Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0017351475634234214710.0
PYIR_134511475635936210652e-144
PYIW_19971147563483659401e-125
PYAP_17762147563483478584e-113
PHYRA_81100147563493578314e-109
PHYSO_471523147563483528167e-107
PPTG_17127147563513528133e-106
PITG_18456147563513528123e-106
PHYCA_556162147563513528106e-106
PHALS_06478147563453527802e-101
PYAR_13570147563223177295e-94
PYVX_18171147562942347041e-90
PHYKE_8393147563263556671e-84
CCA18899147563433316463e-81
CCI45123147563013094954e-59
SPRG_06336147563353314001e-44
SDRG_01781147563353313879e-43
H257_06294147563583523671e-39
H310_09223147563333233633e-39
CCI451271609872022092074e-18
PHYRA_849161612815411451554e-10
PYAR_23286161286071231501e-09
PHYSO_3617471612815231251502e-09
HYAP_086451612815141451483e-09
PYIW_17381161289521251465e-09
SDRG_1276312510913171161449e-09
PPTG_188981612815591031441e-08
PITG_205621612815591031431e-08
PYU1_G0063471612810951141422e-08
PYVX_204381612813461351386e-08
SPRG_0605912510913121141361e-07
PYIR_215891612815681251342e-07
PHYKE_19901612814991191306e-07
H310_002311612814951181296e-07
PYAP_169971612810181231261e-06
H257_067221612814821181261e-06
H257_0672112510912381141233e-06
H310_0023012510912481141234e-06
H257_03093152679751081154e-05
CCA18875161281514451154e-05
CCI447521612815261401154e-05
SPRG_060581612812581131135e-05
SDRG_127621612813921151136e-05
PHYSO_489872819512401301101e-04
PPTG_193711526711951401092e-04
PHYRA_825431526711991191092e-04
PYIR_17453951126191601092e-04
PYAP_186361526710091121073e-04
PYIR_1530914459937841073e-04
PHYSO_556164143137651351055e-04
CCI462351526711551341055e-04
PHYSO_5445981526711631411056e-04
CCA180231526711381341056e-04
PHYRA_76931819512121101056e-04
CCI4122514459981741046e-04
PYVX_133121526710161081046e-04
PYAR_154631526710911121047e-04
PHYRA_73535143138751371047e-04
PYVX_183382417746711047e-04
PYAR_18690951124551031048e-04
PYIR_183821526711541171039e-04
H310_04843152679681081030.001
SDRG_01407152678151081030.001
PHYRA_735346968612101371030.001
PYU1_G008848152677651171030.001
SPRG_00890152678831081030.001
PHYKE_24791445917178980.001
PITG_09930819512211101030.001
PPTG_19153819512191101030.001
CCI4589595111721551030.001
PITG_192131526712011231020.001
SPRG_1702213189210772940.001
PYVX_1357414459950591010.001
PYIW_21108951125931231020.001
PYIW_16987152678211081010.001
PHALS_0653314459930601010.002
PITG_11303931829362990.002
PHYRA_7783414459936601000.002
CCA1648714459975741000.002
PYU1_G0010631445978347990.003
PYIW_131721445993959990.003
CCA21715241778258990.003
CCA2186015507878258990.003
H310_140199204683108980.003
PYAP_172901445983559980.003
PHYCA_50311215292621460950.004
PYU1_G0092499511258053980.004
SPRG_08346241779772970.004
SDRG_05150241778772970.004
PHYRA_830719511230057980.005
PITG_180671445992460970.005
PHYCA_506137241781040970.006
PHYSO_344112241781340970.006
HYAP_08026241779840960.006
PPTG_134011445992760970.006
PHYRA_79281241780940960.006
PITG_02762241781040960.006
PPTG_05519241781040960.006
PYIR_222461255455995960.006
PYAR_1349181951080119960.007
PYAP_22646241781540960.007
CCA1710215292688459950.008
PHYKE_666215267765125950.009
HYAP_0223081951195110950.009
PYU1_G00322916810125950.009
PHYSO_3501971255455797940.010
CCI4245715292690659940.010
PHYSO_5299319511221157950.011
PHALS_03645241783040940.011
PYU1_G01285918501183135940.011
PITG_1789314313747109940.012
PYU1_G004386241783740930.013
H257_035219204685117930.014
PHYCA_5093851255455797930.014
PYIW_2190185060913109930.015
PPTG_14630185339853920.016
PYU1_G01126161471328155930.016
CCI1048915870977740930.016
H257_135671445983676930.017
PYIW_18480241775560920.017
PHALS_026081255455797920.019
SDRG_1477112554549100920.019
PYIW_20891185329153900.020
PYIR_13120241781460920.020
SDRG_007569511216982920.021
PYAR_19883241783340920.021
PHYKE_5678241780940920.021
PYVX_2334914313924109910.023
PYAR_199141445978834910.026
PHYKE_91461255455798910.026
PYAP_136951853348110900.026
CCA2689061471530110910.027
H310_063781445983776900.030
SPRG_0921112554549100900.030
PYIR_2458885060909106900.033
PITG_02109185352253900.033
PYIR_144941681974900.039
SPRG_1190016605110890.040
SDRG_0008012454429857880.044
SPRG_00889122518994116890.045
PPTG_0455314313904109890.047
PHALS_06568185338894880.048
SPRG_029399511216182890.054
PHYRA_7881516919124880.054
HYAP_1368818501036147880.058
PYIW_1757181951330118880.063
PYAP_14828920460497880.064
PPTG_117149511244457880.065
PITG_115789511213157880.066
PYIR_1678061471352154880.072
SPRG_060218195983111870.073
PHYCA_504801185339853860.075
PHALS_0354016904139870.076
SDRG_14486185330854860.076
SPRG_02753185330954860.079
SPRG_0250211092121116810.080
SDRG_055678195980133870.083
SDRG_01408122518916120870.085
PHALS_0409815267118358870.086
PYU1_G012870185335253860.088
H310_07701241781183860.091
HYAP_1171212554558100860.098
PYAP_1673481951314110860.10
PYVX_1308413479126735860.11
SDRG_0215412656882254860.11
H310_0091295112182125860.11
H310_01921185334153850.11
CCI1092861471530140860.11
HYAP_04457152671203129860.12
CCA223673199885109850.12
H257_0336112342869959850.13
H257_075142417810127850.13
PYIR_13555185335553840.14
SDRG_0560811092121116800.14
PHYRA_828881255455797850.14
HYAP_1171317645417100840.15
PITG_0002016927124850.15
H310_1244812554555131840.15
H257_0902812554556129840.15
PPTG_1665916916124850.16
PYU1_G005578144430149830.18
CCI47145185339053830.18
H257_0818216859125840.19
SPRG_1631213132226157820.19
PPTG_1462618501055124840.19
SDRG_088001445988137830.22
CCA19097185668892830.23
CCA24531185337453820.24
CCA190339511188337830.25
H310_1362714313678125830.26
H310_0293381951053109830.28
SPRG_0883412656882554820.28
PYAP_190859940555398820.28
PHALS_0669914313884109820.29
PYAP_1573210538333146810.29
PYAP_221958632901107820.29
SPRG_01654640392339820.29
SDRG_03175640393439820.30
PHYSO_3436291445997723820.30
SPRG_054491445972337820.31
HYAP_13690185337774810.32
PHYSO_478611185352253820.32
PYAP_2347885060897113820.34
SDRG_021352194430633810.34
H257_1180213252783127820.36
PPTG_069911255455797810.37
PYVX_1609581951137112820.37
PYAR_243236147883132810.39
PHYCA_50471216208126790.39
CCI40991241780127810.40
PHYSO_48454116911126810.42
SDRG_062881664155810.45
HYAP_09304134791144137810.47
CCA1783210331112540810.49
PYAR_191229940555497800.51
SDRG_0353112227225541790.52
PYVX_145276030126953800.54
PYAP_162979511246677800.55
PYIR_15118134791222107800.56
H257_03363185331653790.60
H310_0545712227226951780.61
PYIR_1653981951346118800.63
PHYRA_73430185339553790.69
H310_0666713886889661790.70
H257_0982314313654110790.71
PYU1_G0122741583587381790.79
H310_06666863288759790.83
PHYKE_55881675147780.84
H257_1006381951041110780.88
H257_039319639695110780.89
PYIW_178181850118844780.93
HYAP_061012885984120780.96
SPRG_09805144483859780.97
HYAP_08248749078427780.98
PITG_155531255455797781.0
SDRG_06927144484759781.0
CCI4208831991007107781.1
PHYKE_4910185237539771.1
H310_070709639680110771.1
PYAP_1975361471340129781.1
PYIR_1316828851353105781.2
PYIR_226673199749121771.2
PYAP_178003199780117771.2
H310_0644928851361117771.3
CCA2715712554553123771.3
PYAR_21162304113572771.3
PHALS_06336185251139771.3
H310_048421395771081116771.3
PYIW_1891113479119667771.3
CCA272551578101125115771.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001735

Length=342
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001735                                                          571        0.0   
PYIR_13451                                                            414        2e-144
PYIW_19971                                                            366        1e-125
PYAP_17762                                                            335        4e-113
PHYRA_81100                                                           324        4e-109
PHYSO_471523                                                          318        7e-107
PPTG_17127                                                            317        3e-106
PITG_18456                                                            317        3e-106
PHYCA_556162                                                          316        6e-106
PHALS_06478                                                           305        2e-101
PYAR_13570                                                            285        5e-94 
PYVX_18171                                                            275        1e-90 
PHYKE_8393                                                            261        1e-84 
CCA18899                                                              253        3e-81 
CCI45123                                                              195        4e-59 
SPRG_06336                                                            158        1e-44 
SDRG_01781                                                            153        9e-43 
H257_06294                                                            145        1e-39 
H310_09223                                                            144        3e-39 
CCI45127                                                              84.3       4e-18 
PHYRA_84916                                                           64.3       4e-10 
PYAR_23286                                                            62.4       1e-09 
PHYSO_361747                                                          62.4       2e-09 
HYAP_08645                                                            61.6       3e-09 
PYIW_17381                                                            60.8       5e-09 
SDRG_12763                                                            60.1       9e-09 
PPTG_18898                                                            60.1       1e-08 
PITG_20562                                                            59.7       1e-08 
PYU1_G006347                                                          59.3       2e-08 
PYVX_20438                                                            57.8       6e-08 
SPRG_06059                                                            57.0       1e-07 
PYIR_21589                                                            56.2       2e-07 
PHYKE_1990                                                            54.7       6e-07 
H310_00231                                                            54.3       6e-07 
PYAP_16997                                                            53.1       1e-06 
H257_06722                                                            53.1       1e-06 
H257_06721                                                            52.0       3e-06 
H310_00230                                                            52.0       4e-06 
H257_03093                                                            48.9       4e-05 
CCA18875                                                              48.9       4e-05 
CCI44752                                                              48.9       4e-05 
SPRG_06058                                                            48.1       5e-05 
SDRG_12762                                                            48.1       6e-05 
PHYSO_489872                                                          47.0       1e-04 
PPTG_19371                                                            46.6       2e-04 
PHYRA_82543                                                           46.6       2e-04 
PYIR_17453                                                            46.6       2e-04 
PYAP_18636                                                            45.8       3e-04 
PYIR_15309                                                            45.8       3e-04 
PHYSO_556164                                                          45.1       5e-04 
CCI46235                                                              45.1       5e-04 
PHYSO_544598                                                          45.1       6e-04 
CCA18023                                                              45.1       6e-04 
PHYRA_76931                                                           45.1       6e-04 
CCI41225                                                              44.7       6e-04 
PYVX_13312                                                            44.7       6e-04 
PYAR_15463                                                            44.7       7e-04 
PHYRA_73535                                                           44.7       7e-04 
PYVX_18338                                                            44.7       7e-04 
PYAR_18690                                                            44.7       8e-04 
PYIR_18382                                                            44.3       9e-04 
H310_04843                                                            44.3       0.001 
SDRG_01407                                                            44.3       0.001 
PHYRA_73534                                                           44.3       0.001 
PYU1_G008848                                                          44.3       0.001 
SPRG_00890                                                            44.3       0.001 
PHYKE_2479                                                            42.4       0.001 
PITG_09930                                                            44.3       0.001 
PPTG_19153                                                            44.3       0.001 
CCI45895                                                              44.3       0.001 
PITG_19213                                                            43.9       0.001 
SPRG_17022                                                            40.8       0.001 
PYVX_13574                                                            43.5       0.001 
PYIW_21108                                                            43.9       0.001 
PYIW_16987                                                            43.5       0.001 
PHALS_06533                                                           43.5       0.002 
PITG_11303                                                            42.7       0.002 
PHYRA_77834                                                           43.1       0.002 
CCA16487                                                              43.1       0.002 
PYU1_G001063                                                          42.7       0.003 
PYIW_13172                                                            42.7       0.003 
CCA21715                                                              42.7       0.003 
CCA21860                                                              42.7       0.003 
H310_14019                                                            42.4       0.003 
PYAP_17290                                                            42.4       0.003 
PHYCA_503112                                                          41.2       0.004 
PYU1_G009249                                                          42.4       0.004 
SPRG_08346                                                            42.0       0.004 
SDRG_05150                                                            42.0       0.004 
PHYRA_83071                                                           42.4       0.005 
PITG_18067                                                            42.0       0.005 
PHYCA_506137                                                          42.0       0.006 
PHYSO_344112                                                          42.0       0.006 
HYAP_08026                                                            41.6       0.006 
PPTG_13401                                                            42.0       0.006 
PHYRA_79281                                                           41.6       0.006 
PITG_02762                                                            41.6       0.006 
PPTG_05519                                                            41.6       0.006 
PYIR_22246                                                            41.6       0.006 
PYAR_13491                                                            41.6       0.007 
PYAP_22646                                                            41.6       0.007 
CCA17102                                                              41.2       0.008 
PHYKE_6662                                                            41.2       0.009 
HYAP_02230                                                            41.2       0.009 
PYU1_G003229                                                          41.2       0.009 
PHYSO_350197                                                          40.8       0.010 
CCI42457                                                              40.8       0.010 
PHYSO_529931                                                          41.2       0.011 
PHALS_03645                                                           40.8       0.011 
PYU1_G012859                                                          40.8       0.011 
PITG_17893                                                            40.8       0.012 
PYU1_G004386                                                          40.4       0.013 
H257_03521                                                            40.4       0.014 
PHYCA_509385                                                          40.4       0.014 
PYIW_21901                                                            40.4       0.015 
PPTG_14630                                                            40.0       0.016 
PYU1_G011261                                                          40.4       0.016 
CCI10489                                                              40.4       0.016 
H257_13567                                                            40.4       0.017 
PYIW_18480                                                            40.0       0.017 
PHALS_02608                                                           40.0       0.019 
SDRG_14771                                                            40.0       0.019 
PYIW_20891                                                            39.3       0.020 
PYIR_13120                                                            40.0       0.020 
SDRG_00756                                                            40.0       0.021 
PYAR_19883                                                            40.0       0.021 
PHYKE_5678                                                            40.0       0.021 
PYVX_23349                                                            39.7       0.023 
PYAR_19914                                                            39.7       0.026 
PHYKE_9146                                                            39.7       0.026 
PYAP_13695                                                            39.3       0.026 
CCA26890                                                              39.7       0.027 
H310_06378                                                            39.3       0.030 
SPRG_09211                                                            39.3       0.030 
PYIR_24588                                                            39.3       0.033 
PITG_02109                                                            39.3       0.033 
PYIR_14494                                                            39.3       0.039 
SPRG_11900                                                            38.9       0.040 
SDRG_00080                                                            38.5       0.044 
SPRG_00889                                                            38.9       0.045 
PPTG_04553                                                            38.9       0.047 
PHALS_06568                                                           38.5       0.048 
SPRG_02939                                                            38.9       0.054 
PHYRA_78815                                                           38.5       0.054 
HYAP_13688                                                            38.5       0.058 
PYIW_17571                                                            38.5       0.063 
PYAP_14828                                                            38.5       0.064 
PPTG_11714                                                            38.5       0.065 
PITG_11578                                                            38.5       0.066 
PYIR_16780                                                            38.5       0.072 
SPRG_06021                                                            38.1       0.073 
PHYCA_504801                                                          37.7       0.075 
PHALS_03540                                                           38.1       0.076 
SDRG_14486                                                            37.7       0.076 
SPRG_02753                                                            37.7       0.079 
SPRG_02502                                                            35.8       0.080 
SDRG_05567                                                            38.1       0.083 
SDRG_01408                                                            38.1       0.085 
PHALS_04098                                                           38.1       0.086 
PYU1_G012870                                                          37.7       0.088 
H310_07701                                                            37.7       0.091 
HYAP_11712                                                            37.7       0.098 
PYAP_16734                                                            37.7       0.10  
PYVX_13084                                                            37.7       0.11  
SDRG_02154                                                            37.7       0.11  
H310_00912                                                            37.7       0.11  
H310_01921                                                            37.4       0.11  
CCI10928                                                              37.7       0.11  
HYAP_04457                                                            37.7       0.12  
CCA22367                                                              37.4       0.12  
H257_03361                                                            37.4       0.13  
H257_07514                                                            37.4       0.13  
PYIR_13555                                                            37.0       0.14  
SDRG_05608                                                            35.4       0.14  
PHYRA_82888                                                           37.4       0.14  
HYAP_11713                                                            37.0       0.15  
PITG_00020                                                            37.4       0.15  
H310_12448                                                            37.0       0.15  
H257_09028                                                            37.0       0.15  
PPTG_16659                                                            37.4       0.16  
PYU1_G005578                                                          36.6       0.18  
CCI47145                                                              36.6       0.18  
H257_08182                                                            37.0       0.19  
SPRG_16312                                                            36.2       0.19  
PPTG_14626                                                            37.0       0.19  
SDRG_08800                                                            36.6       0.22  
CCA19097                                                              36.6       0.23  
CCA24531                                                              36.2       0.24  
CCA19033                                                              36.6       0.25  
H310_13627                                                            36.6       0.26  
H310_02933                                                            36.6       0.28  
SPRG_08834                                                            36.2       0.28  
PYAP_19085                                                            36.2       0.28  
PHALS_06699                                                           36.2       0.29  
PYAP_15732                                                            35.8       0.29  
PYAP_22195                                                            36.2       0.29  
SPRG_01654                                                            36.2       0.29  
SDRG_03175                                                            36.2       0.30  
PHYSO_343629                                                          36.2       0.30  
SPRG_05449                                                            36.2       0.31  
HYAP_13690                                                            35.8       0.32  
PHYSO_478611                                                          36.2       0.32  
PYAP_23478                                                            36.2       0.34  
SDRG_02135                                                            35.8       0.34  
H257_11802                                                            36.2       0.36  
PPTG_06991                                                            35.8       0.37  
PYVX_16095                                                            36.2       0.37  
PYAR_24323                                                            35.8       0.39  
PHYCA_504712                                                          35.0       0.39  
CCI40991                                                              35.8       0.40  
PHYSO_484541                                                          35.8       0.42  
SDRG_06288                                                            35.8       0.45  
HYAP_09304                                                            35.8       0.47  
CCA17832                                                              35.8       0.49  
PYAR_19122                                                            35.4       0.51  
SDRG_03531                                                            35.0       0.52  
PYVX_14527                                                            35.4       0.54  
PYAP_16297                                                            35.4       0.55  
PYIR_15118                                                            35.4       0.56  
H257_03363                                                            35.0       0.60  
H310_05457                                                            34.7       0.61  
PYIR_16539                                                            35.4       0.63  
PHYRA_73430                                                           35.0       0.69  
H310_06667                                                            35.0       0.70  
H257_09823                                                            35.0       0.71  
PYU1_G012274                                                          35.0       0.79  
H310_06666                                                            35.0       0.83  
PHYKE_5588                                                            34.7       0.84  
H257_10063                                                            34.7       0.88  
H257_03931                                                            34.7       0.89  
PYIW_17818                                                            34.7       0.93  
HYAP_06101                                                            34.7       0.96  
SPRG_09805                                                            34.7       0.97  
HYAP_08248                                                            34.7       0.98  
PITG_15553                                                            34.7       1.0   
SDRG_06927                                                            34.7       1.0   
CCI42088                                                              34.7       1.1   
PHYKE_4910                                                            34.3       1.1   
H310_07070                                                            34.3       1.1   
PYAP_19753                                                            34.7       1.1   
PYIR_13168                                                            34.7       1.2   
PYIR_22667                                                            34.3       1.2   
PYAP_17800                                                            34.3       1.2   
H310_06449                                                            34.3       1.3   
CCA27157                                                              34.3       1.3   
PYAR_21162                                                            34.3       1.3   
PHALS_06336                                                           34.3       1.3   
H310_04842                                                            34.3       1.3   
PYIW_18911                                                            34.3       1.3   
CCA27255                                                              34.3       1.4   
CCA22329                                                              34.3       1.4   
CCI42349                                                              34.3       1.4   
PYU1_G007423                                                          33.9       1.5   
PHALS_09273                                                           33.9       1.5   
HYAP_10830                                                            33.9       1.5   
PHALS_06636                                                           33.9       1.7   
SPRG_04912                                                            33.5       1.7   
PHYKE_4241                                                            33.9       1.7   
H257_16221                                                            33.9       1.7   
PYIR_22259                                                            32.3       1.7   
H257_01308                                                            33.9       1.8   
SDRG_14487                                                            33.9       1.9   
PHALS_07930                                                           33.9       1.9   
HYAP_13757                                                            33.1       2.0   
PYU1_G009508                                                          33.5       2.0   
SPRG_15871                                                            31.6       2.0   
H257_02642                                                            33.5       2.0   
SPRG_02752                                                            33.5       2.1   
CCI39367                                                              33.5       2.1   
PHYRA_77130                                                           33.5       2.3   
PHALS_08097                                                           33.5       2.3   
SPRG_09128                                                            33.5       2.3   
PYAR_14615                                                            33.1       2.4   
CCA25510                                                              33.5       2.4   
PYIW_23452                                                            33.5       2.5   
PHALS_03704                                                           33.5       2.5   
PHYKE_1148                                                            33.1       2.5   
PITG_02106                                                            33.1       2.6   
CCA19118                                                              31.6       2.7   
SPRG_14312                                                            33.1       2.7   
H257_01309                                                            33.1       2.8   
PYAP_16161                                                            33.1       2.9   
PHYCA_539981                                                          33.1       2.9   
CCA14960                                                              33.1       2.9   
PYIW_16158                                                            33.1       2.9   
SDRG_14070                                                            33.1       3.0   
CCI43456                                                              31.6       3.0   
PHYSO_563553                                                          33.1       3.0   
H257_06469                                                            30.4       3.1   
SPRG_00364                                                            32.3       3.1   
PYVX_14593                                                            33.1       3.3   
PHYSO_478442                                                          32.7       3.3   
PYIW_15014                                                            32.7       3.4   
PPTG_13492                                                            32.7       3.4   
PYAR_19291                                                            32.7       3.5   
PYIR_23372                                                            33.1       3.5   
SPRG_01860                                                            32.7       3.5   
PYAP_17850                                                            32.7       3.5   
PYU1_G000724                                                          32.0       3.6   
PYAR_24990                                                            32.0       3.7   
CCI11474                                                              32.7       3.7   
HYAP_11295                                                            32.7       3.8   
PHYRA_73297                                                           31.2       3.8   
H257_00729                                                            31.2       3.8   
PHYKE_4911                                                            29.3       3.9   
SDRG_08236                                                            32.7       4.1   
CCA19458                                                              32.7       4.1   
CCI45290                                                              32.7       4.1   
PHYRA_73985                                                           32.3       4.3   
PHYRA_73432                                                           32.7       4.3   
PHYRA_84786                                                           32.3       4.4   
H310_12867                                                            32.3       4.4   
PYIR_21473                                                            32.3       4.5   
PHALS_12874                                                           32.0       4.7   
PHYRA_85100                                                           30.8       4.8   
PHYRA_85097                                                           30.8       4.8   
PYAR_14076                                                            32.3       4.8   
HYAP_02360                                                            30.8       4.8   
PYIR_14937                                                            32.3       4.9   
PYAR_13263                                                            32.3       4.9   
PPTG_04169                                                            32.3       4.9   
PYU1_G004115                                                          31.2       5.0   
PYVX_20600                                                            32.3       5.0   
PYIW_15053                                                            32.3       5.4   
SPRG_14955                                                            32.3       5.5   
H310_01094                                                            30.8       5.6   
PHALS_06334                                                           32.3       5.6   
PHALS_05587                                                           32.3       5.7   
PHYCA_98948                                                           30.8       5.9   
PHYSO_552247                                                          32.0       5.9   
PPTG_14751                                                            32.0       6.0   
PYU1_G014426                                                          32.0       6.1   
PYIR_14311                                                            32.0       6.1   
PYAP_13968                                                            32.0       6.2   
PYAP_15706                                                            31.6       6.3   
PYU1_G000461                                                          31.6       6.4   
CCI43793                                                              32.0       6.7   
PITG_03652                                                            32.0       6.7   
SDRG_14286                                                            32.0       6.8   
SDRG_07086                                                            32.0       6.8   
PHYSO_556902                                                          31.6       7.0   
H310_02133                                                            32.0       7.3   
PYAP_19776                                                            32.0       7.5   
PHYSO_354120                                                          32.0       7.7   
CCI41909                                                              31.2       8.0   
PHYKE_8689                                                            31.6       8.2   
PYVX_17508                                                            30.4       8.4   
CCA15513                                                              31.6       8.9   
PPTG_07800                                                            30.4       8.9   
SPRG_11537                                                            31.6       8.9   
PYIW_14463                                                            31.2       9.1   
PHYCA_506274                                                          31.6       9.3   
PHYRA_77134                                                           31.6       9.3   
HYAP_14013                                                            31.2       9.3   
PHYKE_7856                                                            31.2       9.4   
PYVX_22589                                                            31.6       9.5   
PHYSO_485120                                                          30.0       9.6   
PHALS_12503                                                           31.2       9.7   
HYAP_13267                                                            31.6       9.8   

>PYU1_G001735
Length=342

 Score = 571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/342 (100%), Positives = 342/342 (100%), Gaps = 0/342 (0%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA
Sbjct  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60

Query  61   AHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDV  120
            AHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDV
Sbjct  61   AHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDV  120

Query  121  NKWLEVVQNALDAAKKLTRKGMTDSTKSMFGFGASISPQLQVkklaatkeellrealreI  180
            NKWLEVVQNALDAAKKLTRKGMTDSTKSMFGFGASISPQLQVKKLAATKEELLREALREI
Sbjct  121  NKWLEVVQNALDAAKKLTRKGMTDSTKSMFGFGASISPQLQVKKLAATKEELLREALREI  180

Query  181  EGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQK  240
            EGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQK
Sbjct  181  EGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQK  240

Query  241  KgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemlalalseleeqanlM  300
            KGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLM
Sbjct  241  KGAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLALALSELEEQANLM  300

Query  301  NAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGNLF  342
            NAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGNLF
Sbjct  301  NAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGNLF  342

>PYIR_13451
Length=359

 Score = 414 bits (1065),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 256/362 (71%), Positives = 288/362 (80%), Gaps = 23/362 (6%)

Query  1    MNILRVPDAKLAISGA-----EVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYF  55
            MNILRVPDAKLA SG+     +  KPTSCEGYVTKRGHFRKSWRVRYLVFNGA+LQV+Y+
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  56   ESRDAAHAPGT-------VPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYI  108
            ESRDA+    +       VPKGSFYVSSVEKHEYW+GVMGG+EKPFGFKLVGHAP KGYI
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  109  ELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGM---TDSTKSMFGFGASISPQLQVkkl  165
            ELDIFVESL D+NKW+EVVQNALDAAKK +R G      +TK+MFGF AS SPQLQVKKL
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180

Query  166  aatkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHL  225
            AATKE+LLR+ALREIEGAKLIGREAVNEIV QGEKLD VE+DLG VEGDLDHADKLLRH+
Sbjct  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240

Query  226  KSPVLHVFSNDNRQKKg-----aptaatasasggasattspvsgtEGQLHAKITGGGGTL  280
            K P+LH+FS D R K+      A      ++ G    TT+  +    Q+H +       L
Sbjct  241  KRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRN---DAL  297

Query  281  NDlemlalalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGN  340
            +DLE LALAL ELEEQANLMNAEA +STEQIAR+E+RLT+VNDRVQ QTKKA ATMKAGN
Sbjct  298  SDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGN  357

Query  341  LF  342
            LF
Sbjct  358  LF  359

>PYIW_19971
Length=348

 Score = 366 bits (940),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 238/365 (65%), Positives = 268/365 (73%), Gaps = 40/365 (11%)

Query  1    MNILRVPDAKLAIS---GAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57
            MNILRVPD KLA S   G +  K TSCEGYVTKRGHFRKSWRVRYLVFNGADLQ +    
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  58   RDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
               A      PKGSF+VSSVEKHEYW+GVMGG+EKPFGFKLVGHAP KGYIELDIFVE+L
Sbjct  61   ASPA-----TPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETL  115

Query  118  PDVNKWLEVVQNALDAAKKLTRK-GMTDS--TKSMFGFGASISPQLQVkklaatkeellr  174
             D+NKW+EVVQNALDAAKK TR  G  DS  TK+MFGF A++SPQLQVKKLAATKEELLR
Sbjct  116  GDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLR  175

Query  175  ealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFS  234
            +ALREIEGAKLIGREAV++I  QG KL+ +E+DLG VE DLDH  KLL H+K P+LH+FS
Sbjct  176  DALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFS  235

Query  235  NDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGT---------------  279
            NDNR K              A  + S     +G   A  + GG +               
Sbjct  236  NDNRSKP------------NAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDT  283

Query  280  --LNDlemlalalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMK  337
              ++DLE L LAL ELEEQA  MNAEA +STEQIAR+E+RLT+VNDRVQ QTKKATATMK
Sbjct  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMK  343

Query  338  AGNLF  342
            AGNLF
Sbjct  344  AGNLF  348

>PYAP_17762
Length=348

 Score = 335 bits (858),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 194/347 (56%), Positives = 249/347 (72%), Gaps = 13/347 (4%)

Query  1    MNILRVP--------DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQV  52
            MNILR+P            + S     KPTSCEGYVTKRGHFRKSWRVR+LV NGADL V
Sbjct  1    MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60

Query  53   SYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDI  112
            SY++S++ A   G VPKGSFY+SSVEKHEY++GV+G +EKPFGFK+VGHAP KGY+ELDI
Sbjct  61   SYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVELDI  120

Query  113  FVESLPDVNKWLEVVQNALDAAKKLTRKGMTD--STKSMFGFGASISPQLQVkklaatke  170
            FVE+L D+NKWLEV QNALDAAKKLTR G  +  + KS+FGF  + SPQ Q+KK+ ATKE
Sbjct  121  FVETLGDLNKWLEVCQNALDAAKKLTRTGQPEALAPKSLFGFSPATSPQQQMKKMTATKE  180

Query  171  ellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVL  230
            ++L++A+ EIE AKLIGR A  EI  QGE+LD +  +L HVEGDLD+ADKLLRH+K+P L
Sbjct  181  QMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKNPGL  240

Query  231  HVFSNDNRQK-KgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemlala  289
            H+FS+D R + K       +S    ++ +    +      H  +  GG  L+D+E LA  
Sbjct  241  HMFSSDARDRAKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAV--GGAPLSDIERLASL  298

Query  290  lseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATM  336
            L ELE+QA L+N EA + T Q+ R+ E+L  VN+RV+ QT+KA A++
Sbjct  299  LGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKANASI  345

>PHYRA_81100
Length=349

 Score = 324 bits (831),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 239/357 (67%), Gaps = 30/357 (8%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV  G++LQ+SY+ESR A
Sbjct  1    MNILRVPEIGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYESRAA  59

Query  61   AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P    + PKGSFY+SS+E HEY +GVMG   KPFGFK++GHAP KGY+ELD+FVE+ 
Sbjct  60   CHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFVETQ  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL A ++LTR+ +  S     K++FGFG S+SPQ       Q++ L  
Sbjct  120  GDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQMQTLTQ  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
             K+ELL  ALR+IE AKL+GREA NEIV QGEKLD +E DLG ++ DLD  DKLLR LKS
Sbjct  180  NKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLLRRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH+FS+D+R K  A    +   S  +           G   +++     T+ND  +  
Sbjct  240  PTLHLFSDDSRPKSTASKGHSPQRSQQS-----------GGSPSRLPPAMETINDAGVSD  288

Query  288  lalsele-----eqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
            L            QA ++N EA RST+QI R+E +L++V  RV+ QTK+A+AT++AG
Sbjct  289  LERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASATLRAG  345

>PHYSO_471523
Length=348

 Score = 318 bits (816),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 245/352 (70%), Gaps = 21/352 (6%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++L VSY+ESR A
Sbjct  1    MNILRVPEVGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYESRAA  59

Query  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P    + PKGSFY+SS+E HEY +GVMG  EKPFGFK+VGHAP KGY+ELD+FVE+L
Sbjct  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFVETL  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L  
Sbjct  120  NDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSPQKQMQTLTK  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
            +++ELL +ALR+IE AK +GREA NEIV+QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  180  SRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH+FS+D+R K  A  A++   S  +          +      I   G  ++DLE LA
Sbjct  240  PTLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDS-----INDAG--VSDLERLA  292

Query  288  lalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             AL ELE QA L+N EA R T+QI RIE +L++V  RV+ QTK+A+A + +G
Sbjct  293  QALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQTKQASAALDSG  344

>PPTG_17127
Length=351

 Score = 317 bits (813),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 247/352 (70%), Gaps = 18/352 (5%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQVSY+ESR A
Sbjct  1    MNILRVPEHGTTASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59

Query  61   AHAPG---TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P    + PKGSFY+SS+E HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FV++L
Sbjct  60   CHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL   ++LTR+ +  S     K++FGF  ++SPQ       Q++ LA 
Sbjct  120  ADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSPQKQMQTLAK  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
            +K+ELL EALRE+E AKL+GREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  180  SKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH+FS+D+R K    +  ++      S  +SP         +   GG    +DLE LA
Sbjct  240  PTLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAFDTSSDAGG----SDLERLA  295

Query  288  lalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             AL ELE QA ++N EA+ S++QI RIE  LT+V  RV+ QTK+A+AT+ AG
Sbjct  296  QALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347

>PITG_18456
Length=351

 Score = 317 bits (812),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 249/352 (71%), Gaps = 18/352 (5%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQVSY+ESR A
Sbjct  1    MNILRVPEHGATASG-DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYYESRAA  59

Query  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P    + PKG FY+SS+E HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FV++L
Sbjct  60   CHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDVFVDTL  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L+ 
Sbjct  120  ADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSPQKQIQTLSK  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
            +K+ELL +ALRE+E AKL+GREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  180  SKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH+FS+D+R K    +  ++      S  +SP          +I+   G ++DLE LA
Sbjct  240  PTLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPA---LEISSDAG-VSDLERLA  295

Query  288  lalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             AL ELE QA L+N EA RS++QI RIE  LT+V  RV+ QTK+A+AT+ AG
Sbjct  296  QALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQTKQASATLSAG  347

>PHYCA_556162
Length=351

 Score = 316 bits (810),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 192/352 (55%), Positives = 246/352 (70%), Gaps = 18/352 (5%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+   A SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQV+Y+ESR A
Sbjct  1    MNILRVPEVGAATSG-DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYESRAA  59

Query  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H      + PKGSFY+SS+E HEY +GVMG   KPFGFK+VGHAP KGY+ELD+FVE++
Sbjct  60   CHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFVETV  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL A ++LTR+ +  S     K++FGF  S+SPQ       Q++ L  
Sbjct  120  GDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSPQKQMQTLTK  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
             K++LL +ALR+IE AK IGREA NEIV QGEKLD +E DL  ++ DLD  DKLLR LKS
Sbjct  180  NKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLLRRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH+FSND+R K  + + A +      S  +SP    +    ++I  G    +DLE LA
Sbjct  240  PTLHMFSNDSRPKSTSSSKANSPQRSQQSGGSSPTRLAQA-AESRIDPGA---SDLERLA  295

Query  288  lalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             AL ELE QA L+N EA  ST+QI  IE  L++V  RV+ QTK+A+AT++AG
Sbjct  296  QALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATLRAG  347

>PHALS_06478
Length=345

 Score = 305 bits (780),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 239/352 (68%), Gaps = 24/352 (7%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILR+P+     SG +  +PTSCEGYVTKRGHFRKSWRVR+LV +G++LQV+Y+ESR A
Sbjct  1    MNILRLPEPGATASG-DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYESRAA  59

Query  61   AHAP---GTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P    T+PKGSFY+S++E HEY IGVMG  ++PFGFK+VGHAP KG++ELD+FVE+ 
Sbjct  60   CHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFVETQ  119

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGAS------ISPQLQVkklaa  167
             D NKWLEV  NAL A ++LTR+ +  S     K +FGF         +SPQ Q++ LA 
Sbjct  120  TDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQMQTLAT  179

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
            +KE LL EALREIE AKL+GREA NEIV+QGEKLD +E DL  ++ DLD  DKLL  LKS
Sbjct  180  SKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLLHRLKS  239

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDlemla  287
            P LH FS+D R K         S S   S               +IT   G ++DL+ LA
Sbjct  240  PTLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPA---------IEITRDAG-VSDLQRLA  289

Query  288  lalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             AL ELE QA L+N+E+  S++QI RIE  L+ V +RV+ QTK+A AT+ AG
Sbjct  290  QALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQAVATLSAG  341

>PYAR_13570
Length=322

 Score = 285 bits (729),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 226/317 (71%), Gaps = 20/317 (6%)

Query  37   SWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGF  96
            SWRVRYLV NGADL VSYF+S+D A  PG  PKGSFY+SSVEKHEY +GV+G ++KPFGF
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67

Query  97   KLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD--STKSMFGFGA  154
            K+VGHAP KGY+ELDIFVES  D+ KWLEV Q+AL AAKKLTR G++D  STKS+FGF  
Sbjct  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRSGLSDAASTKSLFGFSP  127

Query  155  SISPQLQVkklaatkeellrealreIEGAKLIGREAVNEIVSQG---------------E  199
            + SPQ Q++KL+A+KEELL++A+ EIE AKL+GREA  EIV QG               E
Sbjct  128  ATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHAE  187

Query  200  KLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKgaptaatasasggasatt  259
            KLD +E++L  V+ DLD+ DKLL HLKSP+L++FS+D R K  A  A +   S  ++ ++
Sbjct  188  KLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKSKQSALSS  247

Query  260  spvsgtEGQLHAKITGGGGTLNDlemlalalseleeqanlMNAEAARSTEQIARIEERLT  319
            +  +   GQ    +    G ++D+E LAL L ELE QA L+N EA R T Q+ R+ + L 
Sbjct  248  AARADALGQ---GVERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVERVGDALA  304

Query  320  SVNDRVQHQTKKATATM  336
             +N+RVQ+QTKKA + +
Sbjct  305  HINERVQNQTKKADSAV  321

>PYVX_18171
Length=294

 Score = 275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/234 (61%), Positives = 180/234 (77%), Gaps = 9/234 (4%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            +G  V +PTSCEGYVTKRGHFRKSWRVRYLV +GADL+V+YFES+  A   G   KG FY
Sbjct  4    AGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESK-TAFQNGAASKGEFY  62

Query  74   VSSVEKHEY---WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
            +SS++KH Y    +G +G +EKPFGFK+VGHAP KGY ELDIFVE+L D+ KWLEV  NA
Sbjct  63   LSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNA  122

Query  131  LDAAKKLTRKGMTD-----STKSMFGFGASISPQLQVkklaatkeellrealreIEGAKL  185
            L++A  ++RK   D     +TKS+FGF  + SPQ Q+K ++ +K+ELL++ALRE+EGAKL
Sbjct  123  LESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKL  182

Query  186  IGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQ  239
            IGREA  E+V QGEKLD +E +LG +E DLD+ DKLLR LKSPVLH+ + D R+
Sbjct  183  IGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRR  236

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 1/37 (3%)

Query  307  STEQIARIEERLTSVNDRVQHQTKKATATM-KAGNLF  342
            ST+QIARIEERLT+VNDRVQ QTK+AT+ + + GN+F
Sbjct  258  STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PHYKE_8393
Length=326

 Score = 261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 177/355 (50%), Positives = 224/355 (63%), Gaps = 49/355 (14%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            MNILRVP+     SG +  +PTSCEGYVTKRGHF                          
Sbjct  1    MNILRVPEVGATASG-DKARPTSCEGYVTKRGHF-------------------------P  34

Query  61   AHAP-GTVP--KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117
             H P G  P  KGSFY+S++  HEY +GVMG  +KPFGFK+VGHAP KGY+ELD+FVE+L
Sbjct  35   CHPPHGETPAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETL  94

Query  118  PDVNKWLEVVQNALDAAKKLTRKGMTDST----KSMFGFGASISPQL------QVkklaa  167
             D NKWLEV +NAL A +++ R+ +  S     K MFGFG S+SPQ       Q++ L  
Sbjct  95   SDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTH  154

Query  168  tkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKS  227
             KEELL EALRE+E AK++GREA NEIV QGEKLD VE+DL  ++ DLD  DKLLR LK+
Sbjct  155  NKEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKN  214

Query  228  PVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGGGGT---LNDle  284
            P LH+FS+D R K  A +  ++      SA +         +H   + G       +DLE
Sbjct  215  PTLHLFSDDTRPKSHANSNESSPQRTHQSAGS-------NPIHLPFSMGSANDADASDLE  267

Query  285  mlalalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAG  339
             LA AL ELE QA L+N EA RST+QIARIE++L++V  RV+ QTK+A+AT+ AG
Sbjct  268  RLAHALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASATLSAG  322

>CCA18899
Length=343

 Score = 253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 215/331 (65%), Gaps = 11/331 (3%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            PTSCEGYVTKRGHFRKSWRVRYLV +G ++QVSY+ES+D++ +    PKGSF + S EKH
Sbjct  15   PTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQSAEKH  74

Query  81   EYWIGVM---GGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
            EYWI  M     KEKPFGFK+VGHAP +GYIELD+FV+S  D+++WL+V+ N L A+K +
Sbjct  75   EYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKASKCM  134

Query  138  TRKGM---TDSTKSMFGF---GASISPQLQVkklaatkeellrealreIEGAKLIGREAV  191
             R+      D+TKS+ GF   G +   Q+QV  L + K + + EAL++IE AK  G  A 
Sbjct  135  AREAFMAEMDTTKSVLGFSYIGTTSKQQIQV--LKSKKCDYIHEALQQIEMAKSAGNAAC  192

Query  192  NEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKgaptaatasa  251
            +EIVSQGE+L +VE +L  ++ DL+H++KL++ ++ P+ + FS      +   + +++  
Sbjct  193  DEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFSRSRPHDRATISKSSSIH  252

Query  252  sggasattspvsgtEGQLHAKITGGGGTLNDlemlalalseleeqanlMNAEAARSTEQI  311
                       +  +  +           ND+E LA+AL +LE QA L+N+EA +S EQI
Sbjct  253  RSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEAVKSNEQI  312

Query  312  ARIEERLTSVNDRVQHQTKKATATMKAGNLF  342
            ARIE +L+ +NDR+Q QT +   +    NLF
Sbjct  313  ARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343

>CCI45123
Length=301

 Score = 195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 130/309 (42%), Positives = 193/309 (62%), Gaps = 24/309 (8%)

Query  50   LQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVM---GGKEKPFGFKLVGHAPSKG  106
            +QVSY+ES+D+       PKGSF + +VEKHEYWI  M     KE+PFGFK+VGHAP +G
Sbjct  1    MQVSYYESKDSYKNRNATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQG  60

Query  107  YIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGM---TDSTKSMFGFG-ASISPQLQV  162
            Y+ELD+FV+SL ++++WL+V+ N L A K++ R+      D+TK + GF  A  + + QV
Sbjct  61   YVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQV  120

Query  163  kklaatkeellrealreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLL  222
            K+L + K + + EAL++IE AK  G  A +EIV+QGE+L +VE +L ++E DL+H++KL+
Sbjct  121  KELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLI  180

Query  223  RHLKSPVLHVFSNDNRQKKgaptaatasasggasattspvsgtEGQLHAKITGG------  276
            + ++ P+ + FS  +  +K A +    +       T        G LH +   G      
Sbjct  181  KSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQT--------GILHMRKNDGKIEHVA  232

Query  277  ---GGTLNDlemlalalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKAT  333
                   NDLE LA+AL ELE QA L+N+EA +S +QI RIE +L+ +NDR+Q QT +  
Sbjct  233  EEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVV  292

Query  334  ATMKAGNLF  342
            A+    NLF
Sbjct  293  ASSGKKNLF  301

>SPRG_06336
Length=335

 Score = 158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 184/331 (56%), Gaps = 13/331 (4%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            K TSCEGYVTKRGH  KSWR RY+V +G  L+VSY++S+    +     KGSF ++ +EK
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIEK  68

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTR  139
            H+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +WLEV  NAL   K +T 
Sbjct  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVTP  124

Query  140  KGMTDSTKS-MFGFGAS----ISPQLQVkklaatkeellrealreIEGAKLIGREAVNEI  194
            +   D   S + G  A      S  +Q++ +  TKEELLR+A+  +E A+ +G   V+E+
Sbjct  125  QASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184

Query  195  VSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKgaptaatasasgg  254
                E LD  E ++ +VE +LD  D +++ + SP  + FS+   +KKG  +  + SA   
Sbjct  185  GHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKSARSH  244

Query  255  asattspvsgtEGQLHAKITGGGGTL----NDlemlalalseleeqanlMNAEAARSTEQ  310
               T       +         GG T     ++L+ L+  L+ LE  AN ++ E  R+TEQ
Sbjct  245  QPQTPMNSPTHKKSSGPASKAGGATTDAGDDELDQLSKILASLEVHANTISTEVERTTEQ  304

Query  311  IARIEERLTSVNDRVQHQTKKATATMKAGNL  341
            I RI++++   ++R+  Q+ K  A  +   L
Sbjct  305  IDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335

>SDRG_01781
Length=335

 Score = 153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 184/331 (56%), Gaps = 13/331 (4%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            K TSCEGYVTKRGH  KSWR RY+V +G  L+VSYF+S+    +     KGSF ++ +EK
Sbjct  9    KQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIEK  68

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTR  139
            H+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +WLEV  NAL   K +  
Sbjct  69   HDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL--GKNVAP  124

Query  140  KGMTDS-TKSMFGFGAS----ISPQLQVkklaatkeellrealreIEGAKLIGREAVNEI  194
            +   D    ++ G  A+     S  +Q++ +  TKEELLR+A+  +E A+ +G   V+E+
Sbjct  125  QASADQRATALLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTVSEM  184

Query  195  VSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKgaptaatasasgg  254
                E LD  E ++ +V  +LD  D +++ + SP  + FS+   +KKGA +  + SA   
Sbjct  185  GHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSARSH  244

Query  255  asattspvsgtEGQLHAKITGGGGTL----NDlemlalalseleeqanlMNAEAARSTEQ  310
               T       +         GG T     ++L+ L+  L+ LE  AN ++ E  R+TEQ
Sbjct  245  LPQTPMNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHANTISTEVERTTEQ  304

Query  311  IARIEERLTSVNDRVQHQTKKATATMKAGNL  341
            I RI++++   ++RV  Q+ K  A  +   L
Sbjct  305  IDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335

>H257_06294
Length=358

 Score = 145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 119/352 (34%), Positives = 177/352 (50%), Gaps = 42/352 (12%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            TSCEGYVTKRGH  KSW+ RY+V NG  L VSY++S++   + G  PKGSF +S  EK +
Sbjct  11   TSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGH-PKGSFVLSECEKQD  69

Query  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
              +   G   KPFGFK +GH P +GY E  ++VES  D  KWL V  NAL       +K 
Sbjct  70   --LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNAL-GKNSSPQKS  126

Query  142  MTDSTKSMFG----------------------------FGASISPQLQVkklaatkeell  173
            M+   + + G                             G   S + Q+K +  T +ELL
Sbjct  127  MSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKKTSQELL  186

Query  174  realreIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVL---  230
            ++A+ + + A  IG   VNE+V Q + L+  E  +  +   +DHA+ L R LK P+L   
Sbjct  187  QQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKHPILYKL  246

Query  231  -HVFSNDNRQKK---gaptaatasasggasattspvsgtEGQLHAKITGGGGTLNDleml  286
             H+F+     KK   G+ T    + +  +S  +        Q HA        L+ L  +
Sbjct  247  THLFTRKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPEDDQLDQLSKI  306

Query  287  alalseleeqanlMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKA  338
               L +  +  + +    AR+TEQ+ RI++++TSV+DRV+ + K   A +KA
Sbjct  307  LAKLGQTADTISDIT---ARTTEQVDRIDQKVTSVDDRVKKEAKLVQAVLKA  355

>H310_09223
Length=333

 Score = 144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 177/323 (55%), Gaps = 9/323 (3%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            TSCEGYVTKRGH  K+W+ RY+V +G  L V+Y++S++   + G  PKGSF +S  EK +
Sbjct  11   TSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGP-PKGSFVLSECEKQD  69

Query  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
              +   GG  KPFGFK +GH P +GY E  +FVE+  D  KWL V  NAL     +    
Sbjct  70   --LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALGKTTYIPSPS  127

Query  142  MTDSTKSMF--GFGASISPQLQVkklaatkeellrealreIEGAKLIGREAVNEIVSQGE  199
            M     +      G  IS + Q+K +  T  ELL++A+ + + A  IG   V+E+  Q E
Sbjct  128  MESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDEMAYQEE  187

Query  200  KLDQVENDLGHVEGDLDHADKLLRHLKSPVL----HVFSNDNRQKKgaptaatasasgga  255
             L+  EN +  +   +D A+ L + +K P+L    H+FS    ++     ++     G +
Sbjct  188  VLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASSKKRGGGKS  247

Query  256  sattspvsgtEGQLHAKITGGGGTLNDlemlalalseleeqanlMNAEAARSTEQIARIE  315
            + ++    G + +LH          + L+ L+  L++L + A+ ++    R+TEQ+ RI+
Sbjct  248  TRSSRVPRGVQVKLHPPQPQPKQEEDQLDELSKILAKLGQTADTISDITTRTTEQVDRID  307

Query  316  ERLTSVNDRVQHQTKKATATMKA  338
            +++TSV++RV  + K   + +KA
Sbjct  308  QKVTSVDERVTKEAKLVESVLKA  330

>CCI45127
Length=202

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 122/209 (58%), Gaps = 18/209 (9%)

Query  144  DSTKSMFGFG-ASISPQLQVkklaatkeellrealreIEGAKLIGREAVNEIVSQGEKLD  202
            D+TK + GF  A  + + QVK+L + K + + EAL++IE AK  G  A +EIV+QGE+L 
Sbjct  2    DTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLG  61

Query  203  QVENDLGHVEGDLDHADKLLRHLKSPVLHVFSNDNRQKKgaptaatasasggasattspv  262
            +VE +L ++E DL+H++KL++ ++ P+ + FS  +  +K A +    +       T    
Sbjct  62   KVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNHRSHHHQT----  117

Query  263  sgtEGQLHAKITGGGGT---------LNDlemlalalseleeqanlMNAEAARSTEQIAR  313
                G LH +   G             NDLE LA+AL ELE QA L+N+EA +S +QI R
Sbjct  118  ----GILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITR  173

Query  314  IEERLTSVNDRVQHQTKKATATMKAGNLF  342
            IE +L+ +NDR+Q QT +  A+    NLF
Sbjct  174  IEGQLSGINDRIQSQTTQVVASSGKKNLF  202

>PHYRA_84916
Length=1541

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 67/145 (46%), Gaps = 17/145 (12%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A V +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A+     P
Sbjct  390  ATVKKSTANVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNTKGKP  447

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
                 V  V+K   W G      +PFGF  + +     Y+  D   E     NKW+  + 
Sbjct  448  LAEVLVEDVQK---WDG------EPFGFMFMTNEQVPYYVYADNDRER----NKWMNALN  494

Query  129  --NALDAAKKLTRKGMTDSTKSMFG  151
              N ++   ++ +K  T+    + G
Sbjct  495  KLNTVEEEPEIEKKRCTNCNAVLTG  519

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V        +VEK   W
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------TVEKVAPW  259

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + ++WL  ++  +   + ++ +G
Sbjct  260  SGEAHG----FMFYTTKQIP------YYVYASSEGERSRWLRALKEFMVETEDVSCEG  307

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>PYAR_23286
Length=607

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 63/123 (51%), Gaps = 22/123 (18%)

Query  16   AEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVS  75
            A + +P +C GY+TK+GH RKSW+ RY V  G+   VSY+   D A++P   P     + 
Sbjct  381  ANMPEPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYDTANSPKGKPLAEVVIE  438

Query  76   SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
             V++   W G      +PFGF  +    +   I   ++ ++  +  KW+    NAL   +
Sbjct  439  DVQR---WDG------EPFGFMFM----TSEQIPYYVYADNERERTKWM----NAL---R  478

Query  136  KLT  138
            KLT
Sbjct  479  KLT  481

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 50/118 (42%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEG++TKRGH   +W++RY V  G  L+  YF   D +   G+V         VEK   W
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFAGEDKSKRYGSV--------VVEKVAAW  243

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  +  KWL  ++      + +T +G
Sbjct  244  SGEAHG----FMFYTAKQVP------YYVYASSESERAKWLRALKEFYMEPEDVTCEG  291

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            +CEGY+T+RGH   S R  Y V NG  L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>PHYSO_361747
Length=1523

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 16/125 (13%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A V +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A+     P
Sbjct  399  ATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKP  456

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
                 V  V+K   W G      +PFGF  +    +   +   ++ ++  + NKW+  + 
Sbjct  457  LAEVLVEDVQK---WDG------EPFGFMFM----TTEQVPYYVYADNDRERNKWMNAL-  502

Query  129  NALDA  133
            N L+A
Sbjct  503  NKLNA  507

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (45%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V        +VEK   W
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------TVEKVATW  268

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + ++WL V++  +   ++++ +G
Sbjct  269  SGEAHG----FMFYTTKQIP------YYVYASSESERSRWLRVLKEYMVETEEVSCEG  316

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>HYAP_08645
Length=1514

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 67/145 (46%), Gaps = 17/145 (12%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A V +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A+     P
Sbjct  293  ATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDMANNTKGRP  350

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
                 V  V+    W G      +PFGF  + +     Y+  D   E     NKW+  + 
Sbjct  351  LAEVLVEDVQS---WDG------EPFGFMFMTNEQVPYYVYADNDRER----NKWMNALN  397

Query  129  --NALDAAKKLTRKGMTDSTKSMFG  151
              NA++   ++ +K  ++    + G
Sbjct  398  KLNAVEEEPQVDKKRCSNCNAVLTG  422

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+   + +   G V        +VEK   W
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSGEEKSKKYGAV--------TVEKVATW  162

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + ++WL  +++ +   ++++ +G
Sbjct  163  SGEAHG----FMFYTTKQIP------YYVYASSESERSRWLRALKDFMVETEEVSCEG  210

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADL-----QVSYFESRDA  60
            SCEGY+TKRGH   S R+ Y V NG  L     Q +Y E++ A
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  249

>PYIW_17381
Length=952

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 61/125 (49%), Gaps = 15/125 (12%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            S A   +P SC GY+TK+GH RKSW+ RY +  G    ++YF   D A++    P     
Sbjct  396  SNATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYFTDYDIANSAKGKPLAEVT  453

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
            V  V+K   W G      +PFGF  +    +   +   ++ ++  + NKW+  ++     
Sbjct  454  VEDVQK---WDG------EPFGFMFM----TSEQVPYYVYADNDRERNKWMNALRKLTTV  500

Query  134  AKKLT  138
            A++ T
Sbjct  501  AEEPT  505

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 52/124 (42%), Gaps = 26/124 (21%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEG++TKRGH   +W+ RY V  G  L+  YF   D     G+V        +V K   W
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFSGEDKGKRYGSV--------TVAKVAPW  260

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK------L  137
             G   G    F F      P        ++  S  + +KWL  ++  +   ++      L
Sbjct  261  SGEAHG----FMFYTTKQVP------YYVYASSEAERSKWLRALKEFVVEPEEVGCEGYL  310

Query  138  TRKG  141
            TR+G
Sbjct  311  TRRG  314

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 5/42 (12%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADL-----QVSYFESRDA  60
            CEGY+T+RGH   S R+ Y V NG  L     Q +Y E++ A
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  347

>SDRG_12763
Length=1317

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 55/116 (47%), Gaps = 18/116 (16%)

Query  16   AEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVS  75
            A   KP SC GY+TK+GH RKSW+ RY V  GA L  SY+   D+ +      K S    
Sbjct  216  ASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYDSMN------KQSLAEV  267

Query  76   SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             VE    W G      + FGF+ +    +   +   +F ES  +  KW+  +Q  +
Sbjct  268  GVEDVALWDG------EQFGFQFI----TTEQVPYYVFAESDRERQKWMVALQTLI  313

 Score = 37.4 bits (85),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 33/134 (25%), Positives = 49/134 (37%), Gaps = 28/134 (21%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPK-GSFYVSSVEKHEY  82
            C GY+TKRGH   +W+ R+ V     +   Y +          V K G  ++  V   EY
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADD-------SMVKKLGQVHLVKVAPWEY  62

Query  83   WIGVMGGK---------EKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ-----  128
            +    G           E  FGF          Y+  ++  E      +WL  +Q     
Sbjct  63   FSATTGNSVLKSARGSDEMKFGFMFFTTKRVAYYVYANVNAER----QRWLLALQDLYVV  118

Query  129  --NALDAAKKLTRK  140
              NA D    LT++
Sbjct  119  TSNATDCEGYLTKR  132

>PPTG_18898
Length=1559

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 11/103 (11%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A V +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A+     P
Sbjct  393  ATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKP  450

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELD  111
                 V  V+K   W G      +PFGF  + +     Y+  D
Sbjct  451  LAEVLVEDVQK---WDG------EPFGFMFMTNEQVPYYVYAD  484

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V        +VEK   W
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------TVEKVAPW  262

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + ++WL  +++ +   + ++ +G
Sbjct  263  SGEAHG----FMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVETEDVSCEG  310

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

>PITG_20562
Length=1559

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 11/103 (11%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A V +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A+     P
Sbjct  394  ATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--TISYYSDYDMANNAKGKP  451

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELD  111
                 V  V+K   W G      +PFGF  + +     Y+  D
Sbjct  452  LAEVLVEDVQK---WDG------EPFGFMFMTNEQVPYYVYAD  485

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (45%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V        +VEK   W
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------TVEKVAPW  263

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + ++WL  +++ +   ++++ +G
Sbjct  264  SGEAHG----FMFYTTKQIP------YYVYASSEAERSRWLRALKDFMVETEEVSCEG  311

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

>PYU1_G006347
Length=1095

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 56/114 (49%), Gaps = 15/114 (13%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            S A   +P SC GY+TK+GH RKSW+ RY +  G    +SY+   D A++    P     
Sbjct  385  SNATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LISYYSDYDLANSAKGKPLAEVA  442

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
            V  V+K   W G      +PFGF  +    +   +   ++ ++  + NKW+  +
Sbjct  443  VEDVQK---WDG------EPFGFMFM----TSEQVPYYVYADNDRERNKWMNAL  483

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+T+RGH   S R+ Y V NGA L+
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLR  322

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (42%), Gaps = 26/124 (21%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEG++TKRGH   +W+ RY V  G  L+  YF   +     G+V        +V K   W
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE--YFSGEEKNKKYGSV--------TVAKVAPW  249

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK------L  137
             G   G    F F      P        ++  S  + +KWL  ++  +   ++      L
Sbjct  250  SGEAHG----FMFYTTKQIP------YYVYAASEAERSKWLRALKEFVVEPEEVSCEGYL  299

Query  138  TRKG  141
            TR+G
Sbjct  300  TRRG  303

>PYVX_20438
Length=1346

 Score = 57.8 bits (138),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 68/135 (50%), Gaps = 19/135 (14%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A +  S A + +P +C GY+TK+GH RKSW+ RY +  G    +SYF   + A++     
Sbjct  304  ATVKKSTANLPEPVACAGYLTKQGHKRKSWKKRYFILRGT--SISYFADFEMANS----A  357

Query  69   KGSFYVS-SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
            KG      +VE  + W G      +PFGF  +    +   +   ++ ++  + NKW+  +
Sbjct  358  KGKALAEVTVEDVQRWDG------EPFGFMFM----TSEQVPYYVYADNDRERNKWMNAL  407

Query  128  Q--NALDAAKKLTRK  140
            +  NA+D   +  +K
Sbjct  408  RKLNAVDEEPEAEKK  422

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 43/105 (41%), Gaps = 20/105 (19%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  YF S D +   G V        +V K   W
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFASDDKSKKYGAV--------TVAKVAPW  172

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
             G   G    F F      P   Y   ++      +  KWL  +Q
Sbjct  173  SGEAHG----FMFYTTKQIPYYVYASSEV------ERAKWLRALQ  207

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 25/43 (58%), Gaps = 5/43 (12%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADL-----QVSYFESRDA  60
            SCEGY+TKRGH   S R+ Y V  G  L     Q +Y E++ A
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>SPRG_06059
Length=1312

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 18/114 (16%)

Query  16   AEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVS  75
            A   KP SC GY+TK+GH RKSW+ RY V  G  L  +Y+   D+ +      K S    
Sbjct  218  ASAIKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADYDSMN------KQSLAEV  269

Query  76   SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQN  129
             VE    W G      + FGF+ +    +   +   +F ES  +  KW+  +Q 
Sbjct  270  GVEDVALWDG------EQFGFQFI----TTEQVPYYVFAESDRERQKWMVALQT  313

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 49/128 (38%), Gaps = 16/128 (13%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSF----YVSSVEK  79
            C GY+TKRGH   +W+ R+ V     + + Y+     A   G V         YVS+   
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADESMAKKLGQVHLVKVAPWEYVSATTA  70

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ-------NALD  132
            +       G  E  FGF          Y+  ++  E      KWL  +Q       NA D
Sbjct  71   NSILKSTRGSDEMKFGFMFFTTKRVAYYVYANVNAER----QKWLLALQDLYVVTSNATD  126

Query  133  AAKKLTRK  140
                LT++
Sbjct  127  CEGYLTKR  134

>PYIR_21589
Length=1568

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            S A   +P SC GY+TK+GH RKSW+ RY +  G    ++Y+   D A++          
Sbjct  396  SNATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGN--LIAYYPDYDLANSAKGRALAEVT  453

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
            V  V+K   W G      +PFGF  +    +   +   ++ ++  + NKW+  ++     
Sbjct  454  VEDVQK---WDG------EPFGFMFM----TSEQVPYYVYADNDRERNKWMNALRKLTTV  500

Query  134  AKKLT  138
            A++ T
Sbjct  501  AEEPT  505

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 50/124 (40%), Gaps = 26/124 (21%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEG++TKRGH   +W+ RY V  G  L+  YF   D     G+V        +V K   W
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFAGEDKGKRYGSV--------TVAKVAPW  260

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ------NALDAAKKL  137
             G   G    F F      P        ++  S  + +KWL  ++        +     L
Sbjct  261  SGEAHG----FMFYTTKQIP------YYVYAASEAERSKWLRALKEFVVEPEEVSCEGYL  310

Query  138  TRKG  141
            TR+G
Sbjct  311  TRRG  314

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+T+RGH   S R+ Y V NG  L+
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>PHYKE_1990
Length=1499

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 19/119 (16%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            S   + +P +C GY+TK+GH RKSW+ RY +  G+   +SY+   D A+           
Sbjct  396  STTNIPEPVACAGYLTKQGHKRKSWKKRYFILRGS--TISYYSDYDMANNSKGKALAEVL  453

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
            V  V++   W G      +PFGF  +       Y+  D   E     NKW+    NAL+
Sbjct  454  VEDVQR---WDG------EPFGFMFMTSEQVPYYVYADNDRER----NKWM----NALN  495

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 20/118 (17%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V         VEK   W
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------MVEKVATW  260

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
             G   G    F F      P        ++  S  + +KWL  ++  +   ++++ +G
Sbjct  261  SGEAHG----FMFYTTKQIP------YYVYASSEAERSKWLRALKEFMVETEEVSCEG  308

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            SCEGY+TKRGH   S R+ Y V NGA L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

>H310_00231
Length=1495

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 57/118 (48%), Gaps = 15/118 (13%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            +P +C G++TK+GH RKSW+ RY V  G  L  +Y+   DA++   + P G   V  V  
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDASNMRHSRPLGEVTVREVST  405

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
               W G      +P GF  V    +   +   +F ++  D  KWL  ++   +++  +
Sbjct  406  ---WDG------EPGGFMFV----TNDNVPYYVFADNERDQAKWLTALRKLFESSTSV  450

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            CEGY+TKRGH   S+R+RY V +GA ++  YF    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK--YFADETA  285

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 50/122 (41%), Gaps = 25/122 (20%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            GY+TKRGH   +W+ R+ V   A  ++SY+         G V         +EK   W G
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYYADEGMKKKLGEV--------HLEKVSPWSG  207

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ------NALDAAKKLTR  139
               G    F F       +   I   ++  +  +  +WLE +       +A+D    LT+
Sbjct  208  EANG----FMFY------TSKQIAYYVYASTNSERRRWLEALSDYYVEPDAVDCEGYLTK  257

Query  140  KG  141
            +G
Sbjct  258  RG  259

>PYAP_16997
Length=1018

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 22/123 (18%)

Query  16   AEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVS  75
            A + +P +C GY+TK+GH RKSW+ RY V  G    ++YF   D A++          V 
Sbjct  394  ANIPEPIACSGYLTKQGHKRKSWKKRYFVLRGN--SITYFTDFDTANSNKGKALAEVIVE  451

Query  76   SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
             V++   W G      +PFGF  +    +   +   ++ ++  +  KW+    NAL   +
Sbjct  452  DVQR---WDG------EPFGFMFM----TSEQVPYYVYADNERERGKWM----NAL---R  491

Query  136  KLT  138
            KLT
Sbjct  492  KLT  494

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 20/120 (17%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            +CEG++TKRGH   +W++RY V  G  L+  YF   D +   G+V         VEK   
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSGDDKSKRYGSV--------IVEKVAP  255

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGM  142
            W G   G    F F      P        ++  S  +  KWL  +++ +   +++T +G 
Sbjct  256  WSGEAHG----FMFYTTKQVP------YYVYASSEAERAKWLRALRDFMVEPEEVTCEGF  305

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            +CEG++T+RGH   S R  Y V NG  L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>H257_06722
Length=1482

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 56/118 (47%), Gaps = 15/118 (13%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            +P +C G++TK+GH RKSW+ RY V  G  L  +Y+   DA++     P G   V  V  
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDASNLRHGKPLGEVTVREVSA  405

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
               W G      +P GF  +    +   +   +F ++  D  KWL  ++   ++A  +
Sbjct  406  ---WDG------EPSGFMFI----TNDSVPYYVFADNDRDQAKWLAALRKLFESATSM  450

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 48/104 (46%), Gaps = 16/104 (15%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   S+R+RY V  G+ ++   + + + A+  G        V S  +   W
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK---YYADETAYRSGASALAEMEVRSGGR---W  304

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             G   G    F     G         L +  E++P++ KWLE +
Sbjct  305  DGESTGL---FLKTSTGST-------LFVCAENVPELQKWLEAL  338

 Score = 33.1 bits (74),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 50/124 (40%), Gaps = 25/124 (20%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
              GY+TKRGH   +W+ R+ V   A  ++SY+         G V         +EK   W
Sbjct  155  ASGYLTKRGHVVTNWKTRFFVLR-AGGRLSYYADEGMKKKLGEV--------HLEKVSPW  205

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ------NALDAAKKL  137
             G   G    F F       +   I   ++  +  +  +WL+ +       +A+D    L
Sbjct  206  SGEANG----FMFY------TNKQIAYYVYASTNSERRRWLDALSDFYVEPDAVDCEGYL  255

Query  138  TRKG  141
            T++G
Sbjct  256  TKRG  259

>H257_06721
Length=1238

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 54/114 (47%), Gaps = 18/114 (16%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            +P +C GY+TK+GH RKSW+ RY V  G+ L  SY+   D+ +      K       +E 
Sbjct  228  QPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYYTDYDSTN------KQCLAEVGIED  279

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
             + W G M G    F F       +   +   ++ ES  +  KWL  ++  LDA
Sbjct  280  VQVWDGEMHG----FMFT------TSEQVVYYVYAESERERQKWLVSLKALLDA  323

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 57/145 (39%), Gaps = 26/145 (18%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV------P---KGSFYV  74
            C GY+TKRGH   +W++RY V       +SY+E    A   G V      P    GS   
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYEDESMAKKLGQVHLAKVAPWEYNGSL-A  71

Query  75   SSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV-------  127
             SV K E      G +E  +GF       +   +   I+  S  +  KW   V       
Sbjct  72   KSVSKRESRGSSSGAEESRYGFMFF----TTKRVVYYIYTTSAIEHQKWFHAVADYYVHT  127

Query  128  QNALDAAKKLTRKGMTDSTKSMFGF  152
             N  D    +T+K    +  ++F F
Sbjct  128  SNVADCEGYMTKK----TPGTLFSF  148

>H310_00230
Length=1248

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 54/114 (47%), Gaps = 18/114 (16%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            +P +C GY+TK+GH RKSW+ RY V  GA L  SY+   ++A+      K       +E 
Sbjct  222  QPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYYTDYESAN------KQCLAEVGIED  273

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
             + W G M G    F F           +   ++ ++  +  KWL  ++  LDA
Sbjct  274  VQVWDGEMHG----FMFTTTEQ------VMYYVYADTERERQKWLVALKALLDA  317

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 1/44 (2%)

Query  24  CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
           C GY+TKRGH   +W++R+ V       +SY+E    +   G V
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLR-PHANLSYYEDESMSKKLGQV  54

>H257_03093
Length=975

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ S+D A   GT  +G   ++ V    Y  
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKDEART-GTNLRGRMIITKVLPENY--  158

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  + +GH     +  L    E   D+  W+E++Q A+D
Sbjct  159  ----GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAID  196

>CCA18875
Length=1514

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 30/45 (67%), Gaps = 2/45 (4%)

Query  18   VCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAH  62
            V +P +C GY+TK+GH RKSW+ RY +  G    +SY++  D A+
Sbjct  412  VVEPVTCAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLAN  454

 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 30/59 (51%), Gaps = 10/59 (17%)

Query  17   EVCKPT--------SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            E C P         + EGY+TKRGH   +W+ R+ V +G  L+  Y+ S +     G+V
Sbjct  207  ETCAPIPESSSTEITYEGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEEKTKRYGSV  263

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>CCI44752
Length=1526

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 64/140 (46%), Gaps = 17/140 (12%)

Query  14   SGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
            + +   +P +C GY+TK+GH RKSW+ RY +  G    +SY++  D A+           
Sbjct  408  TTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRGN--IISYYQDYDLANNAKGKALAEVQ  465

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ--NAL  131
            V  V+K   W G      + FGF  +       Y    ++ ++  +  KW+  ++  + L
Sbjct  466  VEDVQK---WDG------EAFGFMFMTTEQVPYY----VYADNERERKKWMSALRKLSTL  512

Query  132  DAAKKLTRKGMTDSTKSMFG  151
            D   ++ +K  ++    + G
Sbjct  513  DEDTEVEKKRCSNCQAVLTG  532

 Score = 39.3 bits (90),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 36/139 (26%), Positives = 54/139 (39%), Gaps = 34/139 (24%)

Query  17   EVCKPT--------SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            E C P         + EGY+TKRGH   +W+ R+ V +G  L+  Y+ S +     G+V 
Sbjct  207  ETCAPIPESSSTEITYEGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEEKTKRYGSV-  263

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
                    V K   W G   G    F F      P        ++  S  +  KWL  ++
Sbjct  264  -------VVAKVAPWSGEAHG----FMFYTTKQIP------YYVYAASEAEKTKWLRALR  306

Query  129  ------NALDAAKKLTRKG  141
                  + +     LTR+G
Sbjct  307  EFYVEPDEVTCEGYLTRRG  325

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>SPRG_06058
Length=1258

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (49%), Gaps = 15/113 (13%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            P +C G++TK+GH RKSW+ RY V  G  L  SY+   +AA+      +    +S V   
Sbjct  146  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEAANT-----RAGKALSDVSLK  198

Query  81   EYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
            +  +G   G+   F F  + + P        +F ++  D  KW+  ++ A+ A
Sbjct  199  D--VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGA  243

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 16/110 (15%)

Query  18   VCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
              +P  CEGY+TKRGH   S+R+RY V  G+   V  + S + A+  G        V S 
Sbjct  41   CARPVDCEGYLTKRGHLVPSYRLRYFVMCGS---VVKYYSDETAYRTGASALAEIEVKSG  97

Query  78   EKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             +   W G   G      FK   ++       + +  E++ D+ KW+E +
Sbjct  98   GR---WDGESTG----LFFKTATNS------TMFVCAENVADLQKWIEAL  134

>SDRG_12762
Length=1392

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 17/115 (15%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            P +C G++TK+GH RKSW+ RY V  G  L  SYF   +AA+   T    +    SV+  
Sbjct  357  PVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYFADFEAAN---TRLGKALSEVSVKDV  411

Query  81   EYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA--LDA  133
              W G + G    F F  + + P        +F ++  D  KW+  ++ A  LDA
Sbjct  412  APWDGEVCG----FMFVTLENVPYY------VFADNERDQAKWMTALKKAVGLDA  456

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 16/119 (13%)

Query  18   VCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
            V  P  CEGY+TKRGH   S+R+RY V  G+   V  + S + A+  G        V S 
Sbjct  252  VPDPVDCEGYLTKRGHLVPSYRLRYFVMCGS---VVKYYSDETAYRTGASALAEIEVKSG  308

Query  78   EKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK  136
             +   W G   G      FK   ++       + +  E++ D+ KW+E +    + A K
Sbjct  309  GR---WDGESTG----LFFKTATNS------TMFVCAENVADLQKWIEALGRIFNEAPK  354

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 49/122 (40%), Gaps = 25/122 (20%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            GY+TKRGH   +W+ R+        ++SY+         G V     +VS V     W G
Sbjct  164  GYLTKRGHVITNWKTRFFALRSQG-RLSYYNDEGMGKKLGEV-----HVSKVSP---WSG  214

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLE------VVQNALDAAKKLTR  139
               G    F F+          I   ++  S  +  +WL+      +V + +D    LT+
Sbjct  215  ETNG----FMFQTTKQ------ISYYVYASSNTERARWLKALDDFYIVPDPVDCEGYLTK  264

Query  140  KG  141
            +G
Sbjct  265  RG  266

>PHYSO_489872
Length=1240

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 56/130 (43%), Gaps = 15/130 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S D     G +P        + +    + 
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLD  205

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTDS  145
              GG   PF F++   A +     L +  ES  +  +W+E  Q   DA +    K   ++
Sbjct  206  RSGGGHAPFRFQIRTDAQT-----LLLEAESRENQKRWIEACQELADAIR--ASKYSVNT  258

Query  146  TKSMFGFGAS  155
            + S F   AS
Sbjct  259  SLSSFSMDAS  268

>PPTG_19371
Length=1195

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D+  A + A +      EGYV K+G +   W  RYL+ +GA L  +Y+ S++ A +   +
Sbjct  54   DSSTASTPAAMTHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL  111

Query  68   PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             +G   +S V    Y      GK   F  +  GH     +  L    E   D+  W+E++
Sbjct  112  -RGRMIISKVRPENY------GKAHGFLIETQGH----KHFHLCCTTELEKDM--WVEMM  158

Query  128  QNALD-----AAKKLTRKGM  142
            Q A++     A  +L+ +GM
Sbjct  159  QAAIEEGVRHAHSRLSMEGM  178

>PHYRA_82543
Length=1199

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 57/119 (48%), Gaps = 15/119 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYL+ +GA L  +Y+ S++ A +   + +G   +S V    Y  
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIISKVRPENY--  115

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMT  143
                GK   F  +  GH     +  L    E   D+  W+E++Q A++   + T+  M+
Sbjct  116  ----GKAHGFLLETQGH----KHFHLCCATELEKDM--WVEMMQAAIEEGVRHTQSSMS  164

>PYIR_17453
Length=2619

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 27/160 (17%)

Query  15    GAEVCKPTSCEGYVTKRGHFR-KSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFY  73
             G+ +C    CEGYV  R HF   +WR R+ V    D ++  +    AA + G   K    
Sbjct  2153  GSGICH--RCEGYVRVRHHFLGAAWRERFAVLE--DTRLYLYPDTSAALSEGREQK----  2204

Query  74    VSSVEKHEYWIGV----------MGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKW  123
               ++EKH+  I V          +G     FGF++   A   GY+E  + +E   +  KW
Sbjct  2205  --ALEKHDL-IAVKKWHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKW  2257

Query  124   LEVVQNAL-DAAKKLTRKGMTDSTKSMFGFGASISPQLQV  162
             L  + NA+ + +  ++ K MT      F  GA++   L+ 
Sbjct  2258  LAAITNAVSEISTHVSSKVMTRDAALPFIPGAAMEGYLKT  2297

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 33/74 (45%), Gaps = 5/74 (7%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
             EGY+ KRGH   S R RY V     L+  YF + + +  P   P GSF V  V     W 
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTLE--YFATHEDSRNPAIRPHGSFQVEIVSD---WH  1276

Query  85    GVMGGKEKPFGFKL  98
             G    K    G +L
Sbjct  1277  GKTASKTYEHGMEL  1290

>PYAP_18636
Length=1009

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 15/112 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A + G   +G   +S V    Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARS-GRNLRGRMIISKVRPENY--  157

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK  136
                GK   F  + +GH     +  L    E   D+  W+E++Q A+D   K
Sbjct  158  ----GKAHGFLLETMGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVK  199

>PYIR_15309
Length=937

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 41/84 (49%), Gaps = 13/84 (15%)

Query  7    PDAKLAISGAEVCKPTSC-------EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES--  57
            PD    +SG+E     S        EGYVTKRGH  ++W+ R+    G +L  SY+ES  
Sbjct  123  PDTPSIVSGSEDHAVESLDLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKV  180

Query  58   --RDAAHAPGTVPKGSFYVSSVEK  79
              R+ +H  G V   S  V  V K
Sbjct  181  DARNRSHLKGRVNVASVKVEKVSK  204

>PHYSO_556164
Length=765

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 57/135 (42%), Gaps = 11/135 (8%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH RK+W+ RY V   + L+  Y+     +   G V     +      H  
Sbjct  220  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDSSCSKLKGEV---LLFHPQTRVHYV  274

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGM  142
             + V GG++  F  ++        Y  L +    L D   W+  +++AL        +GM
Sbjct  275  DVHVAGGRDASFAIQV-----GPDYTLL-LQAAQLRDRENWMYCIEDALLCRDSYHPQGM  328

Query  143  TDSTKSMFGFGASIS  157
            T+  +  F    S++
Sbjct  329  TEGPEPYFDLRESVA  343

>CCI46235
Length=1155

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 61/134 (46%), Gaps = 20/134 (15%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A +   + +G   +  V    Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL-RGKMMIVKVRPENY--  174

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
                GK   F  +  GH     +  L    E   D+  W+E++Q A++ A        ++
Sbjct  175  ----GKAHGFLIETKGHK----HFHLCCATELEKDM--WIEMMQAAIEQAVPF-----SN  219

Query  145  STKSMFGFGASISP  158
            +T S      SI+P
Sbjct  220  TTHSFVSLHHSIAP  233

>PHYSO_544598
Length=1163

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 65/141 (46%), Gaps = 21/141 (15%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D+  A + A +      EGYV K+G +   W  RYL+ +GA L  +Y+ S++ A +   +
Sbjct  2    DSSAASTPAAITHEVHWEGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL  59

Query  68   PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             +G   +S V    Y      GK   F  +  GH     +  L    E   D+  W+E++
Sbjct  60   -RGRMIISKVRPENY------GKAHGFLLETQGH----KHFHLCCSTELEKDM--WVEMM  106

Query  128  QNALD------AAKKLTRKGM  142
            Q A++      A  +++ +GM
Sbjct  107  QAAIEEGVRHGAHSRVSMEGM  127

>CCA18023
Length=1138

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 62/134 (46%), Gaps = 19/134 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A +   + +G   +  V    Y  
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKEEARSARNL-RGKMMIVKVRPENY--  179

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
                GK   F  +  GH     +  L    E   D+  W+E++Q A++ A   +    ++
Sbjct  180  ----GKAHGFLIETKGHK----HFHLCCATELEKDM--WIEMMQAAIEQAAPFS----SN  225

Query  145  STKSMFGFGASISP  158
            ++ S      SI+P
Sbjct  226  ASHSFVSLHHSIAP  239

>PHYRA_76931
Length=1212

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 48/110 (44%), Gaps = 13/110 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S D     G +P        + +    + 
Sbjct  152  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIILD  203

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
              GG   PF F++   A +     L +  ES  +  +W++  Q   DA +
Sbjct  204  RSGGGHAPFRFQIRTEAQT-----LLLEAESRENQKRWIDSCQELADAIR  248

>CCI41225
Length=981

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 39/74 (53%), Gaps = 10/74 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR-DA---AHAPGTVPKGSFYVSSVEK-  79
            EGYVTKRGH  ++W++R+    G  L  SY+ES+ DA   AH  G V   S  +  V K 
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESKVDAQQRAHLKGRVKVASVRIDQVSKW  197

Query  80   ---HEYWIGVMGGK  90
               +E+      GK
Sbjct  198  GSGYEFTFSTTEGK  211

>PYVX_13312
Length=1016

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 53/108 (49%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYL+ +GA L  +Y+ S+D A + G   +G   +S V    Y  
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAAL--TYYNSKDEARS-GRNLRGRMQLSRVRPENY--  130

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  +      ++G+    +   +  + + W+E++Q A+D
Sbjct  131  ----GKAHGFLIE------TRGHKSFHLCCTTELEKDMWVEMMQAAID  168

>PYAR_15463
Length=1091

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 15/112 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ S++ A + G   +G   +S V    Y  
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKEEARS-GRNLRGRMIISKVRPENY--  132

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK  136
                GK   F  +      +KG+    +   +  + + W+E++Q A+D   K
Sbjct  133  ----GKAHGFLIE------TKGHKLFHLCCSTELEKDMWVEMMQAAIDEGVK  174

>PHYRA_73535
Length=875

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 58/137 (42%), Gaps = 15/137 (11%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH RK+W+ RY V   + L+  Y+     A   G V     +      H  
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDPSCAKLKGEV---LLFHPQTRVHYV  393

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVES--LPDVNKWLEVVQNALDAAKKLTRK  140
             + V GG++  F  + VG        E  + +++  L D   W+  +++AL        +
Sbjct  394  DVHVAGGRDASFAIQ-VGP-------EYTLLLQAAQLRDRENWMYCIEDALLCRDSYHPQ  445

Query  141  GMTDSTKSMFGFGASIS  157
            GMT      F    S++
Sbjct  446  GMTSGPGPYFDLRESVA  462

>PYVX_18338
Length=746

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 36/71 (51%), Gaps = 7/71 (10%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAP-----GTVPKGSFYVSS  76
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A        G V   + Y  S
Sbjct  79   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVATLDTEKYRGRVTAFAMYTRS  136

Query  77   VEKHEYWIGVM  87
              + E WI ++
Sbjct  137  PVECEIWIKMV  147

>PYAR_18690
Length=2455

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 45/103 (44%), Gaps = 7/103 (7%)

Query  2     NILRVPDAKLAISGAEVCKPTSC---EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR  58
             ++L  P+    IS  E    TS    EGY+ KRGH   S R RY V    ++   Y    
Sbjct  1112  SLLPAPEPVDEISAVESSHETSSILMEGYLVKRGHLVPSMRKRYCVLVK-NVLTYYLTQE  1170

Query  59    DAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGH  101
             D+ ++  + P GSF V  V     W G    +   FG +L  H
Sbjct  1171  DSRNSDTSQPLGSFRVEIVSD---WHGKTAMQTYEFGMELETH  1210

>PYIR_18382
Length=1154

 Score = 44.3 bits (103),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (48%), Gaps = 15/117 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A +   + +G   +S V    Y  
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  183

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
                GK   F  +      +KG+    +   +  + + W+E++Q A+D   K +  G
Sbjct  184  ----GKAHGFLIE------TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNG  230

>H310_04843
Length=968

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ S++ A   G   +G   ++ V    Y  
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKEEART-GKNLRGRMIITRVLPENY--  157

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  + +GH     +  L    E   D+  W+E++Q A+D
Sbjct  158  ----GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAID  195

>SDRG_01407
Length=815

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 53/108 (49%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ ++D A + G   +G   ++ V    Y  
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARS-GRNLRGRMIITRVLPENY--  139

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  +      +KG+    +   +  + + W+E++Q A+D
Sbjct  140  ----GKAHGFLIE------TKGHKHFHLCCTTELEKDMWVEMMQAAID  177

>PHYRA_73534
Length=1210

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/137 (26%), Positives = 58/137 (42%), Gaps = 15/137 (11%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH RK+W+ RY V   + L+  Y+     A   G V     +      H  
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDPSCAKLKGEV---LLFHPQTRVHYV  393

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVES--LPDVNKWLEVVQNALDAAKKLTRK  140
             + V GG++  F  + VG        E  + +++  L D   W+  +++AL        +
Sbjct  394  DVHVAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDALLCRDSYHPQ  445

Query  141  GMTDSTKSMFGFGASIS  157
            GMT      F    S++
Sbjct  446  GMTSGPGPYFDLRESVA  462

>PYU1_G008848
Length=765

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (48%), Gaps = 15/117 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A +   + +G   +S V    Y  
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  188

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
                GK   F  +      +KG+    +   +  + + W+E++Q A+D   K +  G
Sbjct  189  ----GKAHGFLIE------TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNG  235

>SPRG_00890
Length=883

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 53/108 (49%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ ++D A + G   +G   ++ V    Y  
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKDEARS-GRNLRGRMIITRVLPENY--  85

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  +      +KG+    +   +  + + W+E++Q A+D
Sbjct  86   ----GKAHGFLIE------TKGHKHFHLCCTTELEKDMWVEMMQAAID  123

>PHYKE_2479
Length=171

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 7/78 (9%)

Query  7    PDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAH  62
            PD +   S +   + +  EGYVTKRGH  ++W++R+    G    VSY+E    +R+ +H
Sbjct  59   PDTRPPHSNSTSSR-SKWEGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSH  115

Query  63   APGTVPKGSFYVSSVEKH  80
              G V   S  +  V K+
Sbjct  116  LKGRVNVASVKMDKVAKN  133

>PITG_09930
Length=1221

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 48/110 (44%), Gaps = 13/110 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S D     G +P        V +    + 
Sbjct  153  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------VTEDTIVLD  204

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
              GG   PF F++   A +     L +  ES  +  +W++  Q   DA +
Sbjct  205  RSGGGHAPFRFQIRTDAHT-----LLLEAESRENQKRWIDSCQELADAIR  249

>PPTG_19153
Length=1219

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 48/110 (44%), Gaps = 13/110 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S D     G +P        + +    + 
Sbjct  147  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEIP--------ITEDTIVLD  198

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
              GG   PF F++   A +     L +  ES  +  +W++  Q   DA +
Sbjct  199  RSGGGHAPFRFQIRTDAHT-----LLLEAESRENQKRWIDSCQELADAIR  243

>CCI45895
Length=1721

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 2/55 (4%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHA--PGTVPKGSFYVSSV  77
            EGY+ KRGH   S R RY V    D  + YFE+++ A     G+ P G F V++V
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKEDAEGFECGSKPLGEFQVANV  897

>PITG_19213
Length=1201

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 59/123 (48%), Gaps = 20/123 (16%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYL+ +GA L  +Y+ S++ A +   + +G   ++ V    Y  
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL-RGRMIINKVRPENY--  125

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD-----AAKKLTR  139
                GK   F  +  GH     +  L    E   D+  W+E++Q A++     A  +L+ 
Sbjct  126  ----GKAHGFLIETQGHK----HFHLCCTTELEKDM--WVEMMQAAIEEGVRHAHSRLSM  175

Query  140  KGM  142
            +GM
Sbjct  176  EGM  178

>SPRG_17022
Length=107

 Score = 40.8 bits (94),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 14/72 (19%)

Query  22  TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
           T  EGY+ K+GH  ++WR RY V +G     +Y+ S++AA A             +EK++
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASAD------------LEKYK  77

Query  82  YWIGVMGGKEKP  93
             + V G K+ P
Sbjct  78  GRVTVTGAKKDP  89

>PYVX_13574
Length=950

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES----RDAAHAPGTVPKGSFYVSSVEK  79
            EGYVTKRGH  ++W++R+    G    VSY+ES    R+ +H  G V   S  +  V K
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYESKVDARNRSHLKGRVNVASVKIDKVAK  215

>PYIW_21108
Length=2593

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 51/123 (41%), Gaps = 14/123 (11%)

Query  25    EGYVTKRGHFRKSWRVRYLV-FNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
             EGY+ KRGH   S R RY V    A L+  YF + + +  P   P GSF V  V     W
Sbjct  1234  EGYLVKRGHLIPSMRKRYCVLLKNASLE--YFATHEDSRNPAIRPHGSFQVEIVSD---W  1288

Query  84    IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMT  143
              G    K    G +L   +  K +       E   D   W+   ++A+     LTR    
Sbjct  1289  HGKTASKSYDHGMELET-SDGKTFFCAAYKAE---DKTAWMHAFKHAI----ALTRADHA  1340

Query  144   DST  146
             DST
Sbjct  1341  DST  1343

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 67/155 (43%), Gaps = 14/155 (9%)

Query  14    SGAEVCKPTSCEGYVTKRGHFRKS-WRVRYLVFNGADLQVSYFESR---DAAHAPGTVPK  69
             SG    K    EGYV  R HF  + WR R+ V  G  L + Y +S    D       + K
Sbjct  2146  SGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRLLL-YTDSSAAMDEDRERTALEK  2204

Query  70    GSFYVSSVEK-HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
                   +VEK H  +   +G   + FGF++   A   GY+E  +  E   +  KWL VV 
Sbjct  2205  HDLI--AVEKWHPTYSANLGSGSR-FGFRVENEA--GGYLECTVTTED--EQTKWLAVVS  2257

Query  129   NAL-DAAKKLTRKGMTDSTKSMFGFGASISPQLQV  162
             +A+ D A   T K M       F  GA++   L+ 
Sbjct  2258  DAVSDLATHATSKMMARDAVLPFISGAAMEGYLKT  2292

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 15/129 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGY+ KRG    + + RY V  G  L  +Y+ + D      T P+    V  V +   W 
Sbjct  2    EGYLWKRGGLLSTMQRRYCVLKGTML--AYYTNEDECKRQAT-PRD---VLEVVQARDWD  55

Query  85   GVMGGKEK---PFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
            G    ++     F    +G A  + +       +SL D   W++ +Q+ALD   ++ +  
Sbjct  56   GASALRQHYKHAFEIDYLGGATYQCH------CDSLEDKQLWMQAIQHALDEPNRIVQDE  109

Query  142  MTDSTKSMF  150
            + D+ + + 
Sbjct  110  IEDAQRRLL  118

>PYIW_16987
Length=821

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 53/108 (49%), Gaps = 15/108 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGYV K+G +   W  RYLV +GA L  +Y+ +++ A +   + +G   +S V    Y  
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKEEARSARNL-RGRMIISKVRPENY--  174

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                GK   F  +      +KG+    +   +  + + W+E++Q A+D
Sbjct  175  ----GKAHGFLIE------TKGHKHFHLCCSTELEKDMWVEMMQAAID  212

>PHALS_06533
Length=930

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 6/60 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYF----ESRDAAHAPGTVPKGSFYVSSVEKH  80
            EGYVTKRGH  ++W++R+    G    VSY+    E+R+ +H  G V   S  V  V K+
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVEARNRSHLKGRVNVASVKVDKVAKN  168

>PITG_11303
Length=293

 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 10/62 (16%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S + +   G V        +VEK   W
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEEKSKKYGAV--------TVEKVAPW  263

Query  84   IG  85
             G
Sbjct  264  SG  265

>PHYRA_77834
Length=936

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 6/60 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAHAPGTVPKGSFYVSSVEKH  80
            EGYVTKRGH  ++W++R+    G    VSY+E    +R+ +H  G V   S  V  V K+
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKVDKVAKN  176

>CCA16487
Length=975

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 10/74 (14%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR-DA---AHAPGTVPKGSFYVSSVEK-  79
            EGYVTKRGH  ++W++R+    G  L  SY+E++ DA   AH  G V   S  +  V K 
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENKVDAQQRAHLKGRVKVASVRIDQVSKW  195

Query  80   ---HEYWIGVMGGK  90
               +E+      GK
Sbjct  196  GSGYEFTFSTTEGK  209

>PYU1_G001063
Length=783

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 29/47 (62%), Gaps = 6/47 (13%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES----RDAAHAPGTV  67
            EGYVTKRGH  ++W+ R+    G +L  SY+ES    R+ +H  G V
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESKVDARNRSHLKGRV  191

>PYIW_13172
Length=939

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES----RDAAHAPGTVPKGSFYVSSVEK  79
            EGYVTKRGH  ++W+ R+    G +L  SY+ES    R+  H  G V   S  +  V K
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESKVDARNRNHLKGRVNVASVKIEKVSK  206

>CCA21715
Length=782

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            T  EGY+ K+GH  +SWR RY V +G     SY+ S++ A A     +G   V+  E+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAER  161

>CCA21860
Length=782

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            T  EGY+ K+GH  +SWR RY V +G     SY+ S++ A A     +G   V+  E+
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKEIAMADTERYRGRVTVTGAER  161

>H310_14019
Length=683

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 21/108 (19%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S EG++ KRG   K+W+ RY   NG +L+  Y E       PG  PKG   V        
Sbjct  171  SFEGWLLKRGQRVKNWKRRYFTLNGQELK--YME------GPGAKPKGYGMV--------  214

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
             +GV    E P+    +   P++    LD+  ES  +   W++ + +A
Sbjct  215  -VGVKKLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQRILDA  257

>PYAP_17290
Length=835

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAHAPGTVPKGSFYVSSVEK  79
            EGYVTKRGH  ++W++R+    G +L  SY+E    +R+  H  G V   S  +  V K
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENKVDARNRDHLKGRVNVASVKLDKVSK  209

>PHYCA_503112
Length=214

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAHAPGTVPKGSFYVSSVEKH  80
            EGYVTKRGH  ++W+ R+    G    VSY+E    +R+ +H  G V   S  +  V K+
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  174

>PYU1_G009249
Length=2580

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 27/53 (51%), Gaps = 0/53 (0%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
             EGY+ KRGH   S R RY V       + Y+ + + +  P   P GSF V +V
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNPSVAPHGSFRVDTV  1231

>SPRG_08346
Length=797

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 14/72 (19%)

Query  22  TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
           T  EGY+ K+GH  ++WR RY V +G     +Y+ S++AA A             +EK++
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASA------------DLEKYK  77

Query  82  YWIGVMGGKEKP  93
             + V G K+ P
Sbjct  78  GRVTVTGAKKDP  89

>SDRG_05150
Length=787

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (53%), Gaps = 14/72 (19%)

Query  22  TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
           T  EGY+ K+GH  ++WR RY V +G     +Y+ S++AA A             +EK++
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEAASA------------DLEKYK  77

Query  82  YWIGVMGGKEKP  93
             + V G K+ P
Sbjct  78  GRVTVTGAKKDP  89

>PHYRA_83071
Length=2300

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG----TVPKGSFYVSSV  77
             EGY+ KRGH   S R RY V  G +L  SYF + D +  PG    T P G F V+ V
Sbjct  1132  EGYLMKRGHKIPSMRKRYCVLLGNEL--SYFVTHDDSKNPGGGATTAPLGKFRVAVV  1186

>PITG_18067
Length=924

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 6/60 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAHAPGTVPKGSFYVSSVEKH  80
            EGYVTKRGH  ++W++R+    G    VSY+E    +R+ +H  G V   S  +  V K+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

>PHYCA_506137
Length=810

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  138

>PHYSO_344112
Length=813

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  138

>HYAP_08026
Length=798

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  125

>PPTG_13401
Length=927

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 34/60 (57%), Gaps = 6/60 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFE----SRDAAHAPGTVPKGSFYVSSVEKH  80
            EGYVTKRGH  ++W++R+    G    VSY+E    +R+ +H  G V   S  +  V K+
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEGN--LVSYYENKVDARNRSHLKGRVNVASVKMDKVAKN  166

>PHYRA_79281
Length=809

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  137

>PITG_02762
Length=810

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  138

>PPTG_05519
Length=810

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDVA  138

>PYIR_22246
Length=559

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 47/95 (49%), Gaps = 15/95 (16%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V     LQ+ YF+S +A +  GT+ +G    S+V K   W G      KP GF+
Sbjct  43   WKKRYCVIYKESLQIVYFQS-EADYEKGTI-RGKIPFSTVHK---WDG------KPNGFQ  91

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
               + PS       ++ E+  +  +WL  +Q A+D
Sbjct  92   F--YTPSNKCFR--VYTETAEEQEQWLAAMQTAID  122

>PYAR_13491
Length=1080

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 14/119 (12%)

Query  28   VTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP-KGSFYVSSVEKHEYWIGV  86
            +TK+G +R++W+ R+ +       +SY++S +     G+VP  G   V  ++K       
Sbjct  2    LTKQGSWRRNWKTRFFILRSDYPSLSYYKSEEKLELLGSVPITGDSLV--LDKSA-----  54

Query  87   MGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA--AKKLTRKGMT  143
             GG   PF F+L   A     +   +  E+  +  +W++  Q  +D   A+K  +  MT
Sbjct  55   -GGGHAPFRFQLRTDAVGAALL---LETETRDNQQRWMDACQELVDTLRAEKFRQSTMT  109

>PYAP_22646
Length=815

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY + +G     SY+ S+D A
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDVA  137

>CCA17102
Length=884

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA----HAPGTVPKGSFYVSSVEK  79
            EGYV KRGH  ++W++R+    G  L  SY+ES+  A    H  G V   S  + +V +
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESKGDAQQRVHLKGRVKLASVRIEAVSR  166

>PHYKE_6662
Length=765

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (46%), Gaps = 15/125 (12%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D+  A + A +      EG+V K+G +   W  RYL+ +GA L  +Y+ S++ A +   +
Sbjct  55   DSSAASTPATITHEVHWEGFVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNL  112

Query  68   PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             +G   +  V    Y      GK   F  +  GH     +  L    E   D+  W+E++
Sbjct  113  -RGRMIIVKVRPENY------GKAHGFLIETQGHK----HFHLCCSTELEKDM--WVEMM  159

Query  128  QNALD  132
            Q A++
Sbjct  160  QAAIE  164

>HYAP_02230
Length=1195

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 25/110 (23%), Positives = 47/110 (43%), Gaps = 13/110 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S D     G +        ++ +    + 
Sbjct  157  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI--------AITEDTIVLD  208

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
              GG   PF F++   A +     L +  ES     +W++  Q   DA +
Sbjct  209  RSGGGTAPFRFQIRSDAHT-----LLLEAESRDSQKRWMDSCQELADAIR  253

>PYU1_G003229
Length=810

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 49/125 (39%), Gaps = 21/125 (17%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D K    G    +   CEG++ KRG    +W+ R+   NG  LQ           +PG  
Sbjct  244  DQKTPFLGETFNETNMCEGWLYKRGQRSTAWKKRFFTLNGFQLQYQ--------DSPGEN  295

Query  68   PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
            PKG   V         + +  G E  F  ++       G I L +  +S   VN W++ +
Sbjct  296  PKGEGSV---------VDIQLGDEGTFSMEI---QLDTGRI-LSVTADSQDQVNMWVDAI  342

Query  128  QNALD  132
               L+
Sbjct  343  CTVLE  347

 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (49%), Gaps = 5/68 (7%)

Query  13  ISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
           I+   V K T C+  G+ +K+G   KSW+ RY V  G +L   YF  R  +   G   KG
Sbjct  16  IAVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSERSPS-GKGINEKG  72

Query  71  SFYVSSVE  78
              +  VE
Sbjct  73  RLKIVGVE  80

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 8/52 (15%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
            G++ K+GH  KSW+ R+ V  G+   ++YFE     H     PKGS  +  V
Sbjct  402  GWLNKQGHRMKSWKRRFFVVEGST--ITYFEQ---VHED---PKGSGVIQQV  445

 Score = 32.3 bits (72),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (59%), Gaps = 2/34 (6%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57
            C G++ K G   K+W++RY    G  L  +YF+S
Sbjct  702  CSGWLRKEGSTVKNWKLRYFTLKGTTL--TYFKS  733

>PHYSO_350197
Length=557

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 44/97 (45%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S +         +G    SSV     W G      KP GF+
Sbjct  42   WKKRYCVVYKDELQIVYFLSLEDFEKRAI--RGKIPFSSVHA---WDG------KPNGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + PS       ++ E+  D  KWLEV+Q ALD A
Sbjct  91   F--YTPSNNCFR--VYTETPEDQLKWLEVMQKALDNA  123

>CCI42457
Length=906

 Score = 40.8 bits (94),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (56%), Gaps = 6/59 (10%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA----HAPGTVPKGSFYVSSVEK  79
            EGYV KRGH  ++W++R+    G   +VSY+ES+  A    H  G V   S  + ++ K
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESKGDAQQRVHLKGRVKVVSVRMETISK  186

>PHYSO_529931
Length=2211

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG----TVPKGSFYVSSV  77
             EGY+ KRGH   S R RY V  G +L  SYF + D +  PG    T P G+F V  V
Sbjct  989   EGYLMKRGHKIPSMRKRYCVLVGNEL--SYFVTHDDSKNPGGGATTNPLGNFRVEVV  1043

>PHALS_03645
Length=830

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S+D A
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSKDVA  138

>PYU1_G012859
Length=1183

 Score = 40.8 bits (94),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 62/135 (46%), Gaps = 35/135 (26%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            M++++ P + L+ S   + KP    G++ K+GH  +SW+ RY V +G  LQ  YFE+ D 
Sbjct  476  MDLVKAPPS-LSPS---IVKPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFENIDK  529

Query  61   AHAPGTVPKGSFYV-----SSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVE  115
                   P+G   V      +V+++   + +  G+                   L I  +
Sbjct  530  P------PRGGGIVVHVLRDTVDQNCLDVHLANGR------------------VLKISAD  565

Query  116  SLPDVNKWLEVVQNA  130
            +  D+N W + +QNA
Sbjct  566  ARDDLNSWYDALQNA  580

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 29/118 (25%), Positives = 55/118 (47%), Gaps = 21/118 (18%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            ++C G++ K+G   K+W+ RY   +G  L+  YF+        G++ + SF +S VEK  
Sbjct  809  SNCHGWLNKQGGTIKTWKRRYFSLHGTTLR--YFK-----RETGSMLR-SFTISHVEKQ-  859

Query  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTR  139
                     +   G +++  +  K    L +  ES  D  +WL  +Q ++ A   + +
Sbjct  860  --------PQVALGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAESSVPK  905

 Score = 35.4 bits (80),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 16/46 (35%), Positives = 22/46 (48%), Gaps = 8/46 (17%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            +CEG++ K+GH  K W+ RY   N   L+          H P  VP
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLNNDMLEYR--------HEPQDVP  395

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 19/107 (18%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            +G++ K G   K+W+ R++V  G  L  SY+    A   P + P GS  +  VE +    
Sbjct  197  KGWLLKEGKRMKNWKKRFVVLRGNVL--SYY----ADETPSSPPLGSLVIRQVETN----  246

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
                     F         ++G   L I  +SL D+  W  V+  A+
Sbjct  247  ---------FTTPFTLDVHTEGGRILRIAADSLDDIEAWDLVLSQAV  284

>PITG_17893
Length=747

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH RK+W+ RY V   + L+  Y+     A   G V     +      H  
Sbjct  218  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYTDSSCAKLKGEV---LLFHPQTRVHYV  272

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             + V GG++  F  ++        Y  L +    L D   W+  +++AL
Sbjct  273  DVHVAGGRDASFAIQV-----GPDYTLL-LQAAQLRDRENWMYCIEDAL  315

>PYU1_G004386
Length=837

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY + +G     SY+ S+D A
Sbjct  136  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDVA  173

>H257_03521
Length=685

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (44%), Gaps = 23/117 (20%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S EG++ KRG   K+W+ RY   N  +L+ S          PG  PKG   V        
Sbjct  168  SFEGWLLKRGQRVKNWKRRYFTLNSQELKYS--------QGPGEKPKGFGMV--------  211

Query  83   WIGVMGGKEKPFGFKL-VGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLT  138
             +GV    E  F + L +   P++    LD+  ES  +   WL+ +  A  +A  +T
Sbjct  212  -VGVKTSPE--FAYALSISMLPTR---VLDVQAESTDEQEAWLQRLLVASSSATTIT  262

>PHYCA_509385
Length=557

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 43/97 (44%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S +         +G    SSV     W G      KP GF+
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDFEKRAI--RGKIPFSSVHA---WDG------KPNGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + PS       ++ E+  D  KW+E +QN +D A
Sbjct  91   F--YTPSDNCFR--VYTETAEDQAKWIETMQNCIDNA  123

>PYIW_21901
Length=913

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 49/109 (45%), Gaps = 11/109 (10%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ K GH RK+W+ RY V + + L+  Y+     A   G V     +  +   H  
Sbjct  423  SMRGWLRKLGHVRKNWKSRYFVLDRSVLR--YYADESLARLKGEV---LLFHPATRVHYV  477

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             I + GGK+  F   +      K Y  L +  E L D   W+  +++AL
Sbjct  478  DIHLSGGKDGTFAIHV-----GKDYALL-LQAEQLSDRENWMYCIEDAL  520

>PPTG_14630
Length=398

 Score = 40.0 bits (92),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   K+W+ R++V +G   Q++Y+++  +   P   PKGSF V +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT--SKLVPTVKPKGSFQVITVE  60

 Score = 35.8 bits (81),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 39/79 (49%), Gaps = 10/79 (13%)

Query  1    MNIL-RVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            M +L R+    L+ SG+E     +  G++ K G   KSW+ RY V  G  L  SYF S D
Sbjct  132  MELLDRLESLPLSESGSEQV---THSGWLKKEGARVKSWKRRYFVLRGNAL--SYFNSED  186

Query  60   AAHAPGTVPKGSFYVSSVE  78
                 G   KG  +V +VE
Sbjct  187  T----GAAAKGYGHVKAVE  201

>PYU1_G011261
Length=1328

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 71/155 (46%), Gaps = 30/155 (19%)

Query  3    ILRVPDAKLAISGAEV---CKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            + R+P A L IS ++V    + T   G++ K+G   +S++ RY+  NG  L  SY++ + 
Sbjct  144  VARIP-ANLIISDSDVTSTVESTFISGFLRKKGEKNRSFKRRYMELNGTVL--SYYKKKP  200

Query  60   AAHAPGTVPKGSFYVSSVEKHEYWIGV-----------MGGKEKPFGFKLVGHAPSKGYI  108
                     K    +S+ EK  Y  G            M  K +PFG  LV  A  + ++
Sbjct  201  EK-------KSGIPLSAAEKKAYERGSIDLDRVSSLQPMENKSEPFGIHLVTTA--RTWV  251

Query  109  ELDIFVESLPDVNKWLEVVQNALD-AAKKLTRKGM  142
               I  ES  D  +WL+V+   +  +A  +T K M
Sbjct  252  ---IAAESDQDYQRWLKVLCGVVKYSAVHITYKRM  283

>CCI10489
Length=777

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ KRGH  +SWR R+ V +G  L  SY+ S++ A
Sbjct  104  TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEVA  141

>H257_13567
Length=836

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 9/76 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV------E  78
            EG+V K+GH  ++W+VRY    G  L  SY+E+++ A     + KG  +V++V       
Sbjct  61   EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETKEDARKRRFL-KGRVHVTTVVLVEGRS  117

Query  79   KHEYWIGVMGGKEKPF  94
             H Y +     + KPF
Sbjct  118  HHGYDLTFTTQESKPF  133

>PYIW_18480
Length=755

 Score = 40.0 bits (92),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            T  EGYV K+GH  +SWR RY + +G     SY+ S++ A       +G   V+   K +
Sbjct  50   TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGARKDD  107

>PHALS_02608
Length=557

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 43/97 (44%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S D         +G    SSV     W G      KP GF+
Sbjct  42   WKKRYCVIYAGELQIVYFLSLDDFEKRAI--RGKIPFSSVHP---WDG------KPNGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + P+       ++ +S  +  KWL+V+Q  LD A
Sbjct  91   F--YTPADNCFR--VYTDSAEEQQKWLDVMQQCLDNA  123

>SDRG_14771
Length=549

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 15/100 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V   + L + Y+ES +AA A G++ KG     SV     W G      KP GF+
Sbjct  34   WKRRYCVLQESALAIFYYESEEAA-AEGSL-KGKIPYCSVHD---WDG------KPHGFQ  82

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
               + P+       ++ +S  + NKW+  +Q  LD A ++
Sbjct  83   F--YTPTNKCFR--VYCDSDDERNKWMTAMQAQLDNAPEV  118

>PYIW_20891
Length=291

 Score = 39.3 bits (90),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   ++W+ R+LV  G   Q++Y+++  A+  P T  KGSF V +VE
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGK--QLTYYDT--ASLTPKTKEKGSFQVITVE  57

 Score = 32.7 bits (73),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 28/53 (53%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   K+W+ RY   +G  L  SYF+S D     G+  KG  +V  VE
Sbjct  97   GWLKKEGSRVKNWKKRYFTLHGNTL--SYFDSADT----GSAAKGYGHVKGVE  143

>PYIR_13120
Length=814

 Score = 40.0 bits (92),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (52%), Gaps = 2/60 (3%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            T  EGY+ K+GH  +SWR RY + +G     SY+ S++ A       +G   V+   K E
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEVAMVDTEKFRGRVTVTGARKDE  161

>SDRG_00756
Length=2169

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 7/82 (9%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            + EGY+ K+GHF  + + +Y+V  G    V ++ S DA  A  TV  G   V+SV +   
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLVGN--HVFFYASHDAYVAKTTVDVGCSEVASVGE---  518

Query  83   WIG--VMGGKEKPFGFKLVGHA  102
            W G  ++     PF  + V HA
Sbjct  519  WDGHTLLLTYPHPFRIETVAHA  540

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 51/125 (41%), Gaps = 10/125 (8%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            +GY+ KRGH   +   RY V +G+ L V + E     H  G  P   + +  V     W 
Sbjct  2    QGYLWKRGHALPTMSRRYCVLDGSMLAVYHAERE---HELGLTPSSVYEIREVLP---WD  55

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
            G    K+   GF  V     K Y       +++    +W+  +Q +L    ++    + +
Sbjct  56   GHTRLKKYEHGFA-VSTLGGKTY---QCSADTMAAQEQWIAAIQESLAEPYRIVADEIVE  111

Query  145  STKSM  149
            + K +
Sbjct  112  AQKQL  116

>PYAR_19883
Length=833

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  ++WR RY + +G     SY+ S+D A
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKDVA  137

>PHYKE_5678
Length=809

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (63%), Gaps = 2/40 (5%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            T  EGY+ K+GH  +SWR RY V +G     SY+ S++ A
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKEVA  137

>PYVX_23349
Length=924

 Score = 39.7 bits (91),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 30/109 (28%), Positives = 49/109 (45%), Gaps = 11/109 (10%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ K GH RK+W+ RY V   + L+  Y+     +   G V     +  +   H  
Sbjct  444  SMSGWLRKLGHVRKNWKARYFVLEKSILR--YYSDESRSRLKGEV---LLFHPATRVHYV  498

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             I + GG++  F  + VG      Y  L +  E L D   W+  +++AL
Sbjct  499  DIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDAL  541

>PYAR_19914
Length=788

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR  58
            EGYVTKRGH  ++W+ R+    G +L  SY+E++
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK  177

>PHYKE_9146
Length=557

 Score = 39.7 bits (91),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 43/98 (44%), Gaps = 21/98 (21%)

Query  38   WRVRYLVFNGADLQVSYF---ESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPF  94
            W+ RY V    +LQ++YF   E  +     G +P  S +         W G      KP 
Sbjct  42   WKKRYCVVYKDELQITYFLSLEDFEKRSIRGKIPFSSVHA--------WDG------KPN  87

Query  95   GFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
            GF+   + PS       ++ E+  D  KWLEV+Q  LD
Sbjct  88   GFQF--YTPSNTCFR--VYTETAEDQLKWLEVMQKVLD  121

>PYAP_13695
Length=348

 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++TK G   K+W+ R+    G  L  SYF+S D     G+  KG  +V +VE       
Sbjct  156  GWLTKEGMRVKNWKRRWFTLRGDTL--SYFDSADT----GSNAKGYGHVRAVE-------  202

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
            V G K      +        G I L +  ES  D+  WL  + +A++AA+
Sbjct  203  VNGEKANSLDIRF-----DNGRI-LRVAAESSEDMQDWLCKLSDAIEAAQ  246

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 50/105 (48%), Gaps = 17/105 (16%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++ K+G   K+W+ R++V  G   Q++Y+++     +P    KGSF V +VE       
Sbjct  12   GWIYKQGSLVKNWKRRFMVLRGK--QLTYYDTERI--SPRVKEKGSFQVITVELSS---D  64

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
            +  G        L+ H   +G   L ++ +S  + N W   + +A
Sbjct  65   IQNG--------LIVHG--RGGRVLKLYTDSTDNTNGWYHAIMDA  99

>CCA26890
Length=1530

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (52%), Gaps = 14/110 (13%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHA---PGTVPKGSFYVSSVEKHEY  82
            GY+ KRG   KS+R RY+  NG  L  SY++ + +  +     T P+GS  + +V     
Sbjct  297  GYLRKRGETNKSFRRRYMELNGNIL--SYYKKKPSTKSREENKTCPRGSIQLENVTS---  351

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
             +  +  K + +G  LV    S+ +   ++  E+  + ++WL+ + NA++
Sbjct  352  -LQPLESKTEKYGIVLV--TTSRTW---ELVAENESEYHRWLKELCNAVE  395

>H310_06378
Length=837

 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 40/76 (53%), Gaps = 9/76 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV------E  78
            EG+V K+GH  ++W+VRY    G  L  SY+E+++ A     + KG  ++++V       
Sbjct  59   EGFVQKKGHLVRNWKVRYFTLEGNLL--SYYETKEDARKRRFL-KGRVHLTTVMLVEGRS  115

Query  79   KHEYWIGVMGGKEKPF  94
             H Y +     + KPF
Sbjct  116  AHGYDLTFTTQESKPF  131

>SPRG_09211
Length=549

 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 15/100 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V   + L + Y+ES +AA A G++ KG     SV     W G      KP GF+
Sbjct  34   WKRRYCVLQESALAIFYYESEEAA-AEGSL-KGKIPYCSVHD---WDG------KPHGFQ  82

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
               + P+       ++ +S  + NKW+  +Q  LD A ++
Sbjct  83   F--YTPTNKCFR--VYCDSDDERNKWMTSMQAQLDNAPEV  118

>PYIR_24588
Length=909

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++ K GH RK+W+ RY V   + L+  Y+     A   G V     +  +   H   I 
Sbjct  412  GWLRKLGHVRKNWKSRYFVLEKSVLR--YYADESMARLKGEV---LLFHPATRVHYVDIH  466

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
            + GGK+  F   +      K Y  L +  + L D   W+  +++AL
Sbjct  467  LSGGKDCTFAIHV-----GKDYALL-LQADQLSDRENWMYCIEDAL  506

>PITG_02109
Length=522

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G+V K+G   K+W+ R++V +G   Q++Y+++  +   P   PKGSF V +VE
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGR--QLTYYDT--SKLNPTVKPKGSFQVITVE  186

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  SYF S D     G   KG  +V +VE
Sbjct  281  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE  327

>PYIR_14494
Length=819

 Score = 39.3 bits (90),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 33/74 (45%), Gaps = 8/74 (11%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D K    G    +   CEG++ KRG    +W+ R+   NG  LQ  Y E+      PG  
Sbjct  249  DQKTPFLGETFAETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ--YQEN------PGDN  300

Query  68   PKGSFYVSSVEKHE  81
            PKG   V  ++  E
Sbjct  301  PKGEGSVVDIQLGE  314

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57
            C G++ K G   K+W++RY   NGA L  SYF+S
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKS  747

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 5/72 (7%)

Query  9   AKLAISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGT  66
           A   I+ + V K + C+  G+ +K+G   KSW+ RY V  G +L   YF  R  +   G 
Sbjct  13  ANNVIAVSRVTKNSYCDHAGWASKQGSIIKSWKRRYFVLKGREL--IYFAERSPS-GKGI  69

Query  67  VPKGSFYVSSVE  78
             KG   + +VE
Sbjct  70  DEKGRLKIVAVE  81

 Score = 31.6 bits (70),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 29/52 (56%), Gaps = 8/52 (15%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
            G++ K+G   KSW+ R+ V    D  ++Y+E  + A      PKG+ +++ V
Sbjct  422  GWLKKQGKHMKSWKRRFFVIE--DRTITYYEQLNEA------PKGNGFINQV  465

>SPRG_11900
Length=605

 Score = 38.9 bits (89),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 20/110 (18%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            KP  C GY+ K+G   K+WR RY   +G   Q+SY    DA  AP   PKG  +V     
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSY---SDADGAP---PKGFGHV-----  281

Query  80   HEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQN  129
                + V    ++PF   +  H  S     L +   +  + + WL V+++
Sbjct  282  ----VDVCVNTKRPFALYI--HLASGR--RLAVAGSTQAEADTWLAVLED  323

 Score = 33.9 bits (76),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 30/56 (54%), Gaps = 4/56 (7%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            G+V K+G   KSW+ R+LV  G    V+Y++   + H P    KGS  +  V ++
Sbjct  6   SGFVFKQGALIKSWKKRFLVVQGR--HVTYYDR--SVHEPNPREKGSLVLVDVTQN  57

>SDRG_00080
Length=298

 Score = 38.5 bits (88),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 6/57 (11%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
            P +  GYV K+G F K+W+ RY+V +  D  + Y+ S  A     T P+G F V+ +
Sbjct  70   PPAFSGYVRKQGSFVKNWKRRYMVLH--DDTLFYYVSERAT----TKPRGFFRVTGI  120

>SPRG_00889
Length=994

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EG+V K+G +   W  RYLV +G  L  +Y+  +  A + G   +G   ++       ++
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YV  172

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRK  140
            G     +K  GF +     +KG+    +   +  + + W+E++Q ALD A   + K
Sbjct  173  GPDFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSASTK  224

>PPTG_04553
Length=904

 Score = 38.9 bits (89),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 46/109 (42%), Gaps = 11/109 (10%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH RK+W+ RY V   + L+  Y+         G V     +      H  
Sbjct  361  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYADSSCTKLKGEV---LLFHPQTRVHYV  415

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             + V GG++  F  ++        Y  L +    L D   W+  +++AL
Sbjct  416  DVHVAGGRDASFAIQV-----GPDYTLL-LQAAQLRDRENWMYCIEDAL  458

>PHALS_06568
Length=388

 Score = 38.5 bits (88),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 44/94 (47%), Gaps = 10/94 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++ K G   KSWR R+ V  G  L  SYF S D     G + KGS  V +VE +     
Sbjct  153  GWLKKEGARVKSWRRRFFVLRGNSL--SYFNSEDT----GAIAKGSGDVRAVEVNT----  202

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPD  119
            +  G +  F    V    +K   E+++++  L D
Sbjct  203  INNGLDISFDTGRVLRVTAKNSKEMELWLCKLSD  236

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 6/54 (11%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV-PKGSFYVSSVE  78
           G+V K+G   KSW+ RY+V +G   Q++Y+   D A     V PKGS  V +VE
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYY---DTAKVDQKVKPKGSCQVITVE  60

>SPRG_02939
Length=2161

 Score = 38.9 bits (89),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 40/82 (49%), Gaps = 7/82 (9%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            + EGY+ K+GHF  + + +Y+V  G  L   ++ S DA  A  T   G   V+SV     
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDAYMAKTTADVGCSQVASVGD---  518

Query  83   WIG--VMGGKEKPFGFKLVGHA  102
            W G  ++     PF  + V HA
Sbjct  519  WDGHTLLLTYPHPFRIETVAHA  540

 Score = 32.0 bits (71),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 52/123 (42%), Gaps = 10/123 (8%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            +GY+ KRGH   +   RY V +G+ L V Y   R+  H  G  P   + +  V     W 
Sbjct  2    QGYLWKRGHALPTMSRRYCVLDGSMLAV-YQTERE--HELGLTPSSVYEIREVVP---WD  55

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
            G    K+   GF +V     K Y       +++    +W+  +Q +L    ++    + +
Sbjct  56   GHTRLKKYEHGF-VVSTLGGKTY---QCSADTMAAQEQWIAAIQESLAEPYRIVADEIVE  111

Query  145  STK  147
            + K
Sbjct  112  AQK  114

>PHYRA_78815
Length=919

 Score = 38.5 bits (88),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 48/124 (39%), Gaps = 34/124 (27%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG-TVPKGSFYVSSVEKHEY  82
            CEG++ KRG     W+ RY    G  LQ            PG +VPKG+  V        
Sbjct  275  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQ--------DGPGESVPKGAGTV--------  318

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELD------IFVESLPDVNKWLEVVQNALDAAKK  136
                        G KL     +  Y++LD      +  +S   V+KW++ + + LD   K
Sbjct  319  -----------VGLKLGETGSNCVYVQLDSGRVLCVSADSQGQVDKWVQAICSLLDKDPK  367

Query  137  LTRK  140
               K
Sbjct  368  TVEK  371

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (51%), Gaps = 2/51 (4%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            L +  AE   P  C G++ K G   K+W+ RY   +G  L   YF+S + A
Sbjct  781  LRMGTAETEDPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNGA  829

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 35/72 (49%), Gaps = 5/72 (7%)

Query  9   AKLAISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGT  66
           AK  I+   V + + C+  G+  K+G   KSW+ RY V  G +L   YF  R  +   G 
Sbjct  27  AKHVIAVGRVVRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL--IYFAERSPS-GKGI  83

Query  67  VPKGSFYVSSVE  78
             KG   +S VE
Sbjct  84  DEKGRLRISGVE  95

>HYAP_13688
Length=1036

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 61/147 (41%), Gaps = 23/147 (16%)

Query  13   ISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSF  72
            +S   V +   C G++ K G   KSW+ RY    GA L  SY++            KGS 
Sbjct  687  LSPISVNESVGCVGWLRKEGGNVKSWKRRYFTLYGAKL--SYYK----------CEKGSL  734

Query  73   YVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
             + SV+     +GV      P G  +      K  I+ D  VE     ++WL  +Q A  
Sbjct  735  -LRSVDT----VGVTVHPSMPNGLMVATAGGRKLIIQADTNVE----FDRWLNAIQRA--  783

Query  133  AAKKLTRKGMTDSTKSMFGFGASISPQ  159
            A++   R+    +  SM  F  + S +
Sbjct  784  ASRGHDRRSTVSTALSMTDFMETASSE  810

>PYIW_17571
Length=1330

 Score = 38.5 bits (88),  Expect = 0.063, Method: Compositional matrix adjust.
 Identities = 24/118 (20%), Positives = 49/118 (42%), Gaps = 13/118 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK G +R++W+ R+ +       + Y+ S D     G +P        ++     + 
Sbjct  175  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------IQPDTMVLD  226

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMT  143
                   P+ F++   A +     L +  ES  +  +W++  Q  +DA +    +G T
Sbjct  227  RSAAGHAPYRFQVRSDAKT-----LLLEAESRDNQRRWIDSCQELVDAVRADKFRGST  279

>PYAP_14828
Length=604

 Score = 38.5 bits (88),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 44/97 (45%), Gaps = 21/97 (22%)

Query  36   KSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFG  95
            + W+  + V +G D + S          PG   KG   V SVE+   W G      KP+G
Sbjct  201  RKWKRYFAVLSGVDFRYS--------SEPGRASKGFGMVKSVER---WDG------KPYG  243

Query  96   FKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
             K V  + +    E+  +  +  D N+W+++V  A+D
Sbjct  244  IKFVYTSGA----EVPAYCATEQDRNEWIDIVTRAID  276

>PPTG_11714
Length=2444

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG----TVPKGSFYVSSV  77
             EGY+ KRGH   S R RY V  G +L  +Y+ + D +  PG    T P G+F V  V
Sbjct  1143  EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNFRVEIV  1197

 Score = 31.6 bits (70),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 48/120 (40%), Gaps = 5/120 (4%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGY+ KRG    S +  Y V  G  L  S++ ++D A   G VPK    +  +       
Sbjct  2    EGYLWKRGRKVPSMKRHYAVLKGTML--SFYLTQDEAQRSGAVPKRVLEIIDLRIMPSTS  59

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
                        K +    + G   L    +S      WLE +Q+AL    ++ ++ +T+
Sbjct  60   STDTSHPPHMVLKYLD---ADGGGTLQCRADSRETQQDWLEALQHALKEPDRMAQEEITE  116

>PITG_11578
Length=2131

 Score = 38.5 bits (88),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG----TVPKGSFYVSSV  77
             EGY+ KRGH   S R RY V  G +L  +Y+ + D +  PG    T P G+F V  V
Sbjct  952   EGYLMKRGHKIPSMRKRYCVLIGNEL--TYYVTHDDSKNPGGGATTNPLGNFRVEIV  1006

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (56%), Gaps = 2/45 (4%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPK  69
           EGY+ KRG    S +  Y V  G  L  S++ S+D A  PG VPK
Sbjct  2   EGYLWKRGRKVPSMKRHYAVLKGTML--SFYLSQDEAQRPGAVPK  44

>PYIR_16780
Length=1352

 Score = 38.5 bits (88),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 43/154 (28%), Positives = 74/154 (48%), Gaps = 29/154 (19%)

Query  3    ILRVPDAKLAISGAEV---CKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            + R+P A L IS  +V    + T   G++ K+G   +S++ RY+  NG+ L  SY++ + 
Sbjct  137  VARLP-ASLIISDKQVTSTVETTFISGFLRKKGETNRSFKRRYMELNGSIL--SYYKKKP  193

Query  60   AAHA-PGTVPKGSFY---------VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIE  109
              H  P +      Y         VSS++        M  K +P+G  LV  A  + ++ 
Sbjct  194  EKHGIPLSREDKKAYERGNIDLERVSSLQP-------MESKSEPYGIHLVTTA--RTWV-  243

Query  110  LDIFVESLPDVNKWLEVVQNALD-AAKKLTRKGM  142
              I  ES  D ++WL+V+ + +  +A  +T K M
Sbjct  244  --IAAESEQDYHRWLKVLCSVVKFSAVHVTYKRM  275

>SPRG_06021
Length=983

 Score = 38.1 bits (87),  Expect = 0.073, Method: Compositional matrix adjust.
 Identities = 25/111 (23%), Positives = 51/111 (46%), Gaps = 14/111 (13%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI-  84
            GY++KRG +RK+W+ RY +       + Y +S       G VP        +  +   I 
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVP--------ITPNTRVID  190

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
              +G ++ PF F++  H P +    L +   ++ +  KW+  ++  ++  +
Sbjct  191  NSIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>PHYCA_504801
Length=398

 Score = 37.7 bits (86),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   K+W+ R++V  G   Q++Y+++  A   P T  KGSF V +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT--AKVNPTTKAKGSFQVITVE  60

 Score = 34.3 bits (77),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  SYF S D     G   KG  +V +VE
Sbjct  156  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE  202

>PHALS_03540
Length=904

 Score = 38.1 bits (87),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 25/139 (18%)

Query  9    AKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP  68
            A+L    AE  +P  C G++ K G   K+W+ RY   +GA L   YF+S + A       
Sbjct  773  ARLVAMEAE--EPVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKSDNGALLR----  824

Query  69   KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
              SF V           V+  + K    ++      K    L +  E+  D+++WL+ + 
Sbjct  825  --SFTVCH---------VVTLRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLH  869

Query  129  NALDAAKKLTRKGMTDSTK  147
             A+ A K+  +K  TDS++
Sbjct  870  RAIAAEKQ--KKQNTDSSQ  886

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 54/124 (44%), Gaps = 17/124 (14%)

Query  13   ISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            I+   V + + C+  G+  K+G   KSW+ R+ V  G +L   YFE R  +   G   KG
Sbjct  31   IAAGRVARSSYCDHSGWGYKQGSIIKSWKRRFFVLKGREL--IYFEERSPS-GKGIDEKG  87

Query  71   SFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
               +S VE    +   +          LV        +++   VES  ++++W   +  A
Sbjct  88   RLRISGVEYTPEFTNAL----------LVRGELKNQAVKMQ--VESNEEIDEWFVKISEA  135

Query  131  LDAA  134
            L AA
Sbjct  136  LHAA  139

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  51
            CEG++ KRG     W+ RY +  G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>SDRG_14486
Length=308

 Score = 37.7 bits (86),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 4/54 (7%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           +G+V K+G   +SW+ RY+V    + Q+SYF++ +   +  T  KGSF V ++E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTAS--TKAKGSFAVITIE  56

>SPRG_02753
Length=309

 Score = 37.7 bits (86),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 4/54 (7%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           +G+V K+G   +SW+ RY+V    + Q+SYF++ +   +  T  KGSF V ++E
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLK--NKQLSYFDTENVTAS--TKAKGSFAVITIE  56

>SPRG_02502
Length=121

 Score = 35.8 bits (81),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 43/116 (37%), Gaps = 35/116 (30%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV-----------------  67
            EG +TKR  + K WR RY V  G  L   YF  R    AP  V                 
Sbjct  13   EGELTKRSVWLKEWRARYFVLKGNKL---YF-CRAQGEAPHGVIDLSECLTVKSAEEKTN  68

Query  68   ---------PKGSFYV--SSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDI  112
                     P+ ++Y+   S EK + WIG +G     F     G     GY E D+
Sbjct  69   KRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DDGYDEEDV  121

>SDRG_05567
Length=980

 Score = 38.1 bits (87),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 29/133 (22%), Positives = 60/133 (45%), Gaps = 21/133 (16%)

Query  11   LAISGAEVCKPTS-------CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHA  63
            L+ + + V +PT+         GY++KRG +RK+W+ RY +       + Y +S      
Sbjct  115  LSKASSSVAQPTTFTENDIHMAGYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLEL  174

Query  64   PGTVPKGSFYVSSVEKHEYWI-GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNK  122
             G VP        +  +   I   +G ++ PF F++  H P +    L +   ++ +  K
Sbjct  175  VGQVP--------ITPNTRVIDNSIGCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRK  221

Query  123  WLEVVQNALDAAK  135
            W+  ++  ++  +
Sbjct  222  WIRSIRETVELVR  234

>SDRG_01408
Length=916

 Score = 38.1 bits (87),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 31/120 (26%), Positives = 55/120 (46%), Gaps = 14/120 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EG+V K+G +   W  RYLV +G  L  +Y+  +  A + G   +G   ++       ++
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTL--TYYSKQHDARS-GKNLRGRMVLT-------YV  174

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTD  144
            G     +K  GF +     +KG+    +   +  + + W+E++Q ALD A     K   D
Sbjct  175  GPDFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEANGAANKPAQD  230

>PHALS_04098
Length=1183

 Score = 38.1 bits (87),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            EGYV K+G +   W  RYL+ +GA L  +Y+ S++ A +   + +G   V  V    Y
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKEEARSARNM-RGRMTVYKVRPENY  129

>PYU1_G012870
Length=352

 Score = 37.7 bits (86),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 34/53 (64%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   ++W+ R++V  G   Q++Y+++  A+ +P T  KGSF V + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGK--QLTYYDT--ASISPKTKEKGSFQVITAE  55

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (47%), Gaps = 19/107 (18%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++ K G   K+W+ RY   +G  L  SY++S D     G+  KG  +V SVE       
Sbjct  154  GWLKKEGSRIKNWKKRYFTLHGNTL--SYYDSADT----GSAAKGYGHVKSVE-------  200

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
            V G +E             +G + L +  ++  D+ +WL ++  A++
Sbjct  201  VNGERENSLDITF-----ERGRL-LRVSAKNQDDMEQWLCILSEAIE  241

>H310_07701
Length=811

 Score = 37.7 bits (86),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (47%), Gaps = 14/83 (17%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            LA+   E    T  EGYV K+GH  ++WR RY +  G     +Y+ S++ A         
Sbjct  39   LALHPFEDLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHA---------  87

Query  71   SFYVSSVEKHEYWIGVMGGKEKP  93
               +S  EK +  + V G K+ P
Sbjct  88   ---MSDFEKFKGRVTVTGAKKDP  107

>HYAP_11712
Length=558

 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 21/100 (21%)

Query  38   WRVRYLVFNGADLQVSYF---ESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPF  94
            W+ RY V    +LQ+ YF   E  +     G +P  S +         W G      KP 
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTIRGKIPFSSVHA--------WDG------KPN  87

Query  95   GFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
            GF+   + P+       ++ E+  D  KWLEV+Q  +D A
Sbjct  88   GFQF--YTPADHCFR--VYTETAADQLKWLEVMQKCIDNA  123

>PYAP_16734
Length=1314

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 22/110 (20%), Positives = 47/110 (43%), Gaps = 13/110 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + Y++S +     G +        +V      + 
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSEEKLELLGAI--------AVSSDTLVLD  232

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAK  135
               G   P+ F+L       G   L +  E+  +  +W++  Q  +DA +
Sbjct  233  KSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>PYVX_13084
Length=1267

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQV-SYFESRD  59
            GY+ K+G F K+WR RY V    DL V SYF S+D
Sbjct  242  GYLVKQGSFWKTWRRRYFVLR-RDLPVMSYFSSKD  275

>SDRG_02154
Length=822

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 4/54 (7%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            G++ K+G   K+W+ R++V     L   YFE+      P   PKGSF V ++E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKL--TPTLKPKGSFQVLAIER  177

>H310_00912
Length=2182

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 18/125 (14%)

Query  25    EGYV-TKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG--TVPKGSFYVSSVEKHE  81
             EG+V  +R HF  +W+  Y V  G  L  +Y    D A APG  T  +   +V      +
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWL-ATYDTREDFATAPGKPTSKREVVFVG-----D  1850

Query  82    YWIGV-MGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA--AKKLT  138
             ++ GV  GG +  F  + +      G++E   +V+   D  +W++ +Q A+ +  A +L 
Sbjct  1851  WYGGVSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLKADQLV  1904

Query  139   RKGMT  143
              + +T
Sbjct  1905  TRDLT  1909

>H310_01921
Length=341

 Score = 37.4 bits (85),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   KSW+ RY+V    + Q++YFES        +  KGSF V +VE
Sbjct  24  GWVYKQGSMIKSWKKRYMVLK--NKQLTYFESEKVEG--NSKAKGSFQVITVE  72

>CCI10928
Length=1530

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 69/140 (49%), Gaps = 18/140 (13%)

Query  10   KLAISGAEVCK---PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHA---  63
            ++   GA+ C+     +  GY+ KRG   KS+R RY+   G  L  SY++ + +  +   
Sbjct  283  QIETEGAKACQKGTEVTISGYLRKRGETNKSFRRRYMELKGNVL--SYYKKKPSLKSREE  340

Query  64   PGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKW  123
              T  +GS ++ SV      +  +  K + +G  LV  + +      ++ VE+  + ++W
Sbjct  341  NKTYLRGSIHLESVTS----LQPLESKTEKYGVVLVTTSRT-----WELVVENEIEYHRW  391

Query  124  LEVVQNALD-AAKKLTRKGM  142
            L+ + NA++  A  +T K M
Sbjct  392  LKELCNAVEFYAVHITYKRM  411

>HYAP_04457
Length=1203

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (43%), Gaps = 15/129 (12%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            D+  A + A +      EGYV K+G +   W  RYL+ +G  L  +Y+ S++ A +   +
Sbjct  45   DSSSASTSAVMTHEVHWEGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKEDARSARNL  102

Query  68   PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
             +G   +  V    Y      GK   F  +   H          +   S  + + W+E++
Sbjct  103  -RGRMLLLKVRPENY------GKAHGFFLETQSHK------HFHLCCSSELEKDMWVEMM  149

Query  128  QNALDAAKK  136
            Q A++   K
Sbjct  150  QAAIEEGTK  158

>CCA22367
Length=885

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 51/109 (47%), Gaps = 13/109 (12%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE  81
            T  +G++ KRGH +K+W+ RY  F   D Q+ YF + +     G +P     VS      
Sbjct  541  TRRDGFLWKRGHLKKNWKKRY--FRIEDGQLQYF-TENKKLMRGAIPLNGTVVSPG----  593

Query  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
                   G++  F    + H       EL +  E+  ++++W++V+Q A
Sbjct  594  -MTCCPDGRKNYFVISNMNHKS-----ELHLNAETEAEMHEWVQVLQQA  636

>H257_03361
Length=699

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (58%), Gaps = 4/59 (7%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
           +G++ K+G    SW+ RYLV +G +  +SYF+       P    KGSF ++ V+ ++ +
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFDKE--VSNPRAKEKGSFVLAGVQPNKSY  65

 Score = 32.0 bits (71),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            G++ K+G   +SW+ RY V  G +  ++YF++ D
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDTVD  243

>H257_07514
Length=810

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 58/127 (46%), Gaps = 21/127 (17%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            LA+   E    T  EGYV K+GH  ++WR RY +  G     +Y+ S++ A A       
Sbjct  39   LALHPFEDLFETDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKEHAMA-------  89

Query  71   SFYVSSVEKHEYWIGVMGGKEKPF---GFKLVGHAPSKGYIELDIFVESLPDVNKWLEVV  127
                   EK +  + V G K+ P    GF +V  +  K +    ++ ++  +   W+ ++
Sbjct  90   -----DFEKFKGRVTVTGAKKDPSRSNGF-VVTTSIDKVFC---MYTKTPIETELWIRMI  140

Query  128  QNALDAA  134
            + A+  A
Sbjct  141  EKAIQVA  147

>PYIR_13555
Length=355

 Score = 37.0 bits (84),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   ++W+ RY+V  G   Q++Y+++  A+    T  KGSF V +VE
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGK--QLTYYDT--ASLTAKTKEKGSFQVITVE  58

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 28/53 (53%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY   +G  L  SY++S D     G+  KG  +V  VE
Sbjct  160  GWLKKEGSRVKSWKKRYFTLHGNTL--SYYDSADT----GSAAKGYGHVKGVE  206

>SDRG_05608
Length=121

 Score = 35.4 bits (80),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 42/116 (36%), Gaps = 35/116 (30%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG-------------------  65
            EG +TKR  + K WR RY V  G  L   YF  R    AP                    
Sbjct  13   EGELTKRSVWLKEWRARYFVLKGNKL---YF-CRAQGEAPHGMIDLSECLTVKSAEEKTN  68

Query  66   -------TVPKGSFYV--SSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDI  112
                     P+ ++Y+   S EK + WIG +G     F     G     GY E D+
Sbjct  69   KRFCFEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTG---DDGYDEEDV  121

>PHYRA_82888
Length=557

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 43/97 (44%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S +         +G    SSV     W G      KP GF+
Sbjct  42   WKKRYCVIYAGELQIVYFLSLEDFEKRAI--RGKIPFSSVHA---WDG------KPHGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + PS       ++ ++  D  KW++ +Q ++D A
Sbjct  91   F--YTPSDNCFR--VYTDNAEDQQKWIDAMQQSIDQA  123

>HYAP_11713
Length=417

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 21/100 (21%)

Query  38   WRVRYLVFNGADLQVSYF---ESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPF  94
            W+ RY V    +LQ+ YF   E  +     G +P  S +         W G      KP 
Sbjct  42   WKKRYCVIYANELQIVYFLSLEDFERRTIRGKIPFSSVHA--------WDG------KPN  87

Query  95   GFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
            GF+   + P+       ++ E+  D  KWLEV+Q  +D A
Sbjct  88   GFQF--YTPADHCFR--VYTETAADQLKWLEVMQKCIDNA  123

>PITG_00020
Length=927

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 47/124 (38%), Gaps = 34/124 (27%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG-TVPKGSFYVSSVEKHEY  82
            CEG++ KRG     W+ RY    G  LQ            PG +VPKG+  V        
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQ--------DGPGESVPKGAGTV--------  317

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELD------IFVESLPDVNKWLEVVQNALDAAKK  136
                        G KL     +  Y++L       +  +S   V+KW++ + + LD   K
Sbjct  318  -----------VGLKLGEAGSNSVYVQLSSGRVLCVSADSQASVDKWVQAICSLLDKDPK  366

Query  137  LTRK  140
               K
Sbjct  367  TLEK  370

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (55%), Gaps = 2/51 (4%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            L +  AE+ +P  C G++ K G   K+W+ RY   +G  L   YF+S + A
Sbjct  785  LRLGTAEMEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNGA  833

>H310_12448
Length=555

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (47%), Gaps = 17/131 (13%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKS-WRVRYLVFNGADLQVSYFESRDAAHAPGT  66
            DA +A + A    P+ C GYV  +       W+ RY V     L + +++S +AA A G 
Sbjct  7    DALIAKT-ASTAVPSLCTGYVYNQPEKNSIIWKKRYCVLQENSLYIFHYDSAEAA-AKGE  64

Query  67   VPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEV  126
            + KG    SSV     W G      KP GF+   + P+    +  ++ ++  +  KW+  
Sbjct  65   L-KGKIPYSSVHD---WEG------KPHGFQF--YTPTNKCYK--VYTDTEDEKVKWIAT  110

Query  127  VQNALDAAKKL  137
            +Q  LD A ++
Sbjct  111  MQKQLDDAPEI  121

>H257_09028
Length=556

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 62/129 (48%), Gaps = 19/129 (15%)

Query  8    DAKLAISGAEVCKPTSCEGYVTKRGHFRKS--WRVRYLVFNGADLQVSYFESRDAAHAPG  65
            DA +A + + +  PT C GYV  + H + S  W+ RY V     L + ++++ +AA   G
Sbjct  7    DALIAKTSS-IAVPTLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAA-TQG  63

Query  66   TVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLE  125
             + KG    SSV     W G      KP GF+   + P+    +  ++ ++  +  KW+ 
Sbjct  64   EL-KGKIPYSSVHD---WEG------KPHGFQF--YTPTNKCYK--VYTDTEEEKLKWVS  109

Query  126  VVQNALDAA  134
             +Q  LD A
Sbjct  110  TMQKQLDDA  118

>PPTG_16659
Length=916

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 47/124 (38%), Gaps = 34/124 (27%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG-TVPKGSFYVSSVEKHEY  82
            CEG++ KRG     W+ RY    G  LQ            PG +VPKG+  V        
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQ--------DGPGESVPKGAGTV--------  317

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELD------IFVESLPDVNKWLEVVQNALDAAKK  136
                        G KL     +  Y++L       +  +S   V+KW++ + + LD   K
Sbjct  318  -----------VGLKLGESGSNSVYVQLSSGRVLCVSADSQASVDKWVKAICSLLDKDPK  366

Query  137  LTRK  140
               K
Sbjct  367  TLEK  370

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (53%), Gaps = 2/51 (4%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            L +  AE  +P  C G++ K G   K+W+ RY   +G  L   YF+S + A
Sbjct  774  LRLGTAETEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNGA  822

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 34/71 (48%), Gaps = 5/71 (7%)

Query  10  KLAISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
           K  I+   V + + C+  G+  K+G   KSW+ RY V  G +L   YF  R +    G  
Sbjct  28  KHVIAVGRVVRSSYCDHSGWGYKQGSIIKSWKRRYFVLKGREL--IYFSER-SPSGKGID  84

Query  68  PKGSFYVSSVE  78
            KG   +S VE
Sbjct  85  EKGRLRISGVE  95

>PYU1_G005578
Length=301

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 23/49 (47%), Gaps = 4/49 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVF----NGADLQVSYFESRDAAHAPGTVPKG  70
           G++ K G F K WR RY VF    NG      Y   RD A    T PKG
Sbjct  25  GWLKKLGRFSKRWRRRYFVFVSTTNGTKELRHYDACRDVATLLVTTPKG  73

>CCI47145
Length=390

 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 3/53 (6%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G++ K+G   +SW+ RY+V  G   Q+SY+++ D   +     KGSF V +VE
Sbjct  39  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDT-DNILSLKVKEKGSFQVITVE  88

 Score = 32.0 bits (71),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 26/53 (49%), Gaps = 5/53 (9%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  +YF S D     G   KG   V +VE
Sbjct  199  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASEDTG---GASAKGFGRVCAVE  246

>H257_08182
Length=859

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 36/125 (29%), Positives = 58/125 (46%), Gaps = 26/125 (21%)

Query  12   AISGAEVCKPTSC----EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
            +++ A   + TSC    EG++ K+G   KSW+ RY V +G DL     E R      GTV
Sbjct  647  SLTSAAFSRRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDLAYYKDELR------GTV  700

Query  68   -PKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEV  126
              +G+F           + V    +KP+   ++ +    G + L + + S  D   WL  
Sbjct  701  LGQGTF-----------VHVKPNPDKPWSLVIILNT---GRL-LVVALSSEHDEATWLHA  745

Query  127  VQNAL  131
            +Q+AL
Sbjct  746  LQSAL  750

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 10/66 (15%)

Query  9    AKLAISGAEVCK------PTSC---EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            +K+A + A+ C       PTSC    G++ K G   KSW+ RY   +G  L V Y +  D
Sbjct  418  SKVAAAVAQTCPSPVVNTPTSCAHHRGWLQKEGLAIKSWKRRYFTLHGRML-VYYKDMED  476

Query  60   AAHAPG  65
              HA G
Sbjct  477  GGHAVG  482

>SPRG_16312
Length=261

 Score = 36.2 bits (82),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  21  PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
           P    GYV K+G F K+W+ R++V +  D  + Y+ S  A       P+G F V+SV
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRFMVLH--DDTLFYYVSERAM----AKPRGFFRVTSV  88

>PPTG_14626
Length=1055

 Score = 37.0 bits (84),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 54/124 (44%), Gaps = 31/124 (25%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHE--  81
            C G++ K G   KSW+ RY    G+ L  SY++S       G++ + S  V +VE H   
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSE-----KGSLLR-SVSVINVEPHPSV  765

Query  82   ---YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLT  138
                 +  +GG+      KL+  A S G            + NKWL  +Q A+  A +  
Sbjct  766  SLGLTVSTVGGR------KLIVQAESNG------------EFNKWLNAIQEAVAEASERN  807

Query  139  RKGM  142
              G+
Sbjct  808  STGI  811

>SDRG_08800
Length=881

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
           EG+V+K+GH  ++W++RY       L  SY+ES++ A
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLESNLL--SYYESKEDA  100

>CCA19097
Length=688

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 49/92 (53%), Gaps = 10/92 (11%)

Query  1    MNILRVPDAKLAISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR  58
            +N+   P  ++++   +    ++ +  G++ K+G   K+W+ R+ +  G +L  SYF++ 
Sbjct  117  VNVASDPVIRMSLDSTKAPSESTIQYSGWLVKQGGRVKNWKRRFFLLRGDNL--SYFDT-  173

Query  59   DAAHAPGTVPKGSFYV--SSVEKHEYWIGVMG  88
                + G V KG+ YV  SS +  + W+  +G
Sbjct  174  ---ESTGAVAKGTLYVIASSQKVLQEWLHTLG  202

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 51/111 (46%), Gaps = 18/111 (16%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G+V K+G   K+W+ RY+V NG  L+  Y+   D+A +     KGS  + SVE       
Sbjct  9    GWVHKQGAVIKTWKRRYMVLNGNVLK--YY---DSALSIKMEEKGSVQILSVEMSG---S  60

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK  136
            +  G+        + H   KG   L I+ +S     +W E + N +   +K
Sbjct  61   IQNGR--------IMHG--KGGRVLKIYTDSSMQNKEWFEAITNVVCGIEK  101

>CCA24531
Length=374

 Score = 36.2 bits (82),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 3/53 (6%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G++ K+G   +SW+ RY+V  G   Q+SY+++ D   +     KGSF V +VE
Sbjct  27  GWIFKQGSLVRSWKKRYMVLKGR--QLSYYDT-DNILSLKVKEKGSFQVITVE  76

 Score = 31.6 bits (70),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  +YF S D     G   KG   V +VE
Sbjct  184  GWLWKEGCRFKSWKKRYFVLRGNSL--AYFASEDT----GASAKGFGRVCAVE  230

>CCA19033
Length=1883

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
             EGY+ KRGH   S R RY V    +  + YFE+++ A
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKEDA  1057

>H310_13627
Length=678

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 57/125 (46%), Gaps = 16/125 (13%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP---KGSFYVSSVEKHEY  82
            G++ K+GH  K+W+ R+ V +G+ L+  YF     A  P +     KG   +   +   +
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR--YFSEDVDATVPKSTTHKLKGEVLLFHKDTTVH  327

Query  83   WIGV-MGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKG  141
            ++ + + G++  F     G     G   L +   SL +   W+  +++A+     L R+ 
Sbjct  328  YVDIHLSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAI-----LCRES  377

Query  142  MTDST  146
              DS+
Sbjct  378  YQDSS  382

>H310_02933
Length=1053

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 25/109 (23%), Positives = 49/109 (45%), Gaps = 16/109 (15%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            +GY++K+G +RK+W+ RY +    +  + Y +S +     G VP        + K    +
Sbjct  179  QGYLSKQGSWRKNWKRRYFILRIDEPSLVYCDSEENREVLGLVP--------ITKDTTIV  230

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNK-WLEVVQNALD  132
             V         F++   +P++      +     PDV K W++ +Q  +D
Sbjct  231  DVSSATST-LAFEV--SSPNRAL----LLEAPSPDVFKAWIDAIQETID  272

>SPRG_08834
Length=825

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (54%), Gaps = 4/54 (7%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEK  79
            G++ K+G   K+W+ R++V     L   YFE+      P   PKGSF V  +E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLH--YFETDKL--TPTLKPKGSFQVLVIER  177

>PYAP_19085
Length=553

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 47/98 (48%), Gaps = 16/98 (16%)

Query  38   WRVRY-LVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGF  96
            W+ RY +++ G  LQ+ YFES++         +G    +SV K   W G      KP GF
Sbjct  38   WKKRYCVIYKGGQLQIVYFESQEDFEKRNV--RGKIPFASVHK---WDG------KPNGF  86

Query  97   KLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
            +   + P+       ++ E+  +  +W+  +Q  +DAA
Sbjct  87   QF--YTPTNQCYR--VYTETEAEQAQWIATMQQLIDAA  120

>PHALS_06699
Length=884

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 47/109 (43%), Gaps = 11/109 (10%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S  G++ KRGH  K+W+ RY V + + L+  Y+         G V     +      H  
Sbjct  335  SMSGWLRKRGHVCKNWKDRYFVLHKSVLR--YYSDACCTKLKGEV---LLFHPQTCVHYV  389

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             + V GG++  F  + VG         L +  E L D   W+  +++AL
Sbjct  390  DVHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIEDAL  432

>PYAP_15732
Length=333

 Score = 35.8 bits (81),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 35/146 (24%), Positives = 59/146 (40%), Gaps = 30/146 (21%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFES------------RDAAHAPGTVPKGSFY  73
            G++  RG     WR RY   NG  L  +YF +             +   + GT P+G   
Sbjct  75   GWLWMRGSRIGRWRHRYFCLNGTLL--TYFMTFPSEEFLRQASPENVCFSDGTRPRGVIR  132

Query  74   VSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
            V+ VE+ +          K  GFK+ G         ++I    + + N+WL  ++     
Sbjct  133  VAHVEESD---------TKTLGFKVFGTCGR----SIEIRAHRVDERNEWLRALKT---P  176

Query  134  AKKLTRKGMTDSTKSMFGFGASISPQ  159
            A++ +R   T S + +    AS  P+
Sbjct  177  ARRKSRSWSTGSAEDLTLSLASFDPE  202

>PYAP_22195
Length=901

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 45/107 (42%), Gaps = 13/107 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EGY+ K+G   K W+ R+ V NG  L  SY+ SR        +P  +  V      E W 
Sbjct  38   EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISRKDRKPNAVIPLETCTVEDGGLSETW-  94

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
                    P  +   G   + G +   +  E    VN WL V++NA+
Sbjct  95   ------NSPRIYLTDG---TSGVMYC-LSAEDAEVVNAWLTVLRNAV  131

>SPRG_01654
Length=923

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  21  PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
           P   EGY+ KRG +   W   Y+V +G DL  +YF+  D
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--TYFDKSD  58

>SDRG_03175
Length=934

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  21  PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
           P   EGY+ KRG +   W   Y+V +G DL  +YF+  D
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFDKSD  58

>PHYSO_343629
Length=977

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNG  47
            EGYVTKRGH  ++W++R+    G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>SPRG_05449
Length=723

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 25/37 (68%), Gaps = 2/37 (5%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
           EG+V+K+GH  ++W++RY       L  SY+ES++ A
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLESNLL--SYYESKEDA  100

>HYAP_13690
Length=377

 Score = 35.8 bits (81),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 8/74 (11%)

Query  5    RVPDAKLAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAP  64
            R+  A L+I+     K  +  G++ K G   KSW+ RY V  G+ L  SYF S D     
Sbjct  119  RLEPAPLSINVG--TKQVTHTGWLKKEGARVKSWKRRYFVLRGSVL--SYFNSEDT----  170

Query  65   GTVPKGSFYVSSVE  78
            G   KG  +V +VE
Sbjct  171  GAAAKGYGHVRAVE  184

>PHYSO_478611
Length=522

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G+V K+G   K+W+ R++V  G   Q++Y+++  A   P    KGSF V +VE
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGR--QLTYYDT--AKVDPTVKAKGSFQVITVE  189

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  SYF S D     G   KG  +V +VE
Sbjct  283  GWLKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE  329

>PYAP_23478
Length=897

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 49/113 (43%), Gaps = 11/113 (10%)

Query  19   CKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            C   S  G++ K GH RK+W++RY V + + L+  Y+         G V     +  + +
Sbjct  373  CFLDSMCGWLRKLGHVRKNWKLRYFVLDKSVLR--YYSDEGMTRLKGEV---LLFHPATQ  427

Query  79   KHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
             H   I    GK+  F  + VG         L +  E L D   W+  +++AL
Sbjct  428  VHYVDIHESRGKDHTFAIQ-VGPE-----YTLLLQAERLADRENWMYCIEDAL  474

>SDRG_02135
Length=306

 Score = 35.8 bits (81),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (67%), Gaps = 2/33 (6%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57
           EGY+ K+GH  K+WR RY  F   D  ++Y++S
Sbjct  2   EGYLLKQGHVVKNWRRRY--FRLVDASLAYYDS  32

>H257_11802
Length=783

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (46%), Gaps = 12/127 (9%)

Query  14   SGAEVCKPTS---CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            S  +V  PT+    EGY+ K+    K+W  RY+     D  +SY++S+  A    T  +G
Sbjct  49   SVIDVTCPTTEVEWEGYLYKQSKIVKTWTPRYVTLK--DGLISYYKSKKHA-VERTQNRG  105

Query  71   SFYVSSVEKHEYWIGVMGGK--EKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQ  128
            S+ VS+V+K     G  G K      GF +V    +   + +     S  +   WL +++
Sbjct  106  SWSVSAVQKTIPSTGFGGSKLHASTLGFSIV----TTNQLLVHFVAISPAEREMWLHMLE  161

Query  129  NALDAAK  135
                AAK
Sbjct  162  KCCAAAK  168

>PPTG_06991
Length=557

 Score = 35.8 bits (81),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 43/97 (44%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S +         +G    SSV     W G      KP GF+
Sbjct  42   WKKRYCVIYAGELQIVYFLSLEDFEKRAI--RGKIPFSSVHA---WDG------KPNGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + P+       ++ +S  +  KW++V+Q  +D A
Sbjct  91   F--YTPADNCFR--VYTDSSEEQQKWIDVMQQCIDNA  123

>PYVX_16095
Length=1137

 Score = 36.2 bits (82),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 46/112 (41%), Gaps = 13/112 (12%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK+G +R++W+ R+ +       + YF S +     G +        +V +    + 
Sbjct  96   GVLTKQGSWRRNWKTRFFILRRDFPSLCYFTSEEKLELLGEI--------AVTEDTLVLD  147

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKL  137
                   P+ F++     +     L +  ES  D  +W+E  Q   DA + L
Sbjct  148  RSSAGHAPYRFQVRSEDKA-----LLLEAESRDDQRRWMESCQELADALRAL  194

>PYAR_24323
Length=883

 Score = 35.8 bits (81),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 20/132 (15%)

Query  3    ILRVPDAKLAIS--GAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDA  60
            + R+P + + +    A+V       GY+ KRG   +S++ RY+  NG+ L  +Y++ +  
Sbjct  131  VARIPASLIIMDDLAAKVTHENDISGYLRKRGEHNRSYKRRYMELNGSVL--AYYKKKPE  188

Query  61   AHA-------PGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIF  113
             +          +  +G+  +  V      I  +  K +PFG  LV    +       I 
Sbjct  189  KNGIPLSREDKKSCERGAIDLDRVTS----IQPIDAKSEPFGINLVTTNRT-----WSIA  239

Query  114  VESLPDVNKWLE  125
             ES  D  +WL+
Sbjct  240  AESDQDYQRWLK  251

>PHYCA_504712
Length=208

 Score = 35.0 bits (79),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 30/126 (24%), Positives = 53/126 (42%), Gaps = 21/126 (17%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            L +   E  +P  C G++ K G   K+W+ RY   +G  L   YF+S + A         
Sbjct  72   LRLGTVETEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNGALL------R  123

Query  71   SFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
            SF V           V+  + +    ++      K    L +  E+  D+++WL+ +  A
Sbjct  124  SFTVCH---------VVTLRTRRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRA  170

Query  131  LDAAKK  136
            + A K+
Sbjct  171  IAAEKR  176

>CCI40991
Length=801

 Score = 35.8 bits (81),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  22   TSCEGYVTKRGHFRKSWRVRYLVFNGA  48
            T  EGY+ K+GH  +SWR RY V +G 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>PHYSO_484541
Length=911

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 53/126 (42%), Gaps = 21/126 (17%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            L +  AE   P  C G++ K G   K+W+ RY   +G  L   YF+S + A         
Sbjct  768  LRMGTAETEDPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNGALLR------  819

Query  71   SFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
            SF V           V+  + K    ++      K    L +  E+  D+++WL+ +  A
Sbjct  820  SFTVCH---------VVTLRTKKLCLEITTEVGRK----LLVASETQADLDRWLDHLHRA  866

Query  131  LDAAKK  136
            + A K+
Sbjct  867  IAAEKR  872

 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 32/124 (26%), Positives = 46/124 (37%), Gaps = 34/124 (27%)

Query  24   CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPG-TVPKGSFYVSSVEKHEY  82
            CEG++ KRG     W+ RY    G  LQ            PG +VPKG+  V        
Sbjct  273  CEGWLYKRGQRSTEWQRRYFRLKGYKLQYQ--------DGPGESVPKGAGTV--------  316

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELD------IFVESLPDVNKWLEVVQNALDAAKK  136
                        G KL     +  Y++L       +  +S   V+KW++ +   LD   K
Sbjct  317  -----------VGLKLGETGSNCVYVQLGSGRVLCVSADSQASVDKWVKAICGLLDKDPK  365

Query  137  LTRK  140
               K
Sbjct  366  TLEK  369

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (48%), Gaps = 5/71 (7%)

Query  10  KLAISGAEVCKPTSCE--GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV  67
           K  I+   V + + C+  G+  K+G   KSW+ RY V  G +L   YF  R +    G  
Sbjct  28  KNVIAVGRVVRSSYCDHSGWGLKQGSIIKSWKRRYFVLKGREL--IYFAER-SPSGKGID  84

Query  68  PKGSFYVSSVE  78
            KG   VS VE
Sbjct  85  EKGRLRVSGVE  95

>SDRG_06288
Length=641

 Score = 35.8 bits (81),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (55%), Gaps = 4/55 (7%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
           G+V K+G   KSW+ R+LV  G    VSY++   + H P    KGS  +  V ++
Sbjct  7   GFVFKQGSLIKSWKKRFLVVQGR--HVSYYDR--SVHEPDPREKGSLVLGDVTQN  57

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (51%), Gaps = 7/51 (14%)

Query  20   KPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKG  70
            KP  C G + K+G   K+WR RY   +G   Q+SY    DA   P   PKG
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSY---SDAETEP---PKG  301

>HYAP_09304
Length=1144

 Score = 35.8 bits (81),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 60/137 (44%), Gaps = 14/137 (10%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            GY+ K+G F KSWR R+ +       +SY+ S +     G +        ++++H   + 
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTSAEELAKLGEI--------TIDEHT-TVQ  175

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL-DAAKKLTRKGMTD  144
            +     +P  F +      K  + L I  +   D++ W+  +Q  +   A+  TR    +
Sbjct  176  MTPRDGEPHRFTIEN---DKRKLTL-IAEQGKADMDAWISCIQGCITQRARSTTRILSAN  231

Query  145  STKSMFGFGASISPQLQ  161
             +    G G S+S QLQ
Sbjct  232  GSILRRGEGGSVSAQLQ  248

>CCA17832
Length=1125

 Score = 35.8 bits (81),  Expect = 0.49, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 19/40 (48%), Gaps = 1/40 (3%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAP  64
           EGY+ KR  + K W   Y V NG  L   Y    DA H P
Sbjct  39  EGYLQKRSDWLKHWETFYFVLNGRYL-YCYLSEEDARHQP  77

>PYAR_19122
Length=554

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 46/97 (47%), Gaps = 16/97 (16%)

Query  38   WRVRY-LVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGF  96
            W+ RY ++++G+ LQ+ Y+ES+D         +G    +SV K   W G      KP GF
Sbjct  36   WKKRYCVIYSGSTLQIVYYESQDDFEKRNI--RGKIAFASVHK---WDG------KPNGF  84

Query  97   KLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDA  133
            +   + PS       ++  +  +   WL  +Q  +DA
Sbjct  85   QF--YTPSNQCYR--VYTATEDEQRNWLSTMQRLIDA  117

>SDRG_03531
Length=255

 Score = 35.0 bits (79),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (5%)

Query  36  KSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSS  76
           K W+ R+ V  G  L  SYF + D A+ PG  PKG+  V +
Sbjct  31  KKWKRRFFVLEGRRL--SYFGNEDEANDPGRAPKGAITVCA  69

>PYVX_14527
Length=1269

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 33/53 (62%), Gaps = 4/53 (8%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G+V K+G   ++W+ R++V +G   Q++Y+++  A   P    KGSF + +VE
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGR--QLTYYDT--ARLTPSVKAKGSFTLITVE  951

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (45%), Gaps = 19/107 (18%)

Query  26    GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
             G++ K G   KSW+ R+    G  L  SYF+S D     G   KG  ++ +VE ++    
Sbjct  1049  GWLKKEGSRVKSWKRRFFALRGDAL--SYFDSEDT----GAAAKGYGHIKTVEVNDQ---  1099

Query  86    VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
             V  G +  F    V          L +  ++ PD+  WL  + +A++
Sbjct  1100  VANGLDVTFDNGRV----------LRVSAKTRPDMELWLCKLSDAIE  1136

 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            G+V K G   +SW+ R+LV  GADL  +Y+++ D
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKNTD  620

>PYAP_16297
Length=2466

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query  25    EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
             EGY+ KRGH   S R RY +     L  +Y+ + + +      P GSF V  V     W 
Sbjct  1168  EGYLVKRGHLVPSMRKRYCMLVKNVL--TYYLTHEDSRNTEIQPLGSFRVEIVSD---WH  1222

Query  85    GVMGGKEKPFGFKLVGH  101
             G    +   +G +L  H
Sbjct  1223  GKTTTQTYEYGMELETH  1239

>PYIR_15118
Length=1222

 Score = 35.4 bits (80),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (43%), Gaps = 15/107 (14%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP-KGSFYVSSVEKHEYWI  84
            GY+ K+G F K+WR RY +       +SY++S +     G +   G+  V    +  +  
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEITVDGTTGVRPTPREGF--  250

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
                    PF F +V H   K  +   +  E  P  + W+  +QN +
Sbjct  251  --------PFQF-VVEHEGRKLTL---VAEEGKPSTDAWISNIQNCI  285

>H257_03363
Length=316

 Score = 35.0 bits (79),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 31/53 (58%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   KSW+ RY+V    + Q++YFE+        +  KGSF V ++E
Sbjct  8   GWVYKQGSMVKSWKKRYMVLK--NKQLTYFENEKIEG--NSKAKGSFQVITIE  56

>H310_05457
Length=269

 Score = 34.7 bits (78),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (51%), Gaps = 5/51 (10%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSS  76
           GYV +     K W+ R++V  G DL  SY+ +   A  P T PKG   V +
Sbjct  39  GYVYR---LSKKWKRRFMVLEGRDL--SYYGNETEAMEPSTPPKGRIRVCA  84

>PYIR_16539
Length=1346

 Score = 35.4 bits (80),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 47/118 (40%), Gaps = 13/118 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G +TK G +R++W+ R+ +       + Y+ S D     G +P        +      + 
Sbjct  171  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSEDKLELLGEIP--------ILPDTMVLD  222

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMT  143
                   P+ F++     +     L +  ES  +  +W++  Q  +DA +    +G T
Sbjct  223  RSASGHAPYRFQVRSETKT-----LLLEAESRDNQRRWIDSCQELVDAVRADKFRGST  275

>PHYRA_73430
Length=395

 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 6/53 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
            G++ K G   KSW+ RY V  G  L  SYF S D     G   KG  +V +VE
Sbjct  152  GWIKKEGARVKSWKRRYFVLRGNAL--SYFNSEDT----GAAAKGYGHVRAVE  198

 Score = 34.7 bits (78),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 32/53 (60%), Gaps = 4/53 (8%)

Query  26  GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVE  78
           G+V K+G   ++W+ R++V  G   Q++Y+++  A   P    KGSF V +VE
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGR--QLTYYDT--AKVDPTVKAKGSFQVITVE  60

>H310_06667
Length=896

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (46%), Gaps = 2/61 (3%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
           EGY+ K+G   K W+ R+ V +G  L  SYF ++        +P  +  V      E W 
Sbjct  37  EGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTKADKTPSAVIPLETATVQGGGTSERWN  94

Query  85  G  85
           G
Sbjct  95  G  95

>H257_09823
Length=654

 Score = 35.0 bits (79),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP---KGSFYVSSVEKHEY  82
            G++ K GH RK+W+ R+ V +G+ LQ  YF     A  P +     KG   +   +   +
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ--YFTDDVDATTPKSKTHKLKGEVLLFHKDTTVH  322

Query  83   WIGV-MGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNAL  131
            ++ + + G++  F  +  G     G   L +   SL +   W+  ++ A+
Sbjct  323  YVDIHLTGRDYTFAVETSG-----GDYSLVLQAASLDEREDWIFAIEEAI  367

>PYU1_G012274
Length=873

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 13/81 (16%)

Query  23   SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEY  82
            S EGY+ K+    +SW+  Y V  G  +  +Y+ESR+      T   G  ++ SVE    
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESRE-DFIMNTKLIGRIHIQSVEDDH-  365

Query  83   WIGVMGGKEKPFGFKLV--GH  101
                MG   KP GF+++  GH
Sbjct  366  ----MG---KPNGFRILTEGH  379

>H310_06666
Length=887

 Score = 35.0 bits (79),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  25  EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
           EGY+ K+G   K W+ R+ V +G  L  SY+ S+        +P  S  V      E W
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSKLEKKPNAVIPLESATVQDGGTSETW  80

>PHYKE_5588
Length=751

 Score = 34.7 bits (78),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query  11   LAISGAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57
            L +   +V +P  C G++ K G   K+W+ RY   +G  L   YF+S
Sbjct  428  LRMGAVDVEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  472

>H257_10063
Length=1041

 Score = 34.7 bits (78),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 23/110 (21%), Positives = 47/110 (43%), Gaps = 18/110 (16%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP--KGSFYVSSVEKHEY  82
            +GY++K+G +RK+W+ RY +    +  + Y +S +     G VP  K +  +        
Sbjct  168  QGYLSKQGSWRKNWKHRYFILRIDEPALVYCDSEENREVLGWVPITKDTTIMDVSSATST  227

Query  83   WIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
            W   +   ++     L+  APS    +             W++ +Q+ +D
Sbjct  228  WAFEVASPQR----ALLLEAPSPAVFK------------HWIDAIQDTID  261

>H257_03931
Length=695

 Score = 34.7 bits (78),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            PTS  G + K+ +  K+W+ R++V  G     S F       +  T P+G   +S V+ H
Sbjct  108  PTSKSGVLVKQANHLKNWKKRFMVLRGQ----SMFYYVSGTSSEETFPRGVISLSGVDVH  163

Query  81   EYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
                      +K F F+ + H     Y  L +  ++  D+ +WL  +++A
Sbjct  164  PLDTAKF---KKQFCFE-ISHP---NYRSLYMVAKNEADLVQWLSSIKSA  206

>PYIW_17818
Length=1188

 Score = 34.7 bits (78),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 2/44 (5%)

Query  16   AEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            A V +P    G++ K+G   KSW+ RY V  G  LQ  YF++ D
Sbjct  495  AIVAEPEIKYGWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDNID  536

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR---------DAAHAPG  65
            P  C G++ K G   K+W+ RY   +G  L+  YF+S          DA HA G
Sbjct  827  PGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR--YFKSERKKLLGSYTDALHAAG  878

>HYAP_06101
Length=984

 Score = 34.7 bits (78),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 27/120 (23%), Positives = 54/120 (45%), Gaps = 12/120 (10%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++TK+GH  KSW+ R+ V   AD   +Y++++      G +      V SV+  +  + 
Sbjct  143  GWLTKQGHLWKSWKTRFFVL-FADGTFAYYKNKGRKKIKGCMQLNDGVV-SVQHVDIRVA  200

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGMTDS  145
                 EK + F++      KG+ +L  +  S  +   W+  +++    A       +T +
Sbjct  201  -----EKAYAFQI-----EKGFYKLLCYCCSQFEAEIWVAALRSVRRVAPPCYEMDLTST  250

>SPRG_09805
Length=838

 Score = 34.7 bits (78),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 6/59 (10%)

Query  26  GYVTKRGHFRKSWRVRYLVF-NGADL-QVSYFESRDAAHAPGTV----PKGSFYVSSVE  78
           G++ K G F K W+ RY VF  G D  ++ Y++S  A H  G +      G  Y+ +V+
Sbjct  19  GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSTTATHPEGVMSLADATGVCYLDTVQ  77

>HYAP_08248
Length=784

 Score = 34.7 bits (78),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQV  52
            G +TKRGHF K+W  R+LV +   LQV
Sbjct  84   GALTKRGHFFKAWLPRHLVLSRGALQV  110

>PITG_15553
Length=557

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 25/97 (26%), Positives = 42/97 (43%), Gaps = 15/97 (15%)

Query  38   WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFK  97
            W+ RY V    +LQ+ YF S +         +G    SS+     W G      KP GF+
Sbjct  42   WKKRYCVIYAGELQIVYFLSLEDFEKRAI--RGKIPFSSIHP---WDG------KPNGFQ  90

Query  98   LVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAA  134
               + P+       ++ +S  +  KW++ +Q  +D A
Sbjct  91   F--YTPADNCFR--VYTDSAEEQQKWIDTMQQCIDNA  123

>SDRG_06927
Length=847

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 6/59 (10%)

Query  26  GYVTKRGHFRKSWRVRYLVF-NGADL-QVSYFESRDAAHAPGTV----PKGSFYVSSVE  78
           G++ K G F K W+ RY VF  G D  ++ Y++S  A H  G +      G  Y+ +V+
Sbjct  20  GWLRKLGRFSKRWQRRYFVFVKGTDAKELRYYDSSTATHPEGVMSLADATGVCYLDAVQ  78

>CCI42088
Length=1007

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (47%), Gaps = 15/107 (14%)

Query  25   EGYVTKRGHFRKSWRVRYL-VFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYW  83
            +G++ KRGH +K+W+ R+  V NG   Q+ YF + +     G +P     VS        
Sbjct  666  DGFLWKRGHLKKNWKKRFFRVENG---QLQYF-TENRKLMKGAIPLNGTVVSPG-----M  716

Query  84   IGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
                 G++  F    + H       EL +  E+  ++++W+E +Q A
Sbjct  717  TCCPDGRKNYFVISNMSHTK-----ELHLNAETEAEMHEWIEALQRA  758

>PHYKE_4910
Length=375

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            P +  G+V K G   +SW+ R+LV  GA+L  +Y+++ D
Sbjct  125  PVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKNTD  161

>H310_07070
Length=680

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 27/110 (25%), Positives = 51/110 (46%), Gaps = 11/110 (10%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKH  80
            PTS  G + K+ +  K+W+ R++V  G     S F       +  T P+G   +S V+ H
Sbjct  118  PTSKSGVLVKQANHLKNWKKRFMVLRGQ----SMFYYVSGTTSEETYPRGVISLSGVDVH  173

Query  81   EYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
               +      +K F F+ + H     Y  L +  ++  D+ +W+  +++A
Sbjct  174  PLDVSKF---KKQFCFE-ISHP---NYRSLYMVAKNDADLVQWMSSIKSA  216

>PYAP_19753
Length=1340

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 57/129 (44%), Gaps = 20/129 (16%)

Query  5    RVPDAKLAISGAEVCKPT---SCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAA  61
            R+P A L I  ++  K T      GY+ KRG   +S++ RY+  NGA L  SY++ +   
Sbjct  137  RIP-ASLIIMDSQTSKITHENDISGYLRKRGEHNRSYKRRYMELNGATL--SYYKKKPEK  193

Query  62   HAPGTVP-----KGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVES  116
            +    +P     K S+   S++       +     +PFG  LV    +       I  ES
Sbjct  194  NG---IPLSRDDKKSYERGSIDLDRV-SSIQPIDSEPFGMHLVTTTRTWA-----ISAES  244

Query  117  LPDVNKWLE  125
              D  +WL+
Sbjct  245  EQDFLRWLK  253

>PYIR_13168
Length=1353

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 49/105 (47%), Gaps = 12/105 (11%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWIG  85
            G++TK+GH  K+W+ R+ V   AD   +Y++++      G +      V+        IG
Sbjct  116  GWLTKQGHMWKTWKTRFFVLY-ADGTFAYYKNKGKKKMQGCLMLNDGIVTVKHVDVRKIG  174

Query  86   VMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNA  130
                  KP+ F++      KG+ +L  +  S  +   W+  +++A
Sbjct  175  ------KPYVFQV-----EKGFYKLICYCCSQLEAELWVSALRSA  208

>PYIR_22667
Length=749

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 53/121 (44%), Gaps = 26/121 (21%)

Query  21   PTS---CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVS--  75
            PTS    EG + KRGH  K+W+ R+      +L+  Y E+++     G+VP  S  VS  
Sbjct  398  PTSYIHMEGCLLKRGHVNKNWKNRFFRIEKGELRY-YTENQEELK--GSVPLKSTIVSPG  454

Query  76   ---SVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALD  132
                 +  +Y+  V+  ++  F   L  H  S               ++KW+E +Q A  
Sbjct  455  MAQCSDGRKYYF-VLTSRDGKFEMHLNAHNES--------------SMHKWIEAIQEAQT  499

Query  133  A  133
            A
Sbjct  500  A  500

>PYAP_17800
Length=780

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 51/117 (44%), Gaps = 18/117 (15%)

Query  21   PTS---CEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSV  77
            PTS    EG + KRGH  K+W+ R+      +L+  Y E++D     G+VP     VS  
Sbjct  434  PTSYIHIEGCLMKRGHVNKNWKNRFFRIEKGELRY-YTENQDQLR--GSVPLKGTIVSP-  489

Query  78   EKHEYWIGVMGGKEKPFGFKLVGHAPSK-GYIELDIFVESLPDVNKWLEVVQNALDA  133
                      G  + P G K      SK    E+ +   +   +++W+E +Q A  A
Sbjct  490  ----------GMTQAPDGRKNYFVLTSKDATFEMHLSAPNEQSMHRWIEAIQEAQTA  536

>H310_06449
Length=1361

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 51/117 (44%), Gaps = 20/117 (17%)

Query  19   CKPTS-C---EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP--KGSF  72
            C P S C    G++ KRGH   +W+ R+ V   +D ++ YF+  +   + G V    G  
Sbjct  92   CTPGSPCIVHAGWLIKRGHNWHTWKRRWFVLT-SDAKLEYFKKPNRKKSKGKVDLNDGIV  150

Query  73   YVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQN  129
             V  V+ H          E  + F +     +KG+  L    E+  D + W+  ++N
Sbjct  151  QVQFVDVHHV--------EHMYAFSI-----TKGFYTLLCSCETGDDADTWVRNLRN  194

>CCA27157
Length=553

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 54/123 (44%), Gaps = 24/123 (20%)

Query  20   KPTSCEGYVTKRGHFRKS-------WRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSF  72
            +P    G +  RG   K        W+ RY V     LQ+ Y+E+ +       V +G  
Sbjct  17   EPQHLNGEILLRGFLYKRPEQNSLLWKKRYCVIVKNSLQIVYYENEEDFEK--GVIRGKI  74

Query  73   YVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPS-KGYIELDIFVESLPDVNKWLEVVQNAL  131
              +SV K   W G      KP GF+   + PS K Y    ++ ++  +  +W+ ++Q  +
Sbjct  75   PFASVHK---WDG------KPNGFQF--YTPSNKCY---RVYTDTPKEQEEWVAIMQAQI  120

Query  132  DAA  134
            DAA
Sbjct  121  DAA  123

>PYAR_21162
Length=1135

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 4/72 (6%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVP----KGSFYVSSVEKH  80
            EG++ +RG F +SW++RY +       +     R +  A G +P      +F  SS    
Sbjct  221  EGWLGQRGTFSRSWKLRYFILRCDTSSLICLRDRASLVAVGVIPIDKHTSTFSESSPNPD  280

Query  81   EYWIGVMGGKEK  92
            ++   V+ G+ +
Sbjct  281  QFQFLVIQGQHR  292

>PHALS_06336
Length=511

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query  21   PTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRD  59
            P +  G+V K G   +SW+ R+LV  GA+L  +Y+++ D
Sbjct  131  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKNTD  167

>H310_04842
Length=1081

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 50/116 (43%), Gaps = 14/116 (12%)

Query  25   EGYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTVPKGSFYVSSVEKHEYWI  84
            EG V K+G +   W  RYLV +G  L+  Y+  +D A   G   +G   ++ V       
Sbjct  118  EGQVRKKGDWLPRWESRYLVLDGTVLR--YYSKQDDARL-GKHLRGKLILTHVSPE----  170

Query  85   GVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKKLTRK  140
             +   KE  F  +  G      ++  D  +E     + W+E++Q A+  A    R+
Sbjct  171  -IHKKKEHTFAVETTGR--KMFFMSCDTELEK----DMWVEMIQAAISEAAAPQRQ  219

>PYIW_18911
Length=1196

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 30/67 (45%), Gaps = 11/67 (16%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESR-----------DAAHAPGTVPKGSFYV  74
            GY+ K+G F K+WR RY +       +SY++S            DA  A    P+  F  
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDSAEELTKLGEIAVDATTAVRPTPREGFPF  233

Query  75   SSVEKHE  81
              V +H+
Sbjct  234  QFVVEHD  240

>CCA27255
Length=1125

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 23/115 (20%), Positives = 52/115 (45%), Gaps = 21/115 (18%)

Query  26   GYVTKRGHFRKSWRVRYLVFNGADLQVSYFESRDAAHAPGTV--PKGSFYV--SSVEKHE  81
            GY+ K+G +R++W+ R+ +         Y++S+   H  G V   K +  +  +S E  +
Sbjct  167  GYLLKQGSWRRNWKSRFFMLRQDYPSFCYYKSQHKLHLLGHVRITKDTIVLQRTSSESGK  226

Query  82   YWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESLPDVNKWLEVVQNALDAAKK  136
            Y+  V G  +                  L +  +S   +++W+ +++  +DA ++
Sbjct  227  YYFQVRGDPQT-----------------LHLQAKSSQSLDRWVRLIEAFVDALRE  264

Lambda      K        H        a         alpha
   0.315    0.133    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22261787610

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40