
PPTG_092521114710556850.004
PHYRA_816751114710656830.006
PHYCA_5353801114710856820.009
PYAP_228461114710495800.016
PYVX_208541114710454780.032
H257_07358111479849760.053
H310_07567111479849760.054
PYAR_232071114711254750.11
PYU1_G0059631114710351730.19
CCA175211114710492710.30
SDRG_149121114710562710.30
SPRG_128831114710562710.31
PYAR_1763516972467730.39
PYAR_168629836821855710.62
PYIW_147431114710550680.93
PHALS_00343295789261671.2
PYIR_151861114710950671.2
PHYSO_5520776079048274691.5
PITG_177011416310449661.6
PPTG_156551416311249661.6
PHYSO_5143231416310449661.7
PYVX_18358141636249641.8
PYIW_205171561313452662.1
PPTG_093281122141741672.8
CCA270641416310072643.0
CCI46195788359071663.4
H310_1387014811107105663.6
PHYCA_5404611416310449633.9
PITG_07828652855242663.9
PYIR_193561122112829644.0
PHYRA_751931416310449634.6
PHALS_00032318065569655.5
PYU1_G005344478258435646.3
H257_0762914145637642647.0
PHYKE_82251468729433637.5
PHYSO_5138911561312946618.8
H257_020613263530639.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001736

Length=123
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001736                                                          252        1e-87
PYIW_19970                                                            176        4e-57
PHYCA_11834                                                           164        2e-52
PYIR_13454                                                            162        9e-52
PYAP_17747                                                            162        1e-51
PHYRA_95903                                                           160        4e-51
PITG_18455                                                            149        9e-47
PHYSO_321155                                                          148        3e-46
PHALS_06479                                                           148        3e-46
PPTG_17126                                                            147        5e-46
PHYKE_8392                                                            145        7e-45
HYAP_07103                                                            139        2e-42
PYVX_18180                                                            137        1e-41
CCA17542                                                              132        5e-40
SPRG_06335                                                            130        3e-39
SDRG_01782                                                            127        6e-38
CCI44820                                                              127        6e-38
H257_06293                                                            120        3e-35
H310_09224                                                            112        2e-32
PHYKE_5841                                                            44.7       8e-06
HYAP_08499                                                            43.1       3e-05
HYAP_08500                                                            42.7       7e-05
PHALS_11564                                                           39.3       7e-04
PITG_13739                                                            38.5       0.001
PHYSO_315017                                                          38.5       0.002
CCI44232                                                              38.1       0.002
PPTG_09252                                                            37.4       0.004
PHYRA_81675                                                           36.6       0.006
PHYCA_535380                                                          36.2       0.009
PYAP_22846                                                            35.4       0.016
PYVX_20854                                                            34.7       0.032
H257_07358                                                            33.9       0.053
H310_07567                                                            33.9       0.054
PYAR_23207                                                            33.5       0.11 
PYU1_G005963                                                          32.7       0.19 
CCA17521                                                              32.0       0.30 
SDRG_14912                                                            32.0       0.30 
SPRG_12883                                                            32.0       0.31 
PYAR_17635                                                            32.7       0.39 
PYAR_16862                                                            32.0       0.62 
PYIW_14743                                                            30.8       0.93 
PHALS_00343                                                           30.4       1.2  
PYIR_15186                                                            30.4       1.2  
PHYSO_552077                                                          31.2       1.5  
PITG_17701                                                            30.0       1.6  
PPTG_15655                                                            30.0       1.6  
PHYSO_514323                                                          30.0       1.7  
PYVX_18358                                                            29.3       1.8  
PYIW_20517                                                            30.0       2.1  
PPTG_09328                                                            30.4       2.8  
CCA27064                                                              29.3       3.0  
CCI46195                                                              30.0       3.4  
H310_13870                                                            30.0       3.6  
PHYCA_540461                                                          28.9       3.9  
PITG_07828                                                            30.0       3.9  
PYIR_19356                                                            29.3       4.0  
PHYRA_75193                                                           28.9       4.6  
PHALS_00032                                                           29.6       5.5  
PYU1_G005344                                                          29.3       6.3  
H257_07629                                                            29.3       7.0  
PHYKE_8225                                                            28.9       7.5  
PHYSO_513891                                                          28.1       8.8  
H257_02061                                                            28.9       9.7  

>PYU1_G001736
Length=123

 Score = 252 bits (644),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)

Query  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60
            MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG
Sbjct  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60

Query  61   YLKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFM  120
            YLKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFM
Sbjct  61   YLKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFM  120

Query  121  DRK  123
            DRK
Sbjct  121  DRK  123

>PYIW_19970
Length=130

 Score = 176 bits (445),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 97/119 (82%), Gaps = 0/119 (0%)

Query  5    DLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
            DLRP+YKKLL+LA+TLP  KR+TT +QIR EFR+     DPKE+ ALLARAQSSI YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  65   VTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123
            VTPR +SDAGVKNY+Y  G+RVEAA   EDGA+Y+  DYN QM RH +LLRRQHFMDRK
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PHYCA_11834
Length=134

 Score = 164 bits (414),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 3/126 (2%)

Query  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60
            MA+ +LRP+YKKLL+LAQ+LP  KRQT+++QIRREFR+H    DPKE++ LL RAQSS+G
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLG  60

Query  61   YLKIVTPRATSDAGVKNYVYIKGKRV---EAAGAAEDGARYKTADYNAQMQRHVQLLRRQ  117
            YLKIVTPRA S+ GV+ ++Y  GKRV   E  G  E+ AR+KT D  A ++RH QLLRRQ
Sbjct  61   YLKIVTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQ  120

Query  118  HFMDRK  123
            +FMDRK
Sbjct  121  YFMDRK  126

>PYIR_13454
Length=129

 Score = 162 bits (409),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 97/122 (80%), Gaps = 0/122 (0%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A  DLRP+YKKLLKLA+TLP  KR  T+ QIR EFRT     DPKE+ ALLARAQSSIGY
Sbjct  8    ALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGY  67

Query  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMD  121
            LKIVTPR +SDAGVKNY+Y  G+RVEA    EDGA+Y   DYNAQMQRH +LLRRQHFMD
Sbjct  68   LKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127

Query  122  RK  123
            RK
Sbjct  128  RK  129

>PYAP_17747
Length=134

 Score = 162 bits (409),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 103/125 (82%), Gaps = 3/125 (2%)

Query  1    MASSDLRPMYKKLLKLAQTLPAD-KRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59
            MA+S+LRP+YK+LL+LA++LP + KR+ T++QIR EFR+     DPKE+AAL+ RAQ+ I
Sbjct  1    MATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKI  60

Query  60   GYLKIVTPRATSDAGVKNYVYIKGKRVEAAGAA--EDGARYKTADYNAQMQRHVQLLRRQ  117
            GYLKIVTPR+T+DAGVK++VY+ GKRV+++     E+GARYKT D+   M+RH QLLRRQ
Sbjct  61   GYLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQ  120

Query  118  HFMDR  122
            HFMDR
Sbjct  121  HFMDR  125

>PHYRA_95903
Length=134

 Score = 160 bits (405),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (77%), Gaps = 3/126 (2%)

Query  1    MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60
            MA+ +LRP+YKKLL+LAQ+LP  KRQ +++QIRREFR+H    DPKE++AL+ RAQSS+G
Sbjct  1    MAARELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLG  60

Query  61   YLKIVTPRATSDAGVKNYVYIKGKRV---EAAGAAEDGARYKTADYNAQMQRHVQLLRRQ  117
            YLKIVTPRA S+ G++ Y+Y  G+RV   E     E+ ARYKT D    ++RH QLLRRQ
Sbjct  61   YLKIVTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQ  120

Query  118  HFMDRK  123
            HFMDRK
Sbjct  121  HFMDRK  126

>PITG_18455
Length=132

 Score = 149 bits (377),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 3/123 (2%)

Query  4    SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLK  63
            S+LRP+YKKLL+LAQ+LP  KRQ++++QIRR+FR+H    DPKE++AL+ RAQSS+ YLK
Sbjct  2    SELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLK  61

Query  64   IVTPRATSDAGVKNYVYIKGKRVEAAGAAEDG---ARYKTADYNAQMQRHVQLLRRQHFM  120
            IVTPRA S+ GV+ Y+Y  G+RV AA   E G   AR+K  D    ++RH QLL+RQ+FM
Sbjct  62   IVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFM  121

Query  121  DRK  123
            +RK
Sbjct  122  NRK  124

>PHYSO_321155
Length=136

 Score = 148 bits (374),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A+ +LRP+YKKLL+LAQ+LP  KR+ +++QIRREFR+H    DP+ ++AL+ RAQSS+ Y
Sbjct  4    AARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSY  63

Query  62   LKIVTPRATSDAGVKNYVYIKGKRVEAA---GAAEDGARYKTADYNAQMQRHVQLLRRQH  118
            LKIVTPR  S+ GV+ ++Y  G+RV AA      E+ ARYKT D  A ++RH QLLRRQ+
Sbjct  64   LKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQY  123

Query  119  FMDRK  123
            FMDRK
Sbjct  124  FMDRK  128

>PHALS_06479
Length=136

 Score = 148 bits (374),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 3/125 (2%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A+ +LRP+YKKLL+LAQ LP  KRQ++++QIRREFR H    DPKE++  + RAQSS+ Y
Sbjct  4    ATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSY  63

Query  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDG---ARYKTADYNAQMQRHVQLLRRQH  118
            LKI+TPR  S+ GV+ ++Y  G+RV AA   + G   AR+KT D  A  +RH QLLRRQ+
Sbjct  64   LKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQY  123

Query  119  FMDRK  123
            FMDRK
Sbjct  124  FMDRK  128

>PPTG_17126
Length=136

 Score = 147 bits (372),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 3/125 (2%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A  +LRP+YKKLL+LAQ+LP  KRQ++++QIRR+FR H    DP+E++AL+ RAQSS+ Y
Sbjct  4    AMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSY  63

Query  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDG---ARYKTADYNAQMQRHVQLLRRQH  118
            LKIVTPRA S+ GV+ Y+Y  G+RV A    E G   AR+KT D    ++RH QLLRRQ+
Sbjct  64   LKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQY  123

Query  119  FMDRK  123
            F+DRK
Sbjct  124  FLDRK  128

>PHYKE_8392
Length=138

 Score = 145 bits (365),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 91/127 (72%), Gaps = 5/127 (4%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A+ +LRP+YKKLL++AQ LP  KR  ++ QIRREFR H    DPKE++ LL  AQSS+ Y
Sbjct  4    AARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSY  63

Query  62   LKIVTPR--ATSDAGVKNYVYIKGKRVEAAGAAEDG---ARYKTADYNAQMQRHVQLLRR  116
            LKIVTPR    S++GV+ Y+Y  G+RV AA   E G   ARYKT D  A ++RH QL+RR
Sbjct  64   LKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRR  123

Query  117  QHFMDRK  123
            QHFMDRK
Sbjct  124  QHFMDRK  130

>HYAP_07103
Length=164

 Score = 139 bits (351),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 94/156 (60%), Gaps = 38/156 (24%)

Query  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65
            +RP+YKKLL+LAQ+LP  KRQ +++QIRREFR H    DPKE+++LL RAQSSI +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  66   TPRAT-----------------------------------SDAGVKNYVYIKGKRVEAA-  89
            TPRA                                    SD G++ +VY  GKR++AA 
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  90   --GAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123
                 E+ ARYKT D  A M+RH QLLRRQHFMDRK
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156

>PYVX_18180
Length=135

 Score = 137 bits (344),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 92/126 (73%), Gaps = 4/126 (3%)

Query  1    MAS-SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59
            MAS ++LRP+YKKLL+LAQ+LP  KR +TV QIR EFR+H    D  E+A LL RAQS +
Sbjct  1    MASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQL  60

Query  60   GYLKIVTPRATSDAGVKNYVYIKGKRV---EAAGAAEDGARYKTADYNAQMQRHVQLLRR  116
            GYLKIVTPR  S +GVK Y+Y  G+RV    A  A EDGARYKT D    ++RH QLLRR
Sbjct  61   GYLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRR  120

Query  117  QHFMDR  122
            QHFMDR
Sbjct  121  QHFMDR  126

>CCA17542
Length=120

 Score = 132 bits (331),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 0/119 (0%)

Query  4    SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLK  63
            SD R +YK+L++LA++LPA+K+  T+  IR EFR H    DP +++ LL RAQS+IGYLK
Sbjct  2    SDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLK  61

Query  64   IVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDR  122
            IVTP   SD+GVK +++  G+R+E    A + AR+K  D    ++RH QLLRRQHFMDR
Sbjct  62   IVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>SPRG_06335
Length=123

 Score = 130 bits (326),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 85/121 (70%), Gaps = 1/121 (1%)

Query  4    SDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLK  63
            + +R  YKKLLKLA+++P ++R  T+E++R EFR H G   P+E+  LL +AQS I YLK
Sbjct  3    TTIRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLK  62

Query  64   IVTPRATSDAGVKN-YVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDR  122
            IVTP+ +   G  N +VY  G+R++    + D A  KTADYNA M +HVQL+RRQHFMDR
Sbjct  63   IVTPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDR  122

Query  123  K  123
            K
Sbjct  123  K  123

>SDRG_01782
Length=123

 Score = 127 bits (318),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 1/119 (1%)

Query  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65
            +R  YKKLLKLA+++P ++R  T+E++R EFR H G   P+E+  LL +AQS I YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  66   TPRATSDAGV-KNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123
            TP+ +S +    ++VY  G+R++    + D A  KT DYNA M +HVQL+RRQHFMDRK
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123

>CCI44820
Length=123

 Score = 127 bits (318),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 88/121 (73%), Gaps = 0/121 (0%)

Query  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61
            A ++ R ++KK++KLA++LP +K+  T+  IR EFR H   +DP ++A LL RAQS+IGY
Sbjct  3    AVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGY  62

Query  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMD  121
            LKIVTP   SD+GVK++VY  G+R+E +  A + A++K  D    ++RH QL+RRQ+FMD
Sbjct  63   LKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMD  122

Query  122  R  122
            R
Sbjct  123  R  123

>H257_06293
Length=123

 Score = 120 bits (300),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 84/119 (71%), Gaps = 1/119 (1%)

Query  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65
            +R  YKKL+KLAQ+LPAD++ T +++IR +FR+       +E+  L+ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  66   TPRATSDAGVKNYVYIKGKRVEAAGAAEDGAR-YKTADYNAQMQRHVQLLRRQHFMDRK  123
            TP+ T  +G + ++Y  GKR+++    + G R  KT D NA M+RHV+L+RRQHFMDRK
Sbjct  65   TPKRTPQSGPQRFIYKDGKRLDSQSLDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123

>H310_09224
Length=123

 Score = 112 bits (281),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 79/119 (66%), Gaps = 1/119 (1%)

Query  6    LRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIV  65
            +R  YKKL+KLAQ+LPA+++   ++++R EFR+H       ++  ++ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  66   TPRATSDAGVKNYVYIKGKRVEAAGAAED-GARYKTADYNAQMQRHVQLLRRQHFMDRK  123
            TP+       + Y+Y  GKR++     +   A  KT D+NA M+RHV+L+RRQHFMDRK
Sbjct  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123

>PHYKE_5841
Length=121

 Score = 44.7 bits (104),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62
           MY+++LKLAQ  P+ KR + +  I+ EF  H G  D ++I   LA A++ I  L
Sbjct  10  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>HYAP_08499
Length=108

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           MY+++LKLAQ  P+ KRQ+ +  I+ EFR +    D +++   LA  Q+ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>HYAP_08500
Length=172

 Score = 42.7 bits (99),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  9    MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
            MY+++LKLAQ  P+ KRQ+ +  I+ EFR +    D +++   LA  Q+ I  L +
Sbjct  74   MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PHALS_11564
Length=107

 Score = 39.3 bits (90),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           +Y++LLKLAQ  P+ KR+  +  I+ EF  +    D ++I   +A A + I  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PITG_13739
Length=105

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           MY+++LKLAQ  P+ KR++ +  I+ EF  +    D ++I   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSM  65

>PHYSO_315017
Length=109

 Score = 38.5 bits (88),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           MY+++LKLAQ  P+ KR++ +  I+ EF  +    D ++I   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELSM  65

>CCI44232
Length=105

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62
           +Y+++L+LA+  P+ KR   VE IR EFR       P  I   +A A + I  L
Sbjct  9   LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIASANAGIKEL  62

>PPTG_09252
Length=105

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           +Y+++LKLAQ  P+ KR++ +  I+ EF  +    D ++I   LA  ++ I  L +
Sbjct  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65

>PHYRA_81675
Length=106

 Score = 36.6 bits (83),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           MY+++LKLAQ  P+ KR + +  I+ EF  +    D ++I   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELSM  65

>PHYCA_535380
Length=108

 Score = 36.2 bits (82),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI  64
           MY+++LKLA   P+ KR++ +  I+ EF  +    D + I   LA  ++ I  L +
Sbjct  10  MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKELSM  65

>PYAP_22846
Length=104

 Score = 35.4 bits (80),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 18/95 (19%)

Query  9    MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKI----  64
            +Y+ +LKLA+  P+ KR   ++ I+ EF       D + I   +A AQ+ I  L +    
Sbjct  10   LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSMYATL  69

Query  65   --------------VTPRATSDAGVKNYVYIKGKR  85
                          V+P AT  AG  N   +  K+
Sbjct  70   NPSSTAWTVGVGREVSPEATQAAGDTNTKVVGNKQ  104

>PYVX_20854
Length=104

 Score = 34.7 bits (78),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62
           +Y+++LKLAQ  P+ KR + V  I+ EF  +    D +++   +  A++ I  L
Sbjct  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>H257_07358
Length=98

 Score = 33.9 bits (76),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  1   MASSDLRP-MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEI  48
           M+SS   P +Y+++L+LA   P+ K++  V+ I+ EF  +    DP +I
Sbjct  1   MSSSPTVPQIYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKI  49

>H310_07567
Length=98

 Score = 33.9 bits (76),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query  1   MASSDLRP-MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEI  48
           M++S   P +Y+++L+LA+  P+ KR   VE I+ EF  +    DP +I
Sbjct  1   MSASPTVPQIYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDPVKI  49

>PYAR_23207
Length=112

 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYL  62
           +Y+++L+LA+  P+ KR   VE I+ EF       D   I   +A AQ+ I  L
Sbjct  13  LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PYU1_G005963
Length=103

 Score = 32.7 bits (73),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59
           +Y+++LKLA   P+ KR   +  I+ EFR +    D   I A +  A+  I
Sbjct  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>CCA17521
Length=104

 Score = 32.0 bits (71),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 14/92 (15%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI------GYL  62
           +Y+++L+LA+  P+ KR   +  IR EFR          I   +A A + I        L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKELLMYANL  68

Query  63  KIVTPRATSDAG--------VKNYVYIKGKRV  86
             V P  T + G        +   V IK KRV
Sbjct  69  NPVDPNWTVEIGRPSEKPADMDRDVKIKAKRV  100

>SDRG_14912
Length=105

 Score = 32.0 bits (71),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 0/62 (0%)

Query  1   MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60
           MA   +  +Y+++LKLAQ  P+ K+   V  I+ EF  +    D  +I   +A A   I 
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  61  YL  62
            L
Sbjct  61  QL  62

>SPRG_12883
Length=105

 Score = 32.0 bits (71),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 0/62 (0%)

Query  1   MASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIG  60
           MA   +  +Y+++LKLAQ  P+ K+   V  I+ EF  +    D  +I   +A A   I 
Sbjct  1   MAGRSVPQIYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIE  60

Query  61  YL  62
            L
Sbjct  61  QL  62

>PYAR_17635
Length=724

 Score = 32.7 bits (73),  Expect = 0.39, Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query  29   VEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTPRATSDAGVKNYVYIKGKRVEA  88
            +E+++RE  + N  KDP+         Q+  G +K        ++G+ +Y++   K+ + 
Sbjct  540  MEKLQRESLSSNDVKDPRRTGG-----QAPQGIVKPAVHEDKQESGLMSYIFPGSKKGKT  594

Query  89   AGAAEDG  95
            +G+A DG
Sbjct  595  SGSAADG  601

>PYAR_16862
Length=218

 Score = 32.0 bits (71),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 28/55 (51%), Gaps = 3/55 (5%)

Query  69   ATSDAGVKNYVYIKGKRVEAAGAAEDGARYKT---ADYNAQMQRHVQLLRRQHFM  120
            + S   ++    IK   V+ AG + DGA  +    A  NA+M R + L RR HF+
Sbjct  91   SISQGCIQRCFDIKSVNVQTAGGSADGATAEVSLLAPKNAEMIRDLILQRRDHFV  145

>PYIW_14743
Length=105

 Score = 30.8 bits (68),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSS  58
           +Y+++LKLA   P+ KR   + +I+ EF  +    D    A +L + QS+
Sbjct  10  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDS---AKILDKVQSA  56

>PHALS_00343
Length=92

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 28/61 (46%), Gaps = 1/61 (2%)

Query  9   MYKKLLKLAQTLPADK-RQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTP  67
           M   L++ A  +  D  RQ ++    + F  H   +  KEI   L   Q ++G+L   TP
Sbjct  25  MNSWLVECACCVLKDAGRQESLMSNNKGFGCHLYVQGTKEICTELTLVQCNVGFLATPTP  84

Query  68  R  68
           R
Sbjct  85  R  85

>PYIR_15186
Length=109

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query  9   MYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSS  58
           +Y+++LKLA   P+ KR   + +I+ EF  +    D    A +L + QS+
Sbjct  10  VYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTDN---AKILDKVQSA  56

>PHYSO_552077
Length=482

 Score = 31.2 bits (69),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 31/74 (42%), Gaps = 9/74 (12%)

Query  29   VEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTPRATSDAGVKNYVYIKGKRVEA  88
            VE I R   T  G     E   L  ++ + +  L  V         VK  ++ + K V  
Sbjct  66   VEYIERNMDTSPGFTQQMECIILACQSNAPVKVLNSV---------VKQNLWFRRKCVGD  116

Query  89   AGAAEDGARYKTAD  102
             GAAE GA  KTAD
Sbjct  117  KGAAEQGASKKTAD  130

>PITG_17701
Length=104

 Score = 30.0 bits (66),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTLPAD--KRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  L+LA+ +  +  K Q   E +RREF       DP++I AL A A
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIRELVRREFDKGRSETDPEKIEALKANA  62

>PPTG_15655
Length=112

 Score = 30.0 bits (66),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTLPAD--KRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  L+LA+ +  +  K Q   E +RREF       DP++I AL A A
Sbjct  22  LYRDCLRLAKHIGGNSKKGQAIKELVRREFDKGRSETDPEKIEALKANA  70

>PHYSO_514323
Length=104

 Score = 30.0 bits (66),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTLPAD--KRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  ++LA+ +  +  K Q   E +RREF       DP++I AL A A
Sbjct  14  LYRDCMRLAKHIGGNSKKGQAIKELVRREFEKGRSETDPEKIEALKANA  62

>PYVX_18358
Length=62

 Score = 29.3 bits (64),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTL--PADKRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  L+LA+ +   + K +   E +RREF       DP++I AL A A
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANA  49

>PYIW_20517
Length=134

 Score = 30.0 bits (66),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  9   MYKKLLKLAQTLPA-DKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSI  59
           +Y + L+ A+  PA ++R+     ++ +FR   G +DP  I +LLA A   +
Sbjct  14  LYAQCLRSARRCPAWEQREMMKAYVKMKFRHDAGVQDPARIRSLLADASEEL  65

>PPTG_09328
Length=417

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query  78   YVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQH  118
            YVY+K +  ++ G  ED + YK AD N     H+    R H
Sbjct  333  YVYVKNESFQSLGVLEDFSVYK-ADANKSHWTHLHQFCRVH  372

>CCA27064
Length=100

 Score = 29.3 bits (64),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 36/72 (50%), Gaps = 5/72 (7%)

Query  9   MYKKLLKLAQTLPADKRQTTV--EQIRREFRTHNGTKDPKEIAALLARAQSSI-GYLKIV  65
           +Y+  L+LA+ +    ++     E +RREF       DP++I AL A A   +  YL  V
Sbjct  14  LYRDCLRLAKHIGGSSKKGLAIKELVRREFDKGKLETDPEKIEALKANAVRGLSNYL--V  71

Query  66  TPRATSDAGVKN  77
              A+ D  +KN
Sbjct  72  MANASKDIKLKN  83

>CCI46195
Length=590

 Score = 30.0 bits (66),  Expect = 3.4, Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 34/71 (48%), Gaps = 3/71 (4%)

Query  9    MYKKLLKLAQTLPADKRQTTV--EQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVT  66
            +Y+  L+LA+ +    ++     E +RREF       DP++I  L   A   +    +V 
Sbjct  47   LYRDCLRLAKHIGGSSKKGLAIKELVRREFDKGKRETDPEKIEMLKGNAVRGLSNY-LVM  105

Query  67   PRATSDAGVKN  77
              A+ D G+KN
Sbjct  106  ANASKDKGMKN  116

>H310_13870
Length=1107

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 45/105 (43%), Gaps = 12/105 (11%)

Query  3    SSDLR--PMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAA-----LLARA  55
            ++DLR  P   +  ++A TLPA +     +Q+R  FR  +       + +     +L R 
Sbjct  627  TADLRLPPHTPRTFQMALTLPATQTTVMCQQVRLVFRNRHDVSWTWTVTSFVPQTILTRR  686

Query  56   QSSIGYLKIVTPRATSDAGVKNY-----VYIKGKRVEAAGAAEDG  95
             S +  ++ V P     AG  ++       +  + V  AG  +DG
Sbjct  687  NSLLAEMQGVIPGMGQGAGSPSFQRKPTTSLDFEDVTGAGLEDDG  731

>PHYCA_540461
Length=104

 Score = 28.9 bits (63),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTLPAD--KRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  L+LA+ +  +  K Q   + +RREF       DP++I AL A A
Sbjct  14  LYRDCLRLAKHIGGNSKKGQAIKDLVRREFDKGRSETDPEKIEALKANA  62

>PITG_07828
Length=552

 Score = 30.0 bits (66),  Expect = 3.9, Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 0/42 (0%)

Query  25  RQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVT  66
           R++TVE  R+  R HN    P  + A + R  + +G L  V+
Sbjct  24  RESTVEPTRQSRRLHNKELIPTRVTARMIRTATVVGLLVAVS  65

>PYIR_19356
Length=128

 Score = 29.3 bits (64),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  78   YVYIKGKRVEAAGAAEDGARYKTADYNAQ  106
            YVY K +  ++ G  ED + Y+ A+ NAQ
Sbjct  100  YVYTKNESFQSFGTIEDFSVYRVAEENAQ  128

>PHYRA_75193
Length=104

 Score = 28.9 bits (63),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query  9   MYKKLLKLAQTLPAD--KRQTTVEQIRREFRTHNGTKDPKEIAALLARA  55
           +Y+  ++LAQ +  +  K Q   + +RREF       DP+++ AL A A
Sbjct  14  LYRDCMRLAQHIGGNSKKGQAIKDLVRREFAKGRDETDPEKVEALKANA  62

>PHALS_00032
Length=655

 Score = 29.6 bits (65),  Expect = 5.5, Method: Composition-based stats.
 Identities = 19/69 (28%), Positives = 35/69 (51%), Gaps = 3/69 (4%)

Query  11   KKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVTP---  67
            K+ LK A T   D++    EQ +R     NG  D +++ A +  ++++    ++VTP   
Sbjct  238  KRALKAALTAANDEQSDEEEQRKRRMNDDNGMVDVEDVGASMKESEAANMSREMVTPMQR  297

Query  68   RATSDAGVK  76
            +A +  G K
Sbjct  298  KALTKEGYK  306

>PYU1_G005344
Length=584

 Score = 29.3 bits (64),  Expect = 6.3, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  68   RATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTAD  102
            +  SD+G+ N +Y K     +  AA +G R K+ D
Sbjct  542  KQVSDSGISNAIYRKSSTTTSPKAASNGGRGKSKD  576

>H257_07629
Length=376

 Score = 29.3 bits (64),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  10   YKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAAL  51
            Y+  +++ Q  P       V  + R FR H+G     E+AAL
Sbjct  289  YRSWIEVRQVSPTHILMRLVSHVSRSFRAHDGFVSSDELAAL  330

>PHYKE_8225
Length=294

 Score = 28.9 bits (63),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  85   RVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQ  117
            +V A  A E+   YK +D +A +QRH QL+R+ 
Sbjct  18   KVTAGKAEEEFRNYKDSDRHALVQRHYQLMRQN  50

>PHYSO_513891
Length=129

 Score = 28.1 bits (61),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 26/46 (57%), Gaps = 1/46 (2%)

Query  9   MYKKLLKLAQTLP-ADKRQTTVEQIRREFRTHNGTKDPKEIAALLA  53
           +Y + L+ A+  P  ++RQ     ++ +FR    T+DP  + ALLA
Sbjct  16  LYAQCLRSARRCPQWEQRQMMTAYVQMKFRDEMMTQDPDRVRALLA  61

>H257_02061
Length=635

 Score = 28.9 bits (63),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 15/30 (50%), Gaps = 0/30 (0%)

Query  88   AAGAAEDGARYKTADYNAQMQRHVQLLRRQ  117
            A    E G R  T D +   QRHVQLL  Q
Sbjct  458  ALTVVEQGLRVATVDTDGLWQRHVQLLLSQ  487

Lambda      K        H        a         alpha
   0.318    0.130    0.356    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3408016320

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40