Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0017341475780080040430.0
PYIR_1345314757118681234330.0
PYIW_187931475799780733780.0
PYAP_1774614757116979125170.0
PHYSO_32115714757118080124020.0
PPTG_1712814757117781823530.0
PITG_1845714757117081823500.0
PHYRA_9590114757107581723440.0
PHALS_0647714757116681021930.0
PHYCA_344751475769274021040.0
SDRG_0176414757109279219200.0
SPRG_063541475788479119080.0
H257_0630514757109980918970.0
H310_0921214757111380818870.0
CCI4512214757110575816540.0
CCA1889814757114780016240.0
PYAR_13581147577303378625e-103
PHYKE_8394147574282227022e-83
HYAP_00989495133046920.064
HYAP_1285012378697846920.069
H310_05643123786131682870.24
PHYSO_48929614211098168870.27
PITG_063785362213794830.73
PYIR_202022856155546821.1
SPRG_03605123866112140811.4
PYIW_1987210283998219801.7
PYAP_1468477562280115792.3
PPTG_132145362223794783.0
PHYSO_360938495120042783.4
H257_1443114367214841764.9
PHYCA_1253631421108984765.2
PHYRA_8453414050136844765.4
CCA165302856151243765.4
PITG_016151421108784765.5
PYIW_201662856153238756.3
PHYCA_101481404817433676.7
PPTG_08220495133542757.6
PPTG_1622114050125944757.6
PHALS_1102359281345166758.0
SPRG_085657627113264748.4
PHYRA_730964789184150749.0
PHYSO_3590624789177542749.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001734

Length=800
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001734                                                          1561       0.0   
PYIR_13453                                                            1326       0.0   
PYIW_18793                                                            1305       0.0   
PYAP_17746                                                            974        0.0   
PHYSO_321157                                                          929        0.0   
PPTG_17128                                                            910        0.0   
PITG_18457                                                            909        0.0   
PHYRA_95901                                                           907        0.0   
PHALS_06477                                                           849        0.0   
PHYCA_34475                                                           815        0.0   
SDRG_01764                                                            744        0.0   
SPRG_06354                                                            739        0.0   
H257_06305                                                            735        0.0   
H310_09212                                                            731        0.0   
CCI45122                                                              641        0.0   
CCA18898                                                              630        0.0   
PYAR_13581                                                            336        5e-103
PHYKE_8394                                                            275        2e-83 
HYAP_00989                                                            40.0       0.064 
HYAP_12850                                                            40.0       0.069 
H310_05643                                                            38.1       0.24  
PHYSO_489296                                                          38.1       0.27  
PITG_06378                                                            36.6       0.73  
PYIR_20202                                                            36.2       1.1   
SPRG_03605                                                            35.8       1.4   
PYIW_19872                                                            35.4       1.7   
PYAP_14684                                                            35.0       2.3   
PPTG_13214                                                            34.7       3.0   
PHYSO_360938                                                          34.7       3.4   
H257_14431                                                            33.9       4.9   
PHYCA_125363                                                          33.9       5.2   
PHYRA_84534                                                           33.9       5.4   
CCA16530                                                              33.9       5.4   
PITG_01615                                                            33.9       5.5   
PYIW_20166                                                            33.5       6.3   
PHYCA_101481                                                          30.4       6.7   
PPTG_08220                                                            33.5       7.6   
PPTG_16221                                                            33.5       7.6   
PHALS_11023                                                           33.5       8.0   
SPRG_08565                                                            33.1       8.4   
PHYRA_73096                                                           33.1       9.0   
PHYSO_359062                                                          33.1       9.2   

>PYU1_G001734
Length=800

 Score = 1561 bits (4043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/800 (100%), Positives = 800/800 (100%), Gaps = 0/800 (0%)

Query  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
            MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA
Sbjct  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
            LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK
Sbjct  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
            DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ
Sbjct  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
            HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID
Sbjct  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
            ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY
Sbjct  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
            SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF
Sbjct  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
            MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA
Sbjct  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  421  LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480
            LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF
Sbjct  421  LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480

Query  481  GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYE  540
            GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYE
Sbjct  481  GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYE  540

Query  541  AIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFHL  600
            AIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFHL
Sbjct  541  AIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFHL  600

Query  601  LNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaNLVLQEATHL  660
            LNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLVLQEATHL
Sbjct  601  LNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANLVLQEATHL  660

Query  661  GLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADSL  720
            GLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADSL
Sbjct  661  GLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLADSL  720

Query  721  TAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNFAEVLTVVR  780
            TAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNFAEVLTVVR
Sbjct  721  TAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNFAEVLTVVR  780

Query  781  TLTGGKSAKLEKIRRLRRGN  800
            TLTGGKSAKLEKIRRLRRGN
Sbjct  781  TLTGGKSAKLEKIRRLRRGN  800

>PYIR_13453
Length=1186

 Score = 1326 bits (3433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/812 (79%), Positives = 720/812 (89%), Gaps = 17/812 (2%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             MD+LRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEFVSFKRVAQE+WG VEEVI+A
Sbjct  379   MDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRA  438

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LE LLTRYFVPLAY+DGQRLMTVA+MEMA+FSK+DLLSCIVNEDQVGSLIRRPGQRYKGK
Sbjct  439   LEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGK  498

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             DRKRRAAITIQN FRMW NQKKY+R+R HL+SVV IQ+VWRA+ASHE L+RKLK QR QQ
Sbjct  499   DRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQ  558

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
             HEQWEA+MQRL+R+W  IK NRRV+IHVPSLSIDER RI ADNF+VKQN+QLSRLCG+ID
Sbjct  559   HEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLID  618

Query  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
              NVDIVYVSPFELT++V QY MKLLQLGGIADPV RVKLV+PEQA RFPAHFSLTT+LLY
Sbjct  619   PNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLY  678

Query  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
             SPHCLRRI+R ++ KEAYLVTG+PG+EDKRLA+ALNVPILGMDPL+ LPLMTKSGSKRFF
Sbjct  679   SPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFF  738

Query  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
             MRADVNVPTGTYDIYDEDEL+FSLAKLI+SHIEQ+VW+LKIDYDPFGTGTA++D S +T 
Sbjct  739   MRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTV  798

Query  421   LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480
             LREIRREKKSPEYW+QP TRDNAAR IIAELERT+  LVTPLHPEVYP+WQEF DAI+QF
Sbjct  799   LREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQF  858

Query  481   GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILS-------------TASIHKRKV  527
             GVV+EAAPSA++G++RANLF+EPSGEVHVSSTQD+I +              A  ++ K 
Sbjct  859   GVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKT  918

Query  528   AGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPY  587
              GYAFPQT APYEAIRGAS AIGK+L D+ VFGYSS+DYLVF+EDKTH  RLWAMALHPY
Sbjct  919   VGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPY  978

Query  588   LTDSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsa  647
             LTDSASTFA FHLLNRGALN  +G YHL         S S++S+ SLK + S    A   
Sbjct  979   LTDSASTFATFHLLNRGALNASSGLYHL----PPVAASPSSSSTKSLKPSHSRAAGATGT  1034

Query  648   tsaNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVE  707
             ++A+LV+QEATH GLVSLEKAGAQRTY V+EYIFHPNVSTMQYS+FFHTCRLHGVCFDVE
Sbjct  1035  SAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVE  1094

Query  708   RCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDC  767
             RC G++F+LADSLTAGVFGI+CC D+AS ALGFLRTALEVIGREVGTQAL D+  GGG+ 
Sbjct  1095  RCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGES  1154

Query  768   ESGNFAEVLTVVRTLTGGKSAKLEKIRRLRRG  799
             E+GNFA+VL V+R LTGGKSAKLEKIRRLRR 
Sbjct  1155  ETGNFADVLAVIRALTGGKSAKLEKIRRLRRN  1186

>PYIW_18793
Length=997

 Score = 1305 bits (3378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/807 (78%), Positives = 718/807 (89%), Gaps = 16/807 (2%)

Query  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
            MD+LRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEFVSFKRVAQE+WG V+EVIKA
Sbjct  199  MDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKA  258

Query  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
            LE LLTRYFVPLAYVDGQRLMTVA+MEMAS+SK+DLLSCIVNEDQVGSLIRRPGQRYKGK
Sbjct  259  LEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGK  318

Query  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
            DRKRRAA+TIQN FRMW NQKKYSR+R HL+SVV IQ+VWR YASH+DL+R++K+QR QQ
Sbjct  319  DRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQ  378

Query  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
            H QWEA+MQRL+R+W RIK NRRV+IHVPS S+DER R+ ADNF+VKQNLQLSRLCG++D
Sbjct  379  HAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVD  438

Query  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
            +NVDIVYVSPFELT++V QY MKLLQLGGIADPV RVKLVFPE A RFP HFSLTT+LLY
Sbjct  439  SNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLY  498

Query  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
            SPHCLRRI+R +K KEAYLVTGMPG EDKRLAMALNVPILGMDPL+ LPLMTKSG KRFF
Sbjct  499  SPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFF  558

Query  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
            MRADVNVPTGTYDIYDEDEL+FSLAKLIVSHIEQ+VW+LKIDYDPF TGTA++D S + A
Sbjct  559  MRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVA  618

Query  421  LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480
            LREIRREK+SPEYWRQPGTRDNAAR+IIAELERT+G LVTPLHPE+YP+WQ++ADAI QF
Sbjct  619  LREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPSWQDYADAIVQF  678

Query  481  GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASI--------HKRKVAGYAF  532
            GVV+EAAPSA+VG++RANLFVEPSGEVHVSSTQD++LS++          ++ K  GYAF
Sbjct  679  GVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGGCGGKPGGAYRHKSVGYAF  738

Query  533  PQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSA  592
            PQT APYEAIRGAS AIGK+L +D+VFGY+S+D+LVF+EDK+H  RLWAMAL PYLTDSA
Sbjct  739  PQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTARLWAMALRPYLTDSA  798

Query  593  STFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaNL  652
            +TF  FHLLNRGALN  +G Y+L        P+++  S+  ++L +SS   A  A++A+L
Sbjct  799  ATFTTFHLLNRGALNTTSGLYYL--------PAATVTSASLVQLQSSSAAFASGASAADL  850

Query  653  VLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGT  712
            VL EATH GLVSLEK GAQ TY V+EYIFHPNVSTMQYS+FFHTCRLHGVCFDVERC G+
Sbjct  851  VLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGS  910

Query  713  IFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNF  772
            +F+LADSLTAGVFG++CC DTAS ALGFLRTALEV+GREVGTQALTD+   GG+ E+GNF
Sbjct  911  VFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNF  970

Query  773  AEVLTVVRTLTGGKSAKLEKIRRLRRG  799
            A+VL  +R LTGGKSAKLEKIRRLRR 
Sbjct  971  ADVLAAIRALTGGKSAKLEKIRRLRRN  997

>PYAP_17746
Length=1169

 Score = 974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/791 (60%), Positives = 608/791 (77%), Gaps = 39/791 (5%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             M+DLR NVEKIRGYNELLD YSLHQFIIHKG+A+R+TPEF SFKRVAQEIWG +EEVI+A
Sbjct  349   MEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQA  408

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LE LLTRYFVPLAY+DGQRLMT+ASMEMA  S  +LL+C+VNEDQV SLIRRPGQRYKGK
Sbjct  409   LEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGK  468

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             DRKRRAA T+Q  FRM  ++ ++ + RR+ SS +LIQ+ WR+YA  + LRR+L   R+++
Sbjct  469   DRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREER  528

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
               +W+A+++R++ +W  I+  RRV+IHV S+S+DER R+  +NF+VKQNLQLSRL G++D
Sbjct  529   LGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVD  588

Query  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
              NV+IVYV+PFEL++EV QYF+KLLQL GIA+  TRV+LVFPE A +FP HFSL T L+Y
Sbjct  589   QNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIY  648

Query  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILG-MDPLATLPLMTKSGSKRF  359
             SP+C+RRI+R V+GKEAYLV G+PG ED+RLA+AL VPILG  DP + LPLMT+SGSKRF
Sbjct  649   SPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRF  708

Query  360   FMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVT  419
             F++ADVNVPTGTYDIYD DEL+FSLAKLI+SH+ QNVWLLK+D DP GTGTAI+D S++T
Sbjct  709   FIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMT  768

Query  420   ALREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQ  479
              LR+IRREK+ PEYW+QPG RD  AR ++ ELER IG L+ P HPE++ +W+EFA AI +
Sbjct  769   TLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPE  828

Query  480   FGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVIL---STASIHKRKVAGYAFPQTT  536
             FGVV+EA P  + G IR N+F+EPSG+VHV ST DV+    +T S  +R+ A + FPQT 
Sbjct  829   FGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDVLSGNGTTLSQRQRRPAAFVFPQTL  888

Query  537   APYEAIRGASMAIGKVLVDDSVF-GYSSVDYLVFREDKTHVP----RLWAMALHPYLTDS  591
              P+EAI GAS A+G+VL ++  F GY+SVD  + +E+    P    RLWA++L PYLTDS
Sbjct  889   VPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDS  948

Query  592   ASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaN  651
             A+TFA FH L+RG LN  TG+Y+L A  ++   S S   S  +                 
Sbjct  949   AATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIG----------------  992

Query  652   LVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFG  711
                         +L++ GA R+YAV EY+FHPNVS M Y++FFHTCRLHGVCFDVERC G
Sbjct  993   ------------TLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVG  1040

Query  712   TIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALT--DDLRGGGDCES  769
             ++F+LADSLTAG+FG++  G++A+ AL +LRTA EVIGREVGTQ++   D   G     S
Sbjct  1041  SVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLS  1100

Query  770   GNFAEVLTVVR  780
             GNFAE+L ++R
Sbjct  1101  GNFAEILGLLR  1111

>PHYSO_321157
Length=1180

 Score = 929 bits (2402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/801 (56%), Positives = 599/801 (75%), Gaps = 37/801 (5%)

Query  4     LRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALET  63
             L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEFVSF+RVAQE+WG VEE ++ALET
Sbjct  384   LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALET  443

Query  64    LLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  123
             LLT+YFVPLAY DGQRL+++AS     FSK++LLSCIVNE+QV +++RRPGQRYKG+DRK
Sbjct  444   LLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503

Query  124   RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQ  183
             RRAA TIQ   RMWS +++Y R R    S   IQ  WRA++ H  L+ +L+  R++Q + 
Sbjct  504   RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDN  563

Query  184   WEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-IDAN  242
             WEA+M  L+ +W +I   RRV++HVPSLS+DE  R+ A+NFAV+QNLQL+R+C   +D+N
Sbjct  564   WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623

Query  243   VDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYS  301
             VD+ VYV+PFELT++V  YF+KLLQLGG+AD   RVKLVFPEQA RFPAHFSL++VLLYS
Sbjct  624   VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683

Query  302   PHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFM  361
             PHCLRRIR    GK+AYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR  +
Sbjct  684   PHCLRRIRHYTAGKDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLI  743

Query  362   RADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTAL  421
             RADVNVPTGTY++YDE EL  +LAKL V+H++Q  WLLK+DYDP G G A+VD S + A+
Sbjct  744   RADVNVPTGTYELYDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAM  803

Query  422   REIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIAQ  479
             RE+RREKK+PEYWRQPG RD A+++++AELER   + +L TP+H E++P+W+E+ +AI+ 
Sbjct  804   RELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISH  863

Query  480   FGVVIEAAP-------------SAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRK  526
             FG V+EA P             S    Y+RANLF++P G VH++STQ+V+ S   ++++ 
Sbjct  864   FGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLASGGGLNRKT  923

Query  527   VAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT-HVPRLWAMALH  585
             VA + FPQT AP+EA++GA  A GK+LV+ +V+GY S+D++VF++DK+   PRLWA+A+H
Sbjct  924   VA-FTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVH  982

Query  586   PYLTDSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraag  645
             P+LTDSA++FA FHLL RG L+  +G Y + A  ++              L A ++  +G
Sbjct  983   PFLTDSAASFACFHLLARGVLDASSGGYRMAAANST--------------LAAVNSGRSG  1028

Query  646   satsaNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFD  705
                + +L+L+EA+   L    +AG  R Y V  Y+FHP+V+TMQY++FFH CRLHGVCFD
Sbjct  1029  GGGTTDLLLREAS---LAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFD  1085

Query  706   VERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDLRGG  764
             VER  GT+F+L DSLTAGVFG++  G+T   AL F+RTALEVIGRE G T  +       
Sbjct  1086  VERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRP  1145

Query  765   GDCESGNFAEVLTVVRTLTGG  785
             G   SGNFA+VL+ VR  TGG
Sbjct  1146  GSARSGNFAQVLSAVRASTGG  1166

>PPTG_17128
Length=1177

 Score = 910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/818 (56%), Positives = 605/818 (74%), Gaps = 40/818 (5%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             M++L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEF+SF+RVAQE+WG VEE ++A
Sbjct  380   MEELGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRA  439

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LE LLT+YFVPLAYVDGQRL+ +A      FSK++LLSCIVNEDQ+ S++RRPGQRYKG+
Sbjct  440   LEALLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGR  499

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             DRKRRAA T+Q   RMW  +++Y+R R    +   IQ  WRAY+ H  L+ +L+  R+++
Sbjct  500   DRKRRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREK  559

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-I  239
              E+WE RM  L+ +W +I A RRV++HVPSLS+DE +R+ A+NFAV+QNLQL+R+C + +
Sbjct  560   LEKWEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVAL  619

Query  240   DANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298
             D+NVD+ VYVSPFELT++V QYF+KLLQLGG+ D   RVK VFPEQ+TRFPAHFSL+++L
Sbjct  620   DSNVDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLL  679

Query  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR
Sbjct  680   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKR  739

Query  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418
               +RADVNVP GTY++YDE EL  +LAKL ++H++Q  WL+K+DYDP G G A+VD S +
Sbjct  740   LLIRADVNVPNGTYELYDEHELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNI  799

Query  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELERT--IGKLVTPLHPEVYPTWQEFADA  476
              A+RE+RREK++PEYWRQPG RD AA+MI+AELER   + +L  P+H E++PTW+++ DA
Sbjct  800   QAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDA  859

Query  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523
             +  FG VIEA P   +              Y+RANLFV+P G VHV+STQ+V+ +     
Sbjct  860   VGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDPDGSVHVTSTQNVLATGGGGL  919

Query  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAM  582
              RK   + FPQT AP+EAI+GA  A GK+LV+ +V+GY S+D++VF+++K++  PRLWA+
Sbjct  920   NRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWAL  979

Query  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstr  642
             A+HP+LTDSA++FA FHLL RG L+ ++G Y + +                 K   + T 
Sbjct  980   AVHPFLTDSAASFACFHLLARGVLDTNSGAYRVAS-----------------KSLTTVTG  1022

Query  643   aagsatsaNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702
               GS  + +L+L+EA+   L     AGA R + V  Y+FHP+V+TMQY++FFH CRLHGV
Sbjct  1023  RNGSGCTTDLLLREAS---LAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGV  1079

Query  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDL  761
             CFDVER  GT+F+LADSLTAGVFG++  G+T   AL FLRTALEVIGRE G T  +    
Sbjct  1080  CFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSP  1139

Query  762   RGGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798
                    SGNFA+VL+ VR  T GGKS +L K++R RR
Sbjct  1140  SRPVSGRSGNFAQVLSAVRASTGGGKSDRLGKMQRRRR  1177

>PITG_18457
Length=1170

 Score = 909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/818 (55%), Positives = 597/818 (73%), Gaps = 38/818 (5%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             M+ L  NV+KIRGYNELLD YSLHQF+IHKG+ MR+TPEFVSF+RV QE+WG VEE ++A
Sbjct  371   MEKLGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRA  430

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LETLL +YFVPLAYVDGQRL+ +A      FSK++LLSCIVNEDQV S++RRPGQRYKG+
Sbjct  431   LETLLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGR  490

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             DRKRRAA TI+   RMW  +++Y+R R    +   IQ  WRAY+ H  L+ +L+    ++
Sbjct  491   DRKRRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEK  550

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-I  239
              E+WE RM  L+  WP+I   RRV++HVPSLS+DE  R+ A+NFA++QNLQL+R+C   +
Sbjct  551   LEKWEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAAL  610

Query  240   DANVDIV-YVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298
             D+NV+++ YVSPFELTS+V QYF+KLLQLGG+ D   RVKLVFPEQ TRFPAHFSL+++L
Sbjct  611   DSNVELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLL  670

Query  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLAMAL++PILG  P   LPL+T+SG KR
Sbjct  671   LYSPHCLRRIRHYTTGKEAYLVMGLPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKR  730

Query  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418
               +RADVNVP GTY++YDE E+  +LAKL ++H++Q  WL+K+DYDP   G A+VD S +
Sbjct  731   LLIRADVNVPNGTYELYDEHEVCAALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNM  790

Query  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADA  476
              A+RE+RREK++PEYWRQPG RD AA++I+AELER   + ++ TP+  E++P W+EF DA
Sbjct  791   QAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFPKWREFIDA  850

Query  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523
             +  FG V+EA P   +              Y+RANLFV+P G VH+SSTQ+V+ +     
Sbjct  851   VGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDPDGSVHISSTQNVLAAGGGGL  910

Query  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAM  582
              RK   + FPQT APYEAI+GA  A GK+LV+ +V+GY S+D++VF+++K++  PRLWA+
Sbjct  911   NRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWAL  970

Query  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstr  642
             A+HP+LTDSA++FA FHLL RG L+ ++G Y +   + +                A+S R
Sbjct  971   AVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLT---------------TANSGR  1015

Query  643   aagsatsaNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702
              + S ++ +L+L+EA    L      GA+R +    Y+FHP+V TMQY++FFH CRLHGV
Sbjct  1016  KSESGSATDLLLREAL---LAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGV  1072

Query  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVG-TQALTDDL  761
             CFDVER  GT+F+LADSLTAGVFGI+  G+T   AL FLRTALEVIGRE G T ++    
Sbjct  1073  CFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSP  1132

Query  762   RGGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798
                    SGNFA++L+ +R  T GGKS +L K+R+ +R
Sbjct  1133  SRSVASRSGNFAQILSAIRVSTGGGKSDRLGKMRQRQR  1170

>PHYRA_95901
Length=1075

 Score = 907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/817 (57%), Positives = 598/817 (73%), Gaps = 52/817 (6%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             M++L  NV+KIRGYN+LLD YSLHQF+IHKG++MR+TPEFVSF+RVAQE+WG VEE ++A
Sbjct  292   MEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRA  351

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LETLLT+YFVPLAYVDGQRL+++A+     FSK +LL+CIVNE+QV S++RRPGQRYKG+
Sbjct  352   LETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGR  411

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             DRKRRAA TIQ   RMWS +++Y R R    S   IQ  WR+Y+ H  L+ +L+  R++Q
Sbjct  412   DRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQ  471

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-I  239
              E+WEARMQ L+ +WP+I   RRV++HVPSLS+DE  R+ A+NFAV+QNLQL+R+C   +
Sbjct  472   LERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAAL  531

Query  240   DANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVL  298
             D++VD+ VYVSPFELT++V QYF+KLLQLGG+AD   RVKLVFPEQA RFP HFSL+++L
Sbjct  532   DSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLL  591

Query  299   LYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKR  358
             LYSPHCLRRIR    GKEAYLV G+PG ED+RLA+AL++PILG  P   LPL+T+SG KR
Sbjct  592   LYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKR  651

Query  359   FFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVV  418
               +RADVNVPTGTY++YDE EL  +LAKL V+H+EQ  WLLK+DYDP G G A+VD S +
Sbjct  652   LLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGM  711

Query  419   TALREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADA  476
              A+RE+RREK++PEYWRQPG RD AA++++AELER   + +L TP+H E++P W++F +A
Sbjct  712   QAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEA  771

Query  477   IAQFGVVIEAAPSAIV-------------GYIRANLFVEPSGEVHVSSTQDVILSTASIH  523
             I  FG VIEA P A +              Y+RANLFV P G       ++V+ S+    
Sbjct  772   IGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPDG-------KNVLASSGGGL  824

Query  524   KRKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT-HVPRLWAM  582
              RK   + FPQT AP+EA++GA  A GK+LV+ SV+GY S+D++VF+++K    PRLWA+
Sbjct  825   NRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWAL  884

Query  583   ALHPYLTDSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstr  642
             A+HP+LTDSA++FA FHLL RGA  +                           +  ++  
Sbjct  885   AVHPFLTDSAASFACFHLLARGAYRVAASN----------------------SMVNANPG  922

Query  643   aagsatsaNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGV  702
              +GS  +A+L+L+EA+   L     AGA R + V  Y+FHP+V+TMQYS+FFH CRLHGV
Sbjct  923   RSGSGGAADLLLREAS---LTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGV  979

Query  703   CFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLR  762
             CFDVER  GT+F+LADSLTAGVFGI+  G+T   AL FLRTALEVIGREVG        R
Sbjct  980   CFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSR  1039

Query  763   GGGDCESGNFAEVLTVVRTLT-GGKSAKLEKIRRLRR  798
                   +GNFA+VL+ VR  T GGK  +L K+RRLRR
Sbjct  1040  -PVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075

>PHALS_06477
Length=1166

 Score = 849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/810 (52%), Positives = 572/810 (71%), Gaps = 38/810 (5%)

Query  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62
             DL  NV KIR YN+L+D YSLHQ +I+KG+A+R+TPEF SF+RV  ++WG VEEV++ALE
Sbjct  376   DLAVNVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALE  435

Query  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122
              +L +YFVPLA+VDGQRL+ +AS     FS+++LLSCIVN++QV S++RRPGQRY G+DR
Sbjct  436   AILFQYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDR  495

Query  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHE  182
             K RAA TIQ   RMW    +Y + R    + + IQ  +RAY+    L+ +L+  R ++  
Sbjct  496   KHRAATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAA  555

Query  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-IDA  241
             +WEARM   + +W +I A RR+++HVPS+S+ E  R+ A+NFAV+QNLQL+R+C   +D 
Sbjct  556   KWEARMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDL  615

Query  242   NVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
              VD+ VYVSP+ELT++V QYF KLLQL G AD   RVK V+PEQA RFPAHFSL++++LY
Sbjct  616   QVDLLVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILY  675

Query  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
             SP+CLRRIR    G EAYLV G+PG ED+RLA+ L++PILG  P   LPL+T+SG KR  
Sbjct  676   SPYCLRRIRHYTAGNEAYLVMGLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLL  735

Query  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
             ++AD+NVPTGTY++YDE E+  +LAKL V+HI+Q+ WL+K+DYDP G G A+VD S + A
Sbjct  736   IQADINVPTGTYELYDEHEISVALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQA  795

Query  421   LREIRREKKSPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIA  478
             +RE+ REK++PEYWRQPGTRD AA + + E ER   + +L TP+H E+YPTW+E+A AI 
Sbjct  796   MRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIG  855

Query  479   QFGVVIEAAPSAIVG-------YIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYA  531
              FG VIEA P            Y+RAN+FV+P+G VH++STQ+V+ +T     RK   +A
Sbjct  856   HFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEIFA  915

Query  532   FPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVP-RLWAMALHPYLTD  590
             FPQT AP+ AI+GA  A+GK L + +V+GY S+D++VF++ K++   RLWA+A+HP+LT+
Sbjct  916   FPQTVAPHAAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTN  975

Query  591   SASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsa  650
             SA+TFA FHLL RG L+ ++G Y +P         ++  S     +              
Sbjct  976   SAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHDAM--------------  1021

Query  651   NLVLQEATHLGLVSLEKA---GAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVE  707
             +L+L+EA      SL KA   GA R Y V  Y+FHPNV+  QY++FF  CRLHGVCFDV 
Sbjct  1022  DLLLREA------SLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVS  1075

Query  708   RCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDC  767
             R  GT+F+LADSLTAGVFGI+  G+TA  AL +LRTALEVIGRE G  A    +      
Sbjct  1076  RALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAG--ATKGIVSSSSRS  1133

Query  768   ESGNFAEVLTVVRTLTGGKSA-KLEKIRRL  796
               GNFA+VL+ VR  TGG S+ +L ++ R+
Sbjct  1134  VLGNFADVLSTVRASTGGGSSNRLGQVHRM  1163

>PHYCA_34475
Length=692

 Score = 815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/740 (55%), Positives = 539/740 (73%), Gaps = 68/740 (9%)

Query  12   RGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRYFVP  71
            RGYNELLD YSLHQF+IHKG+ MR+TPEF+SF RVAQE+WG VEE ++ALETLLT YFVP
Sbjct  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  72   LAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  131
            LAYVDGQRL+++A+     FSK++LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  132  NVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQWEARMQRL  191
               RMW+ +++Y+R R    +   IQ  WRAY+ H  L+ +L+  R++Q E+WEARM RL
Sbjct  121  AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  192  QREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGI-IDANVDI-VYVS  249
            + +W +I ++RRV++HVPSLS+DE  R+ A+N AV+QNLQL+R+C   +D+ VD+ VYVS
Sbjct  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  250  PFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPHCLRRIR  309
            PFELT++V QYF+KLLQLGG+AD   RVKL+FPEQATRFPAHFSL+++LLYSPHCLRRIR
Sbjct  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  310  RCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRADVNVPT  369
                GKEAYLV G+PG ED+RLAM L++PILG  P   LPL+T+SG KR  +RADVNVP 
Sbjct  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  370  GTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALREIRREKK  429
            GTY++YDE EL  +LAKL V+H++Q  WL K+DYDP G G A+VD S + A+RE+RREK+
Sbjct  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  430  SPEYWRQPGTRDNAARMIIAELER--TIGKLVTPLHPEVYPTWQEFADAIAQFGVVIEAA  487
            +PEYWRQPG RD AA++++ ELER  T+ +L  P+H +++P+W EFA+AI  FG VIEA 
Sbjct  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  488  P-SAIV------------GYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQ  534
            P +AI              YIRANLFV+P G VHV+ST +++ +      R+   + FPQ
Sbjct  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLATGGGGLNRRTVAFTFPQ  540

Query  535  TTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTH-VPRLWAMALHPYLTDSAS  593
            T AP+EA++GA  A GK+LV+ +V+GY S+D++VF++DK++  PRLWA+A+HP+LTDSA+
Sbjct  541  TAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVHPFLTDSAA  600

Query  594  TFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaNLV  653
            +FA FHLL RG L+ ++G Y + A                                    
Sbjct  601  SFACFHLLARGVLDANSGVYRMAA------------------------------------  624

Query  654  LQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTI  713
                          A   R + V  Y+FHP+V+TMQY++FFH CRLHGVCFDVER  GT+
Sbjct  625  --------------ASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  670

Query  714  FMLADSLTAGVFGIICCGDT  733
            F+LADSLTAGVFG++  G+T
Sbjct  671  FLLADSLTAGVFGVLSIGET  690

>SDRG_01764
Length=1092

 Score = 744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/792 (46%), Positives = 527/792 (67%), Gaps = 35/792 (4%)

Query  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
             +D+LR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WG V   I+ 
Sbjct  309   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRE  368

Query  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
             LETLL  Y VPLAY+DGQ+L+ +A+M+  S SK +LL+C++N D+V + + RPGQR+KG+
Sbjct  369   LETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGE  428

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
             D +  AAI +Q+V+RM   +++  ++  H S    IQ+V+R Y S ++++ KL+  R+  
Sbjct  429   DSRHAAAILLQSVYRMHLTRRRLRQHHGH-SYASHIQRVYRTYKSVKEIQVKLRLAREAD  487

Query  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
                WE +M      W +IK  RRV++HVPS S +ER R+  DNFA++QNLQ++RLC I D
Sbjct  488   ARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLCAIAD  547

Query  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
              NVD++Y+SPFEL++++ +Y M+LLQLGG+ADP +RV+++ PE A RFP HFSL T+LLY
Sbjct  548   PNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLY  607

Query  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
             SPHCL++I+R V+GKEAY+V G  G EDKRLA+ L +P+LGMDP   L   T+SG+KR F
Sbjct  608   SPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLF  667

Query  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
              +ADVN+P G +DIYDEDELI SLAKL  +++ Q +WL+K+D DP  TG A +D   +  
Sbjct  668   TQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMHALEC  727

Query  421   LREIRREK---KSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAI  477
             + ++R EK   K+ EY+ QP  ++   R I+AEL     +L++P  P+VYPTWQ     +
Sbjct  728   VNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVV  787

Query  478   AQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTA  537
              + G VIEA P  ++  +RAN+F+EPSG VH++S Q+ ++   + H+    G  +P TT 
Sbjct  788   NRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKNKHQS--VGAVYPSTTV  845

Query  538   PYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT--------HVPRLWAMALHPYLT  589
             PY AIRGAS+A+ + +    + GY+S+DY+ F + KT        H+ RLWA+ L P LT
Sbjct  846   PYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL-RLWALQLLPCLT  904

Query  590   DSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsats  649
              +A +F +F  L+   L+  TG+  LP PA    P++        +L            +
Sbjct  905   PTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPSPATGQLPVTETQL------------A  952

Query  650   aNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERC  709
                +L E+     V     G +R Y  +EYIFHPN++T+QY+ FF+ CR+HGV FD+++ 
Sbjct  953   VEKILSESPRSSNV-----GPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKS  1007

Query  710   FGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCES  769
              G  F+LADSLTAGV G++C G++   A+   R ALE+IG +VG Q   D L G      
Sbjct  1008  IGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGE---RL  1064

Query  770   GNFAEVLTVVRT  781
             GNFA VL  +R+
Sbjct  1065  GNFAAVLGAIRS  1076

>SPRG_06354
Length=884

 Score = 739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/791 (46%), Positives = 522/791 (66%), Gaps = 36/791 (5%)

Query  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
            +D+LR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WG V   I+ 
Sbjct  97   IDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRE  156

Query  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
            LETLL  Y VPLAY+DGQ+L+ +A+M+  S SK +LL+C++N D+V + + RPGQR+KG 
Sbjct  157  LETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGG  216

Query  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
            D +  AAI IQ+V+RM   ++   ++  H S    IQ+V+R Y   +D++ KL+  R+  
Sbjct  217  DGRHAAAIVIQSVYRMHRTRRLLRQHHGH-SYATHIQRVYRTYKCVKDIQVKLRLAREAD  275

Query  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
               WE +M      W +IK  RRV++HVPS S +ER R+  DNFA++QNLQ++RLC I D
Sbjct  276  ARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARLCAIAD  335

Query  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300
             NVD++Y+SPFEL+ ++ +Y M+LLQLGG+ADP +RV+++ PE A RFP HFSL T+LLY
Sbjct  336  PNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLY  395

Query  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360
            SPHCL++I+R V+GKEAY+V G  G EDKRLA+ L +P+LGMDP   L   T+SG+KR F
Sbjct  396  SPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLF  455

Query  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420
             +ADVN+P G +DIYDEDELI SLAKL  +++ Q +WL+K+D DP  TG A +D   +  
Sbjct  456  TQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLAAIDMHALEC  515

Query  421  LREIRREK---KSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAI  477
            + ++R EK   K+ EY+ QP  ++   R I+AEL     +L++P  P+VYPTWQ     +
Sbjct  516  VNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVV  575

Query  478  AQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTTA  537
             + G VIEA P  ++  +RAN+F+EPSG VHV+S Q+ ++   + H+    G  +P T  
Sbjct  576  NRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLMHVKNKHQS--VGAVYPPTAV  633

Query  538  PYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKT--------HVPRLWAMALHPYLT  589
            PY AIRGAS+A+ + +    + GY+S+DY+ F + KT        H+ RLWA+ L P LT
Sbjct  634  PYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHL-RLWALQLLPCLT  692

Query  590  DSASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsats  649
             +A +F +F  L+   L+  TG+  LP PA                 + +   A  +  +
Sbjct  693  PTAMSFVLFTFLSCATLDAATGRSFLPLPAPRPS-------------SLAGPPATETQLA  739

Query  650  aNLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERC  709
               +L E++    +     GA+R Y  +EYIFHPN++T+QY+ FF+ CR+HGV FD+++ 
Sbjct  740  VEKILGESSPAATM-----GAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKS  794

Query  710  FGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCES  769
             G  F+LADSLTAGV G++C G++   A+   R ALE+IG +VG Q   D L G      
Sbjct  795  IGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTGE---RL  851

Query  770  GNFAEVLTVVR  780
            GNFA VL  +R
Sbjct  852  GNFAAVLGAIR  862

>H257_06305
Length=1099

 Score = 735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/809 (47%), Positives = 531/809 (66%), Gaps = 37/809 (5%)

Query  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62
             +LR+NVEKIRGYNELLDTYSLHQFII KGK + +TPEF+SF+R  +++WG V   I+ LE
Sbjct  313   NLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELE  372

Query  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122
             T+LT Y VPLAYVDGQ+LM +A+M+  +    +LLSCI+N D+V SL+RRPGQRYKG   
Sbjct  373   TMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQG  432

Query  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHE  182
                A + IQ+V+RM+  +K+   +  +  + V IQ+++R+Y     L+++LK  R+    
Sbjct  433   PDLAVVLIQSVWRMFLTKKRLKNHHGNEDAAV-IQRIYRSYRCFSQLQQRLKLVREADLR  491

Query  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDAN  242
              W+A+MQR +  W  +K  RRV++HVPS + D+R R++ DNF+++QNLQ++R+C I D N
Sbjct  492   IWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPN  551

Query  243   VDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSP  302
             VDI+Y+SPFEL+ ++ +Y ++LLQLGGI DP TR++++ PE   RFP HFSLTT+LLYSP
Sbjct  552   VDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSP  611

Query  303   HCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMR  362
             HCL++I+R V+GK AY+VTG  G EDKRLA+AL +P+LGMDP   L   T+SG KR FM 
Sbjct  612   HCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMA  671

Query  363   ADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALR  422
             ADVN+P G +DIYDEDELI SL+KLI + ++QN WL+KID D   TG A ++   + ++ 
Sbjct  672   ADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQSDTGIASINVQQMQSVA  731

Query  423   EIRREKK-----SPEYWRQPGTRDNAARMIIAEL-ERTIGKLVTPLHPEVYPTWQEFADA  476
             ++R EK+     + EY++QP  RD   R I  EL E      +TP  P+VY +W E    
Sbjct  732   KVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPV  791

Query  477   IAQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTT  536
               + GVVIEA PS ++  +RAN+F+EPSG VH++S  D+ +S A+ H  + A   FPQT+
Sbjct  792   ALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSPANKHLPQCA--LFPQTS  849

Query  537   APYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHV------PRLWAMALHPYLTD  590
              PY+AIRGAS+AI   +    + GY+S+DY+ F + KT V       RLWAM + P LT+
Sbjct  850   VPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTN  909

Query  591   SASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsa  650
             +A +F +F  L+    N  TG+ HL             A+   +  +A+      +  + 
Sbjct  910   TAVSFVMFAFLSCSQFNPITGKCHL-----------QVAAPPPIAASATVAPITQAQKAV  958

Query  651   NLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCF  710
               +L      G V     G +RTY V +YI+HPN++T+ +S+FF+TCRL+GV FD++R  
Sbjct  959   ETILSARPPNGAVV---CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAI  1015

Query  711   GTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESG  770
             G  F+LADSLTAGV G++C G+    A    R A+E+IG +VG QAL D L G      G
Sbjct  1016  GAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSGE---RLG  1072

Query  771   NFAEVLTVVRTLTGGKSAKLEKIRRLRRG  799
             NF  +L +VR  +   +      RR RRG
Sbjct  1073  NFPHLLAIVRNKSDDPAD-----RRKRRG  1096

>H310_09212
Length=1113

 Score = 731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/808 (46%), Positives = 533/808 (66%), Gaps = 33/808 (4%)

Query  3     DLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALE  62
             +LR+NVEKIRGYNELLDTYSLHQFII KGK + +TPEF+SF+R  +++WG V + I+ LE
Sbjct  327   NLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELE  386

Query  63    TLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDR  122
              +LT Y VPLAYVDGQ+LM +A+M+  +    +LLSCI+N D+V SL+RRPGQR+KGK  
Sbjct  387   AMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGKSG  446

Query  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHE  182
                AA+ +Q+V+RM+  +K+   +  +  + V IQ+++R+Y     L+++LK+ R+    
Sbjct  447   PDLAAVLLQSVWRMYITKKRLKNHHGNEDAAV-IQRIYRSYRCFSQLQQRLKSVREADLR  505

Query  183   QWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDAN  242
              W+A+MQR +  W  IK  RRV++HVPS S +ER R++ +NF+++QNLQ++R+C I D N
Sbjct  506   IWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARMCAIADPN  565

Query  243   VDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSP  302
             VDI+Y+SPFEL+ ++ +Y ++LLQLGGIADP TR++++ PE   RFP HFSLTTVLLYSP
Sbjct  566   VDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLLYSP  625

Query  303   HCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMR  362
             HCL++I+R V+GK+AY+VTG  G EDKRLA+AL +P+LGMDP   L   T+SG KR FM 
Sbjct  626   HCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPDKALLYGTRSGGKRIFMA  685

Query  363   ADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALR  422
             ADVN+P G +DIYDEDELI SL+KLI + I+Q  WL+KID D   TG A ++   + ++ 
Sbjct  686   ADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQSNTGIASLNVDKMQSVA  745

Query  423   EIRREKK-----SPEYWRQPGTRDNAARMIIAEL-ERTIGKLVTPLHPEVYPTWQEFADA  476
             + R EK+     + EY++QP  RD   R + +EL E      VTP  PE+Y +W      
Sbjct  746   KFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPI  805

Query  477   IAQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAFPQTT  536
               + GVVIEA PS ++ ++R N+F+EPSG VH++S  DV +   + H  + A   FPQ++
Sbjct  806   ALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCPVNKHLPQCA--VFPQSS  863

Query  537   APYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVP-----RLWAMALHPYLTDS  591
              PY+AIRGAS+AI   +    + GY+S+DY+ F + K  V      RLWAM + P LT++
Sbjct  864   VPYQAIRGASLAIASSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNT  923

Query  592   ASTFAVFHLLNRGALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaN  651
             A +F +F  L+    N  TG+ HL    A               L+ ++     +     
Sbjct  924   AVSFVMFAFLSCSQFNPITGKSHLQVAPAPVAT-----------LSTANAPITPTQQEIA  972

Query  652   LVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFG  711
              +L   +     S+   G +RTY V +YI+HPN++T+Q+++FF+TCRLHGV FD++R  G
Sbjct  973   TILSPPSSAAAASV--CGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIG  1030

Query  712   TIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGN  771
               ++LADSLTAGV G+IC G++   A    R A+E+IG +VG QAL + L G      GN
Sbjct  1031  AAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSGE---RLGN  1087

Query  772   FAEVLTVVRTLTGGKSAKLEKIRRLRRG  799
             F  +L +VR  +   +A     RR RRG
Sbjct  1088  FPHLLAIVRNKSDDPAA---ADRRKRRG  1112

>CCI45122
Length=1105

 Score = 641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/758 (43%), Positives = 483/758 (64%), Gaps = 36/758 (5%)

Query  16    ELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRYFVPLAYV  75
             E+  TY    F+IH+G   R+ PEF +F+R+A  IW  V+ V++AL  +L+ YF+P+AY+
Sbjct  333   EISKTYD---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYI  389

Query  76    DGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNVFR  135
             +GQR++T+A  +    + +DL+SCI NED+V  L+ +PGQR++G +R +RA I +Q+  R
Sbjct  390   NGQRILTLAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIR  449

Query  136   MWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQWEARMQRLQREW  195
             M  ++K++   R     V  IQ+ WR +++H+  + K++A+R+ Q   +   M+     W
Sbjct  450   MAMHRKRFLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNW  509

Query  196   PRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDANVDIVYVSPFELTS  255
              +I+  RR IIH+PS+SID R R++ + F+++QNLQL RLC +ID NV+++Y+ PFELT 
Sbjct  510   DKIRMQRRTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTD  569

Query  256   EVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGK  315
             ++ QY+MKLLQLGGI+D   R+KL+ PE A+RFP+HFSL++V+LYSP  L R+ RC++G+
Sbjct  570   DIVQYYMKLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGR  629

Query  316   EAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIY  375
              AY+V G PG EDKR+A  L VPILG+D   +L   T SGSKR+F +A+VN      D+Y
Sbjct  630   NAYMVPGFPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLY  689

Query  376   DEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWR  435
             DE+ELIFSLAKL+ SH  Q   +L++DYDPFGTG A++D S + +++E+R   K+ E W 
Sbjct  690   DENELIFSLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWL  749

Query  436   QPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQFGVVIEAAPSAIVGYI  495
             QP  +    R ++ E++  I   +  +HPE++P+ + F  AI  +GV+IE +P    G++
Sbjct  750   QPPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHV  809

Query  496   RANLFVEPSGEVHVSSTQDVI----------------LSTASIHKRKVAGYAFPQTTAPY  539
             RANLF+EPS  V VSST ++                 L  AS  K +  G  FPQT   +
Sbjct  810   RANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDH  869

Query  540   EAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSASTFAVFH  599
             E ++ AS+AIG+ L  D + GY SVD++V  +D+T    L+A  L P+LT++A++FA+F 
Sbjct  870   EVLKDASLAIGQALAKDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQ  929

Query  600   LLNR-GALNIHTGQYHLpapaasgvpssstassvsLKLNasstraagsatsaNLVLQEAT  658
             LL+R G+ N  TG  HL                  + L         S ++ +L+++EA 
Sbjct  930   LLSRGGSYNSMTGSLHL---------------PQEVPLVGVQNDPPSSLSATDLMIREAR  974

Query  659   HLGLVS-LEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGTIFMLA  717
               G+VS +      RTYA+ EY+ +P V+T+  SSFF  CR  GV FD ER  GT+F+LA
Sbjct  975   LSGIVSNVLPPTPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLA  1034

Query  718   DSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQ  755
             DSLTAGVFGI+C  DT   AL   R A+E I    GT+
Sbjct  1035  DSLTAGVFGIMCISDTRKNALSNCRAAMEAIAGVAGTK  1072

>CCA18898
Length=1147

 Score = 630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/800 (43%), Positives = 501/800 (63%), Gaps = 48/800 (6%)

Query  4     LRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALET  63
             +  + E  +G N      S H F IH+G   R   +F SF+  A ++W  VEEV+  LE 
Sbjct  363   INTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLER  417

Query  64    LLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  123
             LL+ YF+P+A+++GQR++T++       + +DLLSC+ NE +V  L+ +PGQR++G ++ 
Sbjct  418   LLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKC  477

Query  124   RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQ  183
              RAA+ +Q+  RM + ++ Y     +   V  IQQ WR YA+++  + K++A R++Q   
Sbjct  478   TRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIV  537

Query  184   WEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDANV  243
             +   M+     W +I+  RR ++H+PS+SID R R++ + F+++QNLQL RLC +ID NV
Sbjct  538   FNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENV  597

Query  244   DIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSPH  303
             +++Y+ PFELT ++ QY+MKLLQL GI+D   R+KL+ PE A+RFP+HFSL+ V+L SPH
Sbjct  598   ELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPH  657

Query  304   CLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFFMRA  363
              ++R+ R ++G+ AYLV G PG EDKRLA  L +PILG+DP     + T SG KR F + 
Sbjct  658   TMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKT  717

Query  364   DVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTALRE  423
             + N   G+ D+YDE+ELIFSLAKLI ++  Q+  +LK+DYDPF TGTA+VD S + +++ 
Sbjct  718   NANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQV  777

Query  424   IRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQFGVV  483
             +R   ++ +YWRQP  ++   R I+ E++  I  LV  ++PEVYP+W+ F  AI  +GVV
Sbjct  778   LRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVV  837

Query  484   IEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHK-----RKVA----------  528
             IE  P    GY+RANLF+EPS  V +SSTQ+  LS  +IH+     RKV           
Sbjct  838   IEVCPKNRQGYVRANLFIEPSRRVCISSTQE-FLSFENIHENDDRARKVVFDKAFAAKMR  896

Query  529   --GYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHP  586
               G+ FPQT   +E ++ AS+ IG+ L  D + GY SVD+LV  +D+T    L+AMAL P
Sbjct  897   TIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQP  956

Query  587   YLTDSASTFAVFHLLNR-GALNIHTGQYHLpapaasgvpssstassvsLKLNasstraag  645
             +LT+SA++F++F  L+R G  N  TG +HLP    S   +S T SS SL           
Sbjct  957   FLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHGVTSDTPSSSSLS----------  1006

Query  646   satsaNLVLQEATHLGLVSLE-KAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCF  704
                + +L+++EA   G+VS E      R+Y + EY+ +PNV+T+ Y SFF  CR  GV F
Sbjct  1007  ---ATDLMIREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYF  1063

Query  705   DVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQ--------A  756
             D+ER  GT+F+LADSLTAGV GI+C  DT   AL   R A+E I    GT+        +
Sbjct  1064  DIERDIGTVFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKSSISKSNHS  1123

Query  757   LTDDLRGGGDCESGNFAEVL  776
             + D +R   D     F+E+L
Sbjct  1124  MNDLMR--ADSTRDRFSEIL  1141

>PYAR_13581
Length=730

 Score = 336 bits (862),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 225/337 (67%), Gaps = 29/337 (9%)

Query  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60
            MDDLRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEF SFKRV QEIWG V+EVI+A
Sbjct  81   MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRA  140

Query  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120
            LE LLTRYF                  MASF    LLSC+VNEDQV SL+RRPGQRYKGK
Sbjct  141  LEALLTRYF------------------MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGK  182

Query  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqq  180
            DRKRRAA T+Q  FRM  ++ ++ R  R  +S   IQ  WR +A+ + LRR+L  +R +Q
Sbjct  183  DRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQ  242

Query  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
               W+ +M RL+ +W  I   RRV++HVPSLS+DE  R+  D+FAV+QNLQL+RL  ++D
Sbjct  243  LRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVD  302

Query  241  ANVD-IVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLL  299
            A V+ +VYVSPFEL +++           G+A+   RVK+V PE A  FP HFSL T LL
Sbjct  303  ATVEYVVYVSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLL  353

Query  300  YSPH-CLRRIRRCVKGKEAYLVTGMPGQEDKRLAMAL  335
            YSPH  L ++ RC +       +  P     R   AL
Sbjct  354  YSPHLTLEKLGRCSRALAPSACSSRPTSTCPRARTAL  390

 Score = 153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 123/205 (60%), Gaps = 12/205 (6%)

Query  410  TAIVDASVVTALREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPT  469
            TA++D S +T LREIRR  K P YW+QPG RD  AR ++ ELER IG L  P H E +P 
Sbjct  388  TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447

Query  470  WQEFADAIAQFGVVIEAAPSAIVGYIRANLFVEPSGEVH-----VSSTQDVILSTASIHK  524
            W+ FA AI + GVVIEA P+ + G +R N+FV P+   H     V STQ+ + ++A    
Sbjct  448  WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAG---  504

Query  525  RKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVF-GYSSVDYLVFREDKTHVPRLWAMA  583
            R    +A PQT  P++A+ GA+ AIG++L +D  F GY+SVD  + R++ + +  L + A
Sbjct  505  RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDETSGLYLLPSPA  564

Query  584  LHPYLTDSASTFAVF---HLLNRGA  605
            +      S +T  V    HLL R +
Sbjct  565  VDTSAPLSPATPLVLQEAHLLARSS  589

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 60/136 (44%), Gaps = 39/136 (29%)

Query  652  LVLQEATHLGLVS---LEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVER  708
            LVLQEA  L   S      + + R +   ++  HPN+ TM  ++FF  CR  GVCFDV R
Sbjct  577  LVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR  636

Query  709  CFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCE  768
                                        A+ +LRTA EV+ REVG+   + D        
Sbjct  637  ---------------------------RAMQYLRTAFEVLAREVGSSTPSSD--------  661

Query  769  SGNFAEVLTVVRTLTG  784
             GNF +VL ++R   G
Sbjct  662  -GNFGDVLALLRHRVG  676

>PHYKE_8394
Length=428

 Score = 275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 166/222 (75%), Gaps = 25/222 (11%)

Query  222  DNFAVKQNLQLSRLCGI-IDANVDI-VYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKL  279
            +NFAV+QNLQL+R+C   +D+NVD+ VYVSPFELT++V QYF+KLLQLGG+AD   RVKL
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  280  VFPEQATRFPAHFSLTTVLLYSPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPI  339
            VFPEQA RFP                        GK+AYLV G+PG ED+RLA+AL++PI
Sbjct  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  340  LGMDPLATLPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLL  399
            LG  P   LPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL V+H++Q  WLL
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  400  KIDYDPFGTGTAIVDASVVTALREIRREKKSPEYWRQPGTRD  441
            K+DYDP G G AI+D S + A+RE+RREK++PEYWRQPG RD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 30/37 (81%), Gaps = 1/37 (3%)

Query  507  VHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYEAIR  543
            VHV+STQ+V+ S + ++++ VA Y FPQT AP+EA++
Sbjct  390  VHVTSTQNVLASGSGLNRKTVA-YTFPQTAAPHEAVK  425

 Score = 37.0 bits (84),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 0/22 (0%)

Query  1    MDDLRKNVEKIRGYNELLDTYS  22
            M++L  NV+KIRGYNELLD Y+
Sbjct  156  MEELGANVDKIRGYNELLDAYT  177

>HYAP_00989
Length=1330

 Score = 40.0 bits (92),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  122  RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHE  167
            RKRR+ + IQ ++R WS  ++Y R  R   +VV +Q   R YA+ +
Sbjct  844  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARK  889

>HYAP_12850
Length=978

 Score = 40.0 bits (92),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 0/46 (0%)

Query  122  RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHE  167
            RKRR+ + IQ ++R WS  ++Y R  R   +VV +Q   R YA+ +
Sbjct  492  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARK  537

>H310_05643
Length=1316

 Score = 38.1 bits (87),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 38/82 (46%), Gaps = 21/82 (26%)

Query  124  RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQ  183
            RRA I +Q+  RMW+ + K+ R R    +V  IQ+ W A+ +                 +
Sbjct  834  RRAIIVLQSHVRMWTARNKFRRLRL---AVQFIQKAWVAHRA-----------------K  873

Query  184  WEARMQRLQREWPRIKANRRVI  205
            W AR +R Q  W R  A  RV+
Sbjct  874  WSARSER-QLAWTRRHAAARVV  894

>PHYSO_489296
Length=1098

 Score = 38.1 bits (87),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 81/168 (48%), Gaps = 20/168 (12%)

Query  86   MEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAITIQNVFRMWSNQK  141
            ME+    +QD ++  +     G L R+  QR K K   RR    +A  IQ VFR +  +K
Sbjct  606  MELMELRRQDRMASHIGSIARGILARKFIQREKRKRYHRRVLEPSAARIQRVFRGYIVRK  665

Query  142  KYSRYRRHLSSVVLIQQVWRAYASHEDlrrklkaqrqqqHEQWEARMQRLQREW----PR  197
            +    R  + + + +QQ+WR+ ++ + ++ KL+  R      WEA   ++QR +     R
Sbjct  666  RLEDTRDQIEAAITLQQMWRSRSTVKTIKEKLRGFRLML---WEAAAGKIQRCYLCYRAR  722

Query  198  IKANRRVIIH-----VPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240
             + N R + H       +L++   +R    ++  ++ L+  R C +I+
Sbjct  723  QELNFRRLTHQACFGKAALAVQSAWR----SYCSRKQLKEFRFCSLIE  766

>PITG_06378
Length=2137

 Score = 36.6 bits (83),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 44/94 (47%), Gaps = 6/94 (6%)

Query  78   QRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQR------YKGKDRKRRAAITIQ  131
            +R + +A  E  +  K+     +   +   S+I+R  +R      +K   R  RAA+TIQ
Sbjct  856  ERAVHLAWSEFVTLKKEKRAESLRLRNHSASIIQRNFRRHLCQVVFKETLRNHRAAVTIQ  915

Query  132  NVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYAS  165
             VFR +  +    R R  + +   IQ VWR + +
Sbjct  916  RVFRGFLGRNAAQRRRWEMYAATQIQTVWRRHKA  949

>PYIR_20202
Length=1555

 Score = 36.2 bits (82),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 3/46 (7%)

Query  122   RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHE  167
             RK  AAI IQ+V RM   +K+Y R++RH  ++V IQ+ W+ Y + E
Sbjct  1366  RKITAAIKIQSVLRMALERKEY-RFQRH--AIVNIQRGWKRYLNIE  1408

>SPRG_03605
Length=1121

 Score = 35.8 bits (81),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 28/40 (70%), Gaps = 0/40 (0%)

Query  125  RAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYA  164
            RA+ T+Q+  R + +  ++ RYRR  ++ VL+Q+VWR +A
Sbjct  263  RASRTLQHAARGFVHYSRFQRYRRSKTAAVLLQRVWRGHA  302

>PYIW_19872
Length=998

 Score = 35.4 bits (80),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 90/219 (41%), Gaps = 55/219 (25%)

Query  47   AQEIWGGVEEVIKALETLLTRYFVPLAYVDGQRLMTVASMEM------ASFSKQDLLSCI  100
            A+   G  EE+ K +E LL+    P   +  +R++ +AS          S  K DLL  I
Sbjct  785  AEGTLGSGEELQKQIEKLLSANEDPSDQISAKRVVKIASESTLLFHSAESVEKLDLLLEI  844

Query  101  VNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVV------  154
                                 R+ +AAITIQ+  RM  ++  Y   ++ L S+       
Sbjct  845  ---------------------RQIQAAITIQSFARMLKDRNVYLEKQKELKSLKNELVEL  883

Query  155  -------LIQQVWRAYASHEDlrrklkaqrqqqHEQWEARMQRLQREWPRIKANRRVIIH  207
                    ++++   Y+S+ED  R   A ++    +  A++++L+R+             
Sbjct  884  YGEANMRKVEKILNKYSSNEDELRAKIAAKKLIVREEHAQIEQLERD-------------  930

Query  208  VPSLSIDERFRIRADNFAVKQNLQLSRLCGIIDANVDIV  246
            + SL +     +RA+   V + L   ++C ++  N  IV
Sbjct  931  LKSLCLSSEGGLRAE--TVNEILSDEKICSLLQQNESIV  967

>PYAP_14684
Length=2280

 Score = 35.0 bits (79),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 52/115 (45%), Gaps = 19/115 (17%)

Query  418   VTALREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAI  477
             V ALR+I++EKK  E  +               + RTI +L TPL PE+  TW++ A   
Sbjct  963   VFALRQIKKEKKVDEVTK------------YLTIHRTI-RLDTPLVPEMMTTWKDDAALY  1009

Query  478   AQFGVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASIHKRKVAGYAF  532
               F   +    S+++   + N   E +  ++ +     +L    IH    AGYA+
Sbjct  1010  ISFDTAMVMDFSSLLSEEKNNRVTEATARIYAAQ---CLLMLEYIHN---AGYAY  1058

>PPTG_13214
Length=2237

 Score = 34.7 bits (78),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 44/94 (47%), Gaps = 6/94 (6%)

Query  78    QRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQR------YKGKDRKRRAAITIQ  131
             +R + +A    AS  ++     +   +   S+I+R  +R      +K   R  RAA+TIQ
Sbjct  958   KRTVILAWRGFASLKREKRAERLRLSNHSASVIQRNFRRHLCQVVFKDTLRNHRAAVTIQ  1017

Query  132   NVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYAS  165
              +FR +  +    R R  + +   IQ VWR Y +
Sbjct  1018  RLFRGFQGRNAALRRRWEMYASTRIQTVWRRYKA  1051

>PHYSO_360938
Length=1200

 Score = 34.7 bits (78),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 25/42 (60%), Gaps = 0/42 (0%)

Query  122  RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAY  163
            RKRR++I IQ ++R WS   +Y R  R   + + +Q+  R +
Sbjct  711  RKRRSSIRIQAIWRSWSCWNRYQRIIRRERAALTLQRTTRGF  752

>H257_14431
Length=2148

 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 13/41 (32%), Positives = 27/41 (66%), Gaps = 0/41 (0%)

Query  122   RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRA  162
             R+ +AA+T+Q V+R +  +  + + RR  +++ L+Q+ WR 
Sbjct  1426  RRHKAALTMQRVYRGFKGRLVFDKRRREDAAIRLVQRSWRG  1466

>PHYCA_125363
Length=1089

 Score = 33.9 bits (76),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 4/84 (5%)

Query  86   MEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAITIQNVFRMWSNQK  141
            ME+    ++D ++  +     G L R+  +R K K   RR    +A  IQ VFR +  +K
Sbjct  604  MELMELRRKDRMASHIGAIARGILARKFIRREKKKRYHRRVVEPSAARIQRVFRGYLVRK  663

Query  142  KYSRYRRHLSSVVLIQQVWRAYAS  165
            +    R  + + + +QQ+WR+ ++
Sbjct  664  RLEDIRDQVEAAITLQQMWRSRST  687

>PHYRA_84534
Length=1368

 Score = 33.9 bits (76),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  124  RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHE  167
            R+ AI +Q   R W  ++++ R ++H   +V IQ+ WR Y  H+
Sbjct  801  RKYAIVLQKNVRCWLMRRRFLRKKQH---IVAIQKYWRRYVVHK  841

>CCA16530
Length=1512

 Score = 33.9 bits (76),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 27/43 (63%), Gaps = 3/43 (7%)

Query  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAY  163
             +RK RAAI +Q++ RM   + +Y   RR   ++V IQ+ WR Y
Sbjct  1303  ERKIRAAILVQSLMRMELERVEYKLQRR---AIVSIQRCWRRY  1342

>PITG_01615
Length=1087

 Score = 33.9 bits (76),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 4/84 (5%)

Query  86   MEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAITIQNVFRMWSNQK  141
            M++    + D ++  +     G L R+  QR K K   RR    +A  IQ VFR +  +K
Sbjct  601  MDLMELRRMDRMASQIGSIARGILTRKFIQREKQKRHFRRVIEPSAARIQRVFRGYIVRK  660

Query  142  KYSRYRRHLSSVVLIQQVWRAYAS  165
            +    R  + + + +QQ+WR+ ++
Sbjct  661  RLEGIRDQIEAAITLQQMWRSRST  684

>PYIW_20166
Length=1532

 Score = 33.5 bits (75),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 3/38 (8%)

Query  126   AAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAY  163
             AAITIQ+V RM   +K+Y   RR   ++V IQ  W+ Y
Sbjct  1351  AAITIQSVMRMALERKEYRFQRR---AIVSIQHGWKKY  1385

>PHYCA_101481
Length=74

 Score = 30.4 bits (67),  Expect = 6.7, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 18/33 (55%), Gaps = 3/33 (9%)

Query  461  PLHPEVYPT---WQEFADAIAQFGVVIEAAPSA  490
            PL P  YP    W  FA ++ +F + I A PSA
Sbjct  30   PLTPSSYPMNLHWNAFASSLRRFSLGISAYPSA  62

>PPTG_08220
Length=1335

 Score = 33.5 bits (75),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 0/42 (0%)

Query  122  RKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAY  163
            RKRR++I IQ ++R WS   +Y R  R   + V +Q   R +
Sbjct  849  RKRRSSIRIQAMWRSWSCWHRYQRIIRRTRAAVKLQCTTRGF  890

>PPTG_16221
Length=1259

 Score = 33.5 bits (75),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (7%)

Query  124  RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHE  167
            R+ AI +Q   R W  +++Y R ++    +V+IQ+ WR Y  H+
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQQ---IVVIQKYWRRYVVHK  738

>PHALS_11023
Length=1345

 Score = 33.5 bits (75),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 70/166 (42%), Gaps = 15/166 (9%)

Query  9    EKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALETLLTRY  68
            +++ G  E++     H     K   +  + EF   K  +Q  +GGV   +KA+E L   +
Sbjct  676  QQLAGLMEVVQQTQTHYIRCIKPNDVGASDEFDRTKVSSQLRYGGV---LKAVEILRQSF  732

Query  69   FVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNE-------DQVGSLIRRPGQRYKGKD  121
             V +++ D  +   V +   +    +  L C   +       DQ      R   R +  D
Sbjct  733  PVRMSHADFVKQYRVLASTNSGLKAKVALDCTAGDLIEALDIDQTELGKTRVFLRQQAFD  792

Query  122  R--KRRAAITIQNVFRM---WSNQKKYSRYRRHLSSVVLIQQVWRA  162
            R  KRR  +  ++V R+   W  +++   Y R + S+  IQ  W+A
Sbjct  793  RLEKRREHVIAKSVMRLQSLWRGRQQRRIYIRQIHSLESIQVRWKA  838

>SPRG_08565
Length=1132

 Score = 33.1 bits (74),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (55%), Gaps = 1/64 (2%)

Query  506  EVHVSSTQDVILSTASIHKRKVAGYAFPQTTAPYEAIRGASMAIGKVL-VDDSVFGYSSV  564
            E+H+ S+ DV+L TAS      +G    +T A  E  RG  + I +   +D+S +G  ++
Sbjct  529  ELHLLSSGDVVLKTASDLIGHYSGETQTKTQACLEMARGKVLVIDEAYNLDNSRYGKQAL  588

Query  565  DYLV  568
            D LV
Sbjct  589  DVLV  592

>PHYRA_73096
Length=1841

 Score = 33.1 bits (74),  Expect = 9.0, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 6/50 (12%)

Query  115   QRYKGKDRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYA  164
             QRY+ +   R+  I +Q+++RM S +K+Y+   R    V L+Q +WR +A
Sbjct  1037  QRYRDE---RKKIILVQSLWRMHSARKQYTMRDRQ---VTLLQSLWRCHA  1080

>PHYSO_359062
Length=1775

 Score = 33.1 bits (74),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 28/42 (67%), Gaps = 3/42 (7%)

Query  123   KRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYA  164
             +R+  I +Q+++RM S +K+Y++  R    V L+Q +WR +A
Sbjct  989   ERKKIIIVQSLWRMHSARKQYTKRDRQ---VTLLQSLWRCHA  1027

Lambda      K        H        a         alpha
   0.323    0.137    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 64858439412

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40