Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYU1_G0017331475873271835070.0
PYIR_134181475874774127380.0
PYIW_199691475873373825320.0
PYAP_177631475879453517800.0
PHYCA_5114151475874469416590.0
PPTG_171291475874572816070.0
PHYKE_839514758142069116030.0
PYAR_135711475866662715890.0
PHYSO_3489031475876669315810.0
PITG_184581475874775715720.0
PHYRA_810981475874168615590.0
HYAP_071041475872163215030.0
PHALS_064761475872652814380.0
PYVX_235901475868967213456e-176
CCI441111475857653310415e-132
CCA228431475858654210355e-131
SPRG_06355147587135747221e-83
SDRG_01763147587365816881e-78
PHYSO_4705331382110844692259e-18
SDRG_045751382110034222142e-16
PPTG_113651382111064212115e-16
PITG_172501382110464222098e-16
H257_117731382110264091982e-14
SPRG_126211382110033491963e-14
H310_082921382110074021954e-14
H257_0193413355510223881821e-12
PYIR_141071382111764171802e-12
SDRG_079831335559913761774e-12
SPRG_1903013355510003731741e-11
PYAP_222301382111164471678e-11
PYU1_G002110138219994341623e-10
PYVX_215131382114462261534e-09
PYIW_157171382111214331463e-08
PYAR_14788138217953741176e-05
SPRG_09182126797109280880.17
SPRG_09179137130126280880.17
H257_02565139367100572870.21
H310_0856812738655470850.32
PYAR_22431101110134980820.84
SPRG_2133413456618139752.4
PHYSO_33854475731110932782.7
PYAP_24112101110131680783.1
SDRG_1729113838222737753.4
PHYCA_53267610954166277773.6
PYVX_20285935756217684.0
PPTG_036021911538243754.4
H257_10608142853129224764.5
PYIR_191748307255756764.6
H257_025621348798972764.9
PHYSO_5453781252822483744.9
PYU1_G00116912818120084755.5
PYU1_G008219953591289120756.4
PYVX_217761252820383726.7
PYVX_241348092470924747.4
SDRG_09904123246128237747.6
H310_022101348799972748.0
PYAP_21608100158129838748.0
PYAP_14982156401444212748.5
PITG_155251252822483728.5
SPRG_02378123246135189748.8
PYIW_2792516737611624698.9
H310_12516134035316877210.0
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYU1_G001733

Length=732
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYU1_G001733                                                          1355       0.0   
PYIR_13418                                                            1059       0.0   
PYIW_19969                                                            979        0.0   
PYAP_17763                                                            690        0.0   
PHYCA_511415                                                          643        0.0   
PPTG_17129                                                            623        0.0   
PHYKE_8395                                                            622        0.0   
PYAR_13571                                                            616        0.0   
PHYSO_348903                                                          613        0.0   
PITG_18458                                                            610        0.0   
PHYRA_81098                                                           605        0.0   
HYAP_07104                                                            583        0.0   
PHALS_06476                                                           558        0.0   
PYVX_23590                                                            522        6e-176
CCI44111                                                              405        5e-132
CCA22843                                                              403        5e-131
SPRG_06355                                                            282        1e-83 
SDRG_01763                                                            269        1e-78 
PHYSO_470533                                                          91.3       9e-18 
SDRG_04575                                                            87.0       2e-16 
PPTG_11365                                                            85.9       5e-16 
PITG_17250                                                            85.1       8e-16 
H257_11773                                                            80.9       2e-14 
SPRG_12621                                                            80.1       3e-14 
H310_08292                                                            79.7       4e-14 
H257_01934                                                            74.7       1e-12 
PYIR_14107                                                            73.9       2e-12 
SDRG_07983                                                            72.8       4e-12 
SPRG_19030                                                            71.6       1e-11 
PYAP_22230                                                            68.9       8e-11 
PYU1_G002110                                                          67.0       3e-10 
PYVX_21513                                                            63.5       4e-09 
PYIW_15717                                                            60.8       3e-08 
PYAR_14788                                                            49.7       6e-05 
SPRG_09182                                                            38.5       0.17  
SPRG_09179                                                            38.5       0.17  
H257_02565                                                            38.1       0.21  
H310_08568                                                            37.4       0.32  
PYAR_22431                                                            36.2       0.84  
SPRG_21334                                                            33.5       2.4   
PHYSO_338544                                                          34.7       2.7   
PYAP_24112                                                            34.7       3.1   
SDRG_17291                                                            33.5       3.4   
PHYCA_532676                                                          34.3       3.6   
PYVX_20285                                                            30.8       4.0   
PPTG_03602                                                            33.5       4.4   
H257_10608                                                            33.9       4.5   
PYIR_19174                                                            33.9       4.6   
H257_02562                                                            33.9       4.9   
PHYSO_545378                                                          33.1       4.9   
PYU1_G001169                                                          33.5       5.5   
PYU1_G008219                                                          33.5       6.4   
PYVX_21776                                                            32.3       6.7   
PYVX_24134                                                            33.1       7.4   
SDRG_09904                                                            33.1       7.6   
H310_02210                                                            33.1       8.0   
PYAP_21608                                                            33.1       8.0   
PYAP_14982                                                            33.1       8.5   
PITG_15525                                                            32.3       8.5   
SPRG_02378                                                            33.1       8.8   
PYIW_27925                                                            31.2       8.9   
H310_12516                                                            32.3       10.0  

>PYU1_G001733
Length=732

 Score = 1355 bits (3507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 718/718 (100%), Positives = 718/718 (100%), Gaps = 0/718 (0%)

Query  15   ERKRVERAQSDGVRATADEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDM  74
            ERKRVERAQSDGVRATADEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDM
Sbjct  15   ERKRVERAQSDGVRATADEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDM  74

Query  75   FYNGGGGITRSTSDYTTGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLMPLNEDE  134
            FYNGGGGITRSTSDYTTGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLMPLNEDE
Sbjct  75   FYNGGGGITRSTSDYTTGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLMPLNEDE  134

Query  135  VLPaamrtttgaaggSEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGT  194
            VLPAAMRTTTGAAGGSEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGT
Sbjct  135  VLPAAMRTTTGAAGGSEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGT  194

Query  195  IIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVTAI  254
            IIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVTAI
Sbjct  195  IIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVTAI  254

Query  255  PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAF  314
            PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAF
Sbjct  255  PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAF  314

Query  315  ERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSP  374
            ERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSP
Sbjct  315  ERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSP  374

Query  375  RNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVL  434
            RNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVL
Sbjct  375  RNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVL  434

Query  435  LVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNA  494
            LVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNA
Sbjct  435  LVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNA  494

Query  495  NYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVP  554
            NYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVP
Sbjct  495  NYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVP  554

Query  555  LDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQ  614
            LDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQ
Sbjct  555  LDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQ  614

Query  615  FSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674
            FSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR
Sbjct  615  FSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674

Query  675  LHRKsstdthsvassessshhtpsnvstASSYLSLNVPPPAAPAQKVNFKPVGILKKK  732
            LHRKSSTDTHSVASSESSSHHTPSNVSTASSYLSLNVPPPAAPAQKVNFKPVGILKKK
Sbjct  675  LHRKSSTDTHSVASSESSSHHTPSNVSTASSYLSLNVPPPAAPAQKVNFKPVGILKKK  732

>PYIR_13418
Length=747

 Score = 1059 bits (2738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/741 (77%), Positives = 634/741 (86%), Gaps = 32/741 (4%)

Query  16   RKRVERAQSDGV--RATADEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVED  73
            +KR+ERAQSD V  RAT DE+ LRMSKHV E+AHR+ RNTTMNTSAASSTSSYMSDDVE+
Sbjct  15   QKRLERAQSDAVTVRAT-DEETLRMSKHVQEEAHRFQRNTTMNTSAASSTSSYMSDDVEE  73

Query  74   MFYNGGG-------GITRSTSDYTTGR-TTSSMRD----ANG-MNRST--SLRVTDVYRT  118
            MFYNG            RST ++  GR TTSSMR     +NG  +R+T  SLRVTD+YRT
Sbjct  74   MFYNGSANGNANPSASARSTDNF--GRSTTSSMRSTDTYSNGNASRATGGSLRVTDMYRT  131

Query  119  TEQLRNTNLMPLNEDEVLPaamrtttgaaggSEA----DALRAELVEMKQEMQTIRREMM  174
            TEQ+R TNLMPL EDEVLPAA R TT  A  S      DALRAEL EMK E+Q IRREMM
Sbjct  132  TEQMRGTNLMPLQEDEVLPAASRATTTMATASNGGNPIDALRAELSEMKLEVQAIRREMM  191

Query  175  NEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVA---EPQPELSPAQLDTIT  231
            NEMHVTRYDVLKEITMLKGTIIQLV ALESKGVR+LDA G A   E QPELS  +LDTI+
Sbjct  192  NEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTIS  251

Query  232  RTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPL  291
            RTTA++TSKATK+R A RE +A P ++R + SRLTQLAPVADDALSTPLLQHQID+MFPL
Sbjct  252  RTTALYTSKATKERRATREDSA-PVLVRAS-SRLTQLAPVADDALSTPLLQHQIDEMFPL  309

Query  292  VDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALC  351
            V+ S +LQ  AQ +DP+SREWA ERFQ+WVDSRFNVG DNLLALVGDGGSGKSTL GALC
Sbjct  310  VECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALC  369

Query  352  DRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPL  411
            D+FHDN+VA+HLC FDRKSKSSPRNVLLSLVNQLI+NLPLFKNQLARLNLKYVLEETDPL
Sbjct  370  DKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPL  429

Query  412  VLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITS  471
            VLARKVLVDPLCALEEPLTAKV + DGIDQCKSK RNDLLDFLA IIPE PTW+G+FITS
Sbjct  430  VLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGVFITS  489

Query  472  KPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNF  531
            KPSPELPAKLAITSLLDFS KN NYMNDTIILINDIIGNFSDKDV +AR+ILKRKSGGNF
Sbjct  490  KPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNF  549

Query  532  TFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPL  591
            TFLDFTKQALSHPGMEE+NGY+PLDVLHDLPESIYEIY+EIFEDKFGKG +R+WKKVQPL
Sbjct  550  TFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRIWKKVQPL  609

Query  592  LDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWL  651
            L+LIVTAASGPYALITE QAQEQFSLS++DIR IRRAF DII V HGTYR+ETSA++EWL
Sbjct  610  LELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWL  669

Query  652  VDPQRSGEQFYVNISASMDILRRLHRKsstdthsvassessshhtpsnvstASSYLSLNV  711
            VDPQR+GEQFYV++S  M++LR+LH +  +     A+S  +S +  SNVSTASS+LS  V
Sbjct  670  VDPQRAGEQFYVDVSGGMNLLRQLHHQ-DSSDTHSAASSEASSNNVSNVSTASSHLSYVV  728

Query  712  PPPAAPAQKVNFKPVGILKKK  732
            PPPAAP  KVNFKPVGILKKK
Sbjct  729  PPPAAP--KVNFKPVGILKKK  747

>PYIW_19969
Length=733

 Score = 979 bits (2532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/738 (72%), Positives = 621/738 (84%), Gaps = 40/738 (5%)

Query  16   RKRVERAQSDGVRATA-DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDM  74
            ++R+ERAQSD VRATA DED+LRMSKHV E+AHR+ RNTTMNTS+ASSTSSYMSDDVEDM
Sbjct  15   QRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSASSTSSYMSDDVEDM  74

Query  75   FYNGGGGITRSTSDY---TTGRTTS-SMRDANGMNRST--SLRVTDVYRTTEQLRNT-NL  127
            FYNGG   + S+S     T GR+T+ S R  +  +R+T  SLRVTDVYRTTEQLR T NL
Sbjct  75   FYNGGDARSTSSSVRSTDTYGRSTAASTRSTDTYSRATGGSLRVTDVYRTTEQLRGTANL  134

Query  128  MPLNEDEVLPaamrtttgaag-------------gSEADALRAELVEMKQEMQTIRREMM  174
            +PL EDEVLPAA RTTT +               GS+ DALR EL EMK E+Q IRREMM
Sbjct  135  IPLQEDEVLPAASRTTTTSQMPTNGNYSNGNSGGGSQLDALRTELSEMKLEVQAIRREMM  194

Query  175  NEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTT  234
            NEMHVTRYDVLKE+TMLKGTI+QLV ALE+KG               LS  +++TI+RTT
Sbjct  195  NEMHVTRYDVLKEVTMLKGTILQLVTALETKG---------------LSTDEINTISRTT  239

Query  235  AVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDF  294
            A+ TSKATKDR A R+ ++ P ++R + SRLTQLAPVAD+ALSTPLLQHQID+MFPL++ 
Sbjct  240  ALFTSKATKDRRATRDESSSPMLVRAS-SRLTQLAPVADEALSTPLLQHQIDEMFPLIEC  298

Query  295  SADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRF  354
            S +L   ++ +D +SREWA ERFQ+W+DSRFNVG DNLLALVG+GGSGKSTL GAL D+F
Sbjct  299  SDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKF  358

Query  355  HDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLA  414
            HDNIVA+HLC FDRKSKSSPRNVLLSLVNQ+I+NLPLFKNQLARLNLKYVLEE+DP+VLA
Sbjct  359  HDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLA  418

Query  415  RKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPS  474
            RK+LVDPLCALEEP+TAKV ++DG+DQCKS+ RNDLLDFLA IIPE PTW+G+FITSKPS
Sbjct  419  RKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPS  478

Query  475  PELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFL  534
            PELPA+LAI+SLLDFS KN NYMNDT+I+INDIIG+FSDKDV +AR+ILKRKSGGNFTFL
Sbjct  479  PELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFL  538

Query  535  DFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDL  594
            DFTKQALSHPGMEE+NGY+PLDVLHDLPESIYEIY+EIFEDKFGKG NR+WKKVQPLL+L
Sbjct  539  DFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLEL  598

Query  595  IVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDP  654
            IVTAASGPYALITE QAQEQF+LS++DIR IRR+F DIIDVRHGTYR+E SA++EWLVDP
Sbjct  599  IVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDP  658

Query  655  QRSGEQFYVNISASMDILRRLHRKsstdthsvassessshhtpsnvstASSYLSLNVPPP  714
            QR+GEQFYV++S  M  LR+LH + S++THSV SS+ SS +  SNVSTASS+LS  V   
Sbjct  659  QRAGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDGSSSNATSNVSTASSHLSYVV---  715

Query  715  AAPAQKVNFKPVGILKKK  732
              P  KVNFKPVGILKKK
Sbjct  716  PPPVPKVNFKPVGILKKK  733

>PYAP_17763
Length=794

 Score = 690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/535 (60%), Positives = 414/535 (77%), Gaps = 8/535 (1%)

Query  151  EADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTL  210
            +AD LRAEL EMKQEMQ I+REMMNEMH+TRYDVLKE+TMLKGTI+QLV+ ++  G    
Sbjct  179  DADLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHF  238

Query  211  DAGGVAE------PQP-ELSPAQLDTITRTTAVHTSKATKDRLAAREVTAIPTIIRGTNS  263
            D    A       PQ  ELSP + + ++R T    SK TK+R+       IP ++R T+S
Sbjct  239  DTATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSS  298

Query  264  RLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDS  323
            RLTQLAPV D ALSTPL Q QIDDMFPL+DFSA++Q+ ++  +  SREW F+R Q+W+DS
Sbjct  299  RLTQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDS  358

Query  324  RFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVN  383
            RFNVG D +LA+VGD GSGK+    ++CD++ D +VA H CKFDRK+KSSPRNVLLSLVN
Sbjct  359  RFNVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVN  418

Query  384  QLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK  443
            QL ++LP+FK+QLARLNLKYVLEETD   L+RKVL+DPL ALEEPLT K ++ D IDQC+
Sbjct  419  QLTSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCR  478

Query  444  SK-DRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTII  502
            +    NDL DFL+AIIPE P WLG  ++SKPSPE    + ++S+LDFS +NANYMNDT+ 
Sbjct  479  TGVGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVF  538

Query  503  LINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLP  562
            LINDI   F D D +EA+ ILK KSGGN+++L+FTKQALS+PGMEE +G+VP+DVLHDLP
Sbjct  539  LINDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLP  598

Query  563  ESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDI  622
            +S+YEIY+EIFEDKFGKG  R+W+K  P+L LI TAASGPYA ITE+   +  S ++D++
Sbjct  599  QSLYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEV  658

Query  623  RMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677
            RM+RRAF DII +RHGTY + +SA+Y+WL D QR GEQ++++++  + +LR++ R
Sbjct  659  RMLRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLR  713

>PHYCA_511415
Length=744

 Score = 643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/694 (49%), Positives = 456/694 (66%), Gaps = 82/694 (12%)

Query  32   DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNGGGGITRSTSDYTT  91
            DED+LR+ K   +DA R+ R+TT+  +   +      DDVE+MFY               
Sbjct  23   DEDSLRL-KQQQDDAVRFDRSTTLADTVNVT------DDVEEMFY---------------  60

Query  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLM--PLNEDEVLPaamrtttgaagg  149
            GR T         NRST+      YRTTEQ+R  NL    L+E+ V P+A   ++  +  
Sbjct  61   GRNT---------NRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQF  111

Query  150  S----------------------------------------EADALRAELVEMKQEMQTI  169
            S                                        E + LR+E++E+K+E++ I
Sbjct  112  SATTPSNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEEVKAI  171

Query  170  RREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDT  229
            RRE+MNE+HVTRYDVLKE+T+LKG I QL AA  S    +      ++P   LS  +   
Sbjct  172  RREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDP---LSAEERAA  228

Query  230  ITRTTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDD  287
            +TR T+  TS AT+DRLAA    V   P      + RLTQLAPVAD+ALSTPL   QI++
Sbjct  229  LTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPLSSQQINE  288

Query  288  MFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLV  347
            MFPL+DF++DL  HA+   P SR WA  R ++W+D+RFNVG D LLA+VG+GG+GKS  +
Sbjct  289  MFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSAFL  348

Query  348  GALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEE  407
            G +  +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE
Sbjct  349  GTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVLEE  408

Query  408  TDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWL  465
             DP++LA KVLVDPL A+EEP+ A  +LVDGIDQC +    RN+LL F A +IP+ P+W+
Sbjct  409  ADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPSWI  468

Query  466  GIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKR  525
            G  ++SKPS +L  +L ++S+LDFS KN  ++ D   L++DI  NFSD D +EA+ +LK 
Sbjct  469  GFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVLKH  528

Query  526  KSGGNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNR  583
            KSGGNF +L+FTKQALSHPGM    + G VPL VLH+LPE++Y+IY EIFEDKFG+G  R
Sbjct  529  KSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGRAR  588

Query  584  LWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRME  643
            +W K +PLL L+V AASGPY+ +TEEQA+E F L+ +D+RM+RR+F D++ V+HG+YR+E
Sbjct  589  VWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYRIE  648

Query  644  TSAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677
            +SA+  WL DP RS EQFY +I  ++  LR++ R
Sbjct  649  SSALCAWLSDPARSEEQFYFSIDDALHALRKMRR  682

>PPTG_17129
Length=745

 Score = 623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/728 (47%), Positives = 473/728 (65%), Gaps = 40/728 (5%)

Query  32   DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNGGGGITRSTSDYTT  91
            DED+LR+ +   +D  R+ R+TT+  +   +      DDVE+MFY  G   + ++SD   
Sbjct  27   DEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFY--GRSTSNTSSDMPQ  78

Query  92   GRTTSSMRDANGMNRST------------SLRVTDVYRTTEQLRNTNLMPLNEDEV----  135
             RTT  +R AN M  S                    + TT         P N        
Sbjct  79   YRTTEQIR-ANNMTLSALHEDVEASNVSNVSSSFSQFSTTTPSNYAASTPGNFSSTYHGF  137

Query  136  --LPaamrtttgaaggSEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKG  193
              + +   T+   +G  E + LR+E++E+K+E++ IRRE+MNE+HVTRYDVLKE+ +LKG
Sbjct  138  NTVHSTTGTSRAVSGDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKG  197

Query  194  TIIQLVAALESKG-VRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAARE--  250
             I QL A   S     +      ++P   LS  +   +TR T+  TS+AT+DRLAA    
Sbjct  198  AIAQLTATQHSAPPSVSSTESSSSDP---LSAEERAALTRQTSTKTSQATRDRLAASRTN  254

Query  251  VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSR  310
            +   P      + RLTQLAPVAD+ALSTPL   QI++MFPL+DF+++L  HA+   P +R
Sbjct  255  IHKTPPPAARASVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTR  314

Query  311  EWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKS  370
             WA  R ++W+D+RFNVG D LLA+VG+GG+GKS   G +  +F  N++A H C+FDRKS
Sbjct  315  TWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKS  374

Query  371  KSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLT  430
            KSSPRNVLLS+V+QL+ NLP FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ 
Sbjct  375  KSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMH  434

Query  431  AKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLD  488
            A  +LVDGIDQC +    RN+LL+F A +IP+ P+W+G  I+SKPS +L  +L ++S+LD
Sbjct  435  ATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLD  494

Query  489  FSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGM--  546
            FS KN  ++ D   +++DI  NFSD D +EA+ +LK+KSGGNF +L+FTKQALSHPGM  
Sbjct  495  FSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAA  554

Query  547  EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALI  606
              + G VPL+VLH+LPE++Y+IY EIFEDKFG+G  R+W K +PLL LIV AA+GPY+ +
Sbjct  555  ASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPM  614

Query  607  TEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNIS  666
            TEEQA+E F  + +D+RM+RR+F D++ V+HG YR+E+SA+  WL DP RS EQFY +I 
Sbjct  615  TEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSID  674

Query  667  ASMDILRRLHR---KsstdthsvassessshhtpsnvstASSYLSLNVPPPAAPAQKVNF  723
             ++  LR++ R     S+  HS +SS+  + H  S+    SS           P    +F
Sbjct  675  DALQALRKMRRVSSSGSSSGHSGSSSDGKATHRASSRVKTSSKTHQRAHTRHEPRANPDF  734

Query  724  KPVGILKK  731
            KPVGILK+
Sbjct  735  KPVGILKR  742

>PHYKE_8395
Length=1420

 Score = 622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/691 (48%), Positives = 449/691 (65%), Gaps = 82/691 (12%)

Query  32    DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNGGGGITRSTSDYTT  91
             DED+LR++K   +DA R+ RNT M  +   S      DDVEDMFY               
Sbjct  693   DEDSLRLNKQ-QQDADRFDRNTAMTDTVNVS------DDVEDMFY---------------  730

Query  92    GRTTSSMRDANGMNRSTSLRVTDV--YRTTEQLRNTN--LMPLNEDEVLPaamrtttgaa  147
             GR+T+  + +N          +DV  YRTTEQ+R TN  L  L+E+E +  +    + + 
Sbjct  731   GRSTTQSQLSN---------TSDVPSYRTTEQMRGTNSTLTALHEEEAMTPSASHLSNSF  781

Query  148   ggS-------------------------------------EADALRAELVEMKQEMQTIR  170
               S                                     E   LRAEL E+K E+QTIR
Sbjct  782   ASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEVKAEVQTIR  841

Query  171   REMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTI  230
             RE+MNE+H+TRYDVLKE+T+LKG + QL AA  +  V    +        E   A    +
Sbjct  842   REVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSAEDRAA----L  897

Query  231   TRTTAVHTSKATKDRLAAREVT--AIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288
             TR  +  TSK TKDRLA   V    +P      + RLTQLAPVAD+ALSTPL   QI++M
Sbjct  898   TRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQQINEM  957

Query  289   FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348
             FPL+DF+++L  HA+   P +R WA  R ++W+D+RFNVG D +LA+VGDGG+GKS   G
Sbjct  958   FPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGKSAFCG  1017

Query  349   ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408
              +  +F  N++A H C+FDRKSKS+PRNVLLS V+QL+ NLP FKNQLARLNLKYVLEE+
Sbjct  1018  TVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKYVLEES  1077

Query  409   DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLG  466
             DP +LA KV VDPL A+EEP+ A  +LV+G+DQC +    RN+LL+FL+ IIP+ P+W+G
Sbjct  1078  DPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQLPSWVG  1137

Query  467   IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526
               I+SKP  +   +L ++S+LDFS KN  +++D   L++DI  NFSD+D +EA+ +LKRK
Sbjct  1138  FMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKRVLKRK  1197

Query  527   SGGNFTFLDFTKQALSHPG--MEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRL  584
             SGGNF +L+FTKQALSHPG  M  + G VPL+VL DLP+S+++IY EIFEDKFG+G  R+
Sbjct  1198  SGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQGRARI  1257

Query  585   WKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMET  644
             W K +PLL LIV AA+GPY+ +TE QA+E F  + +D+RM+RR+F D+++V+HG YR+E+
Sbjct  1258  WAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGAYRLES  1317

Query  645   SAMYEWLVDPQRSGEQFYVNISASMDILRRL  675
             SA+  WL DP RS EQFY+++  ++  LR+L
Sbjct  1318  SALCSWLSDPARSEEQFYLSVDDALTALRKL  1348

>PYAR_13571
Length=666

 Score = 616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/627 (51%), Positives = 414/627 (66%), Gaps = 64/627 (10%)

Query  69   DDVEDMFY-----NGGGGIT-RSTSDYTTGRTTSS-----------MRDANGMNRSTSLR  111
            +D ED FY     N G  I+ RS     + R+T+S           M      +RST+  
Sbjct  5    EDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRSTATT  64

Query  112  VTDVYRTTEQLRNTNLMPLNEDEVLPaamrtttgaaggSEADALRAELVEMKQEMQTIRR  171
             ++  RTTE LR T L  LNE E  P    T        +   +          M  IRR
Sbjct  65   PSNA-RTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAAPAYTPMPAIRR  123

Query  172  EMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTIT  231
            EMMNEMH +RYDVLKE+TMLKGTI QL+                            +T+ 
Sbjct  124  EMMNEMHTSRYDVLKEVTMLKGTITQLI----------------------------ETMA  155

Query  232  RTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPL  291
            R T    SK+TK+R+       +P ++R T+ RLTQLAPV D ALSTPL Q QID++FPL
Sbjct  156  RRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPL  215

Query  292  VDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALC  351
            +DFSA++Q+ A+  D  +REWAF+R Q+W+DSRFNVG D LLA+VGD G+GK+       
Sbjct  216  LDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-------  268

Query  352  DRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPL  411
                      H CKF+RK KSSPRNVLLS+VNQL A LP FK+QLARLNLKYVLEETD L
Sbjct  269  ----------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVL  318

Query  412  VLARKVLVDPLCALEEPLTAKVLLVDGIDQCK-SKDRNDLLDFLAAIIPEFPTWLGIFIT  470
             LARKVLVDPL +LEEPLTAK +L+DG+DQC  +   NDLLDFL+ ++PE P+WLG  IT
Sbjct  319  ALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGFLIT  378

Query  471  SKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGN  530
            +KPSPE   K+ +TSLLDFS KNA Y+NDT +L+ DI+  F  +D ++A  ILK KS GN
Sbjct  379  TKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGN  438

Query  531  FTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQP  590
            +++L+FT+QA+S+PGME   G VP+DVLHDLP+S+YEIY+EIFEDKFGKG  RLW+K  P
Sbjct  439  YSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALP  498

Query  591  LLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEW  650
            +L LI TAASGPYA ITE+   +  S ++DD+RM+RRAF DII +RHGTY + +SA+++W
Sbjct  499  VLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDW  558

Query  651  LVDPQRSGEQFYVNISASMDILRRLHR  677
            L DPQR GE ++V+++  + +LRR+ R
Sbjct  559  LTDPQRKGEPYHVDVTLHVKVLRRVLR  585

>PHYSO_348903
Length=766

 Score = 613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/693 (48%), Positives = 444/693 (64%), Gaps = 66/693 (10%)

Query  32   DEDALRMSKHVAEDAH-RYARnttmntsaasstssymsDDVEDMFYNGGGGITRST-SDY  89
            DED+LR+ K   +DA  RY R+ T++ +   +      DDVEDMFY      T S  SD 
Sbjct  30   DEDSLRL-KQAQDDAPVRYDRSGTLSDTVNVT------DDVEDMFYGRNNRSTASAASDV  82

Query  90   TTGRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTNLM-----------PLNEDEVLPa  138
               RTT  +RD       T L ++ ++   E    TN +           P N     P 
Sbjct  83   PQYRTTEQLRD-------THLTLSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPG  135

Query  139  a-------------------------mrtttgaaggSEADALRAELVEMKQEMQTIRREM  173
                                          +  A   E + LRAE++E+K+E++ IRRE+
Sbjct  136  NFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGELERLRAEVLEVKEEVKAIRREV  195

Query  174  MNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLD---TI  230
            MNE+HVTRYDVLKE+ +LKG + QL AA  S           +     L P   D    +
Sbjct  196  MNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSSTDSSS-----LDPLSADDRAKL  250

Query  231  TRTTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288
             R T+  TS AT++RLAA    V   P      + RLTQLAPVADDALSTPL   QI++M
Sbjct  251  VRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLTQLAPVADDALSTPLTSQQINEM  310

Query  289  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348
            FPL+DF+++L  HA+   P SR WA  R ++W+DSRFN G D LLA+VG+GG+GKS   G
Sbjct  311  FPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCG  370

Query  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408
             +  +F  N++A H C+FDRKSKS+PRNVLLS+V+Q++ N P FKNQLARLNLKYVLEE 
Sbjct  371  TVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEA  430

Query  409  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLG  466
            DP++LA KVLVDPL ALEEP+ A  ++VDGIDQC   ++ RN+LL+F A IIP+ PTW+G
Sbjct  431  DPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVG  490

Query  467  IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526
              ++SKPS +L  +L ++S+LDFS +N  ++ D   L+ DI  NFSD D  +A+ +LK+K
Sbjct  491  FLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQK  550

Query  527  SGGNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRL  584
            SGGNF +L+FTKQALSHPGM    + G VPL VL+DLPE++Y+IY EIFEDKFG+G  R+
Sbjct  551  SGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARV  610

Query  585  WKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMET  644
            W K +PLL L+V AASGPY+ +TEEQA+E F+L+ +D+RM+RR+F D++ VRHG+YR+E+
Sbjct  611  WGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIES  670

Query  645  SAMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677
            SA+  WL DP RS EQFY +I  ++  LR++ R
Sbjct  671  SALCAWLSDPARSEEQFYFSIDDALQALRQMRR  703

>PITG_18458
Length=747

 Score = 610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/757 (45%), Positives = 476/757 (63%), Gaps = 92/757 (12%)

Query  32   DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNGGGGITRSTSDYTT  91
            DED+LR+ +   +D  R+ R+TT+  +   +      DDVE+MFY       RSTS+   
Sbjct  23   DEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFYG------RSTSN---  67

Query  92   GRTTSSMRDANGMNRSTSLRVTDVYRTTEQLRNTN--LMPLNED----------------  133
              T+S M                 YRTTEQLR  N  L  L+ED                
Sbjct  68   --TSSDMPQ---------------YRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQF  110

Query  134  -EVLPaamrtttgaaggS----------------------EADALRAELVEMKQEMQTIR  170
                P+    +T     S                      E + LR+E++E+K+E++ IR
Sbjct  111  SATTPSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVLEVKEEVKAIR  170

Query  171  REMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTI  230
            RE+MNE+HVTRYDVLKE+ +LKG I QL A               +     LSP +   +
Sbjct  171  REVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVSST--ESSSSDPLSPDERAAL  228

Query  231  TRTTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288
            TR T+  TS+AT+DRLAA    +   P      + RLTQLAPVAD+ALSTPL   QI++M
Sbjct  229  TRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPLNPQQINEM  288

Query  289  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348
            FPL+D +++L  HA+   P +R WA  R ++W+D+R+N+G D LLA+VG+GG+GKST  G
Sbjct  289  FPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKSTFCG  348

Query  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408
             +  +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ +LP FKNQLARLNLKYVLEE 
Sbjct  349  TVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYVLEEA  408

Query  409  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWLG  466
            DP +LA KVLVDPL A+EEP+ A  +LVDGIDQC   S  RN+LL+  A +IP+ P+W+G
Sbjct  409  DPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLPSWVG  468

Query  467  IFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRK  526
              ++SKPS +L  +L ++S+LDFS KN  ++ D   L++DI  NFSD D +EA+ +LK+K
Sbjct  469  FLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKVLKKK  528

Query  527  SGGNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRL  584
            SGGNF +L+FTKQALSHPG+    + G VPL+VLH+LPE++Y+IY EIFEDKFG+G  R+
Sbjct  529  SGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQGRARV  588

Query  585  WKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMET  644
            W K +PLL L+V AA+GPY+ +TEEQA+E F+L+ +D+RM+RR+F D++ V+HG+YR+E+
Sbjct  589  WGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSYRIES  648

Query  645  SAMYEWLVDPQRSGEQFYVNISASMDILRRLHRKsstdthsvassessshhtpsnvstAS  704
            SA+  WL DP RS EQFY ++  ++  LR++ R+  + + S   S +SS    +    AS
Sbjct  649  SALCAWLSDPARSEEQFYFSVDDALLALRKI-RRVGSSSSSSGHSGNSSDGKAAKNGHAS  707

Query  705  SYLSLNVPPPAAPAQKVN----------FKPVGILKK  731
            S  S  V   +   Q+ +          +KPVGILK+
Sbjct  708  SRPSNRVKTSSKTHQRAHTRYEPRTSPDYKPVGILKR  744

>PHYRA_81098
Length=741

 Score = 605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/686 (48%), Positives = 445/686 (65%), Gaps = 83/686 (12%)

Query  32   DEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNGGGGITRSTSDYTT  91
            DED+LR+ K   +DA R  R+TT+  +   +      DDVE+MFY G             
Sbjct  24   DEDSLRL-KQTQDDALRLDRSTTLTDTVNVT------DDVEEMFYGG-------------  63

Query  92   GRTTSSMRDANGMNRSTSLRVTDV--YRTTEQLRNTN--LMPLNEDEV------------  135
                          RST   V+DV  YRTTEQLR T+  L  L+ED              
Sbjct  64   --------------RST---VSDVPQYRTTEQLRGTHMTLSALHEDAEASNASSSFSQFS  106

Query  136  --------------LPaamrtttgaaggS---------EADALRAELVEMKQEMQTIRRE  172
                          +P        +   S         E + LR+E+VE+K+E++ IRRE
Sbjct  107  ATTPSNYAASTPGHVPNQGAYHDFSTAHSTTRAISDAFELERLRSEVVEVKEEVKAIRRE  166

Query  173  MMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITR  232
            +MNE+HVTRYDVLKE+ +LKG I QL A        ++ +   +   P LS  +   +TR
Sbjct  167  VMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDP-LSADERAALTR  225

Query  233  TTAVHTSKATKDRLAARE--VTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFP  290
             T+  TS AT++RLAA    +   P      + RLTQLAPVAD+ALSTPL   QI+DMFP
Sbjct  226  QTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQQINDMFP  285

Query  291  LVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGAL  350
            L+DF+++L  HA+   P SR WA  R ++W+D+RFNVG D LLA+VG+GG+GKS  +G +
Sbjct  286  LIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAFLGTV  345

Query  351  CDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDP  410
              +F  N++A H C+FDRKSKSSPRNVLLS+V+QL+ +LP FKNQLARLNLKYVLEE DP
Sbjct  346  AQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLEEADP  405

Query  411  LVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKS--KDRNDLLDFLAAIIPEFPTWLGIF  468
             VLA KVLVDPL A+EEP+ A  +LVDGIDQC +  + RN+LL+F A +IP  P+W+G  
Sbjct  406  FVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSWVGFM  465

Query  469  ITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSG  528
            ++SKPS +L  +L ++S+LDFS KN  +++D   L+ D+  NFSD D +EA+ +LK+KSG
Sbjct  466  VSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLKQKSG  525

Query  529  GNFTFLDFTKQALSHPGM--EEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWK  586
            GNF +L+FTKQALSHPGM    + G VPL VLH+LPE++Y+IY EIFEDKFG+G  R+W 
Sbjct  526  GNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRARVWG  585

Query  587  KVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSA  646
            K +PLL LIV AA+GPY+L+TEEQA++ F+L+ +D+RM+R +F D++ VRHG YR+E+SA
Sbjct  586  KAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRIESSA  645

Query  647  MYEWLVDPQRSGEQFYVNISASMDIL  672
            +  WL DP RS EQFY  I  ++  L
Sbjct  646  LCGWLSDPARSEEQFYFAIDDAIQAL  671

>HYAP_07104
Length=721

 Score = 583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/632 (48%), Positives = 413/632 (65%), Gaps = 30/632 (5%)

Query  69   DDVEDMFYNGGGGITRSTSDYTTGRTTSSM-----------RDA----NGMNRSTSLRVT  113
            DDVE+MFY+     TRST+     R+T  +            DA     G N S+S    
Sbjct  50   DDVEEMFYSSTQ--TRSTNGPPQYRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQF  107

Query  114  DVYRTTEQLRNTNLMPLNEDEVLPaamrtt--tgaaggSEADALRAELVEMKQEMQTIRR  171
              + T+  + + NL   +       +M +         SE + LR EL+E+KQE+  IR+
Sbjct  108  SDHATS--ISSVNLTSTHHHLTTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQ  165

Query  172  EMMNEMHVTRYDVLKEITMLKGTIIQLVAALE--SKGVRTLDAGGVAEPQPELSPAQLDT  229
             ++NE+HVTRYDVLKE+ +LKG I QL       +  V       V+ P   LS A    
Sbjct  166  HVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNP---LSSADRGA  222

Query  230  ITRTTAVHTSKATKDRLAAREVTAI--PTIIRGTNSRLTQLAPVADDALSTPLLQHQIDD  287
            +TR T+  TS AT+DRLAA  V     P      + RLTQLAPVAD ALSTPL   Q++D
Sbjct  223  LTRQTSTMTSSATRDRLAASRVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMND  282

Query  288  MFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLV  347
            +FPL+DF+ +L  HA++  P SR WA  R ++W++SRF  G D LLA+VG+GGSGKS   
Sbjct  283  LFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFC  342

Query  348  GALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEE  407
            G +  ++   +VA H C+FDRK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE
Sbjct  343  GTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEE  402

Query  408  TDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRNDLLDFLAAIIPEFPTWL  465
             DP++LA KVLVDPL ALE+P+    +LVDGIDQC      RN+LL+FLA +IP+ P+WL
Sbjct  403  ADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWL  462

Query  466  GIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKR  525
            G+ ++SKPS +L  +L ++S+LDFS KN  ++ D   L+++I  +F  +DV EA+++LK 
Sbjct  463  GVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKH  522

Query  526  KSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLW  585
            KSGGNF +L+FTKQALS      + G V +DVL +LPE++Y+IY EIFEDKFG G  R+W
Sbjct  523  KSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVW  582

Query  586  KKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETS  645
             K + +L L + A +GPY+ +TEEQAQE F L+ +D+R++RR+F D++ V+HG YR+E S
Sbjct  583  SKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENS  642

Query  646  AMYEWLVDPQRSGEQFYVNISASMDILRRLHR  677
            A+  WL DP R+ EQFY NI  ++  LR++ R
Sbjct  643  ALCAWLCDPARAEEQFYFNIDDALQALRKMRR  674

>PHALS_06476
Length=726

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/528 (53%), Positives = 374/528 (71%), Gaps = 29/528 (5%)

Query  155  LRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGG  214
            L +E++++K E++TIRRE+MNE+HVTRYDVLKE+T+LKG I QL A+ +S    +  +  
Sbjct  157  LHSEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQL-ASTKSLNSSSSVSST  215

Query  215  VAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVT---AIPTIIRGTNSRLTQLAPV  271
             +     LS  +   +TR T   TS+AT+DRLAA  +    A P  IR + +RLTQLAPV
Sbjct  216  DSSSSDPLSSDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRAS-ARLTQLAPV  274

Query  272  ADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDN  331
            ADDALSTPL   QI++ FPL+DF+++L  HA+   P SR WA  R Q+W+D+RF++G D 
Sbjct  275  ADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDT  334

Query  332  LLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPL  391
            LLA+VG+GGSGKS   G +  +F  N++A H C+FDRKSKS PRNVLLS+V+QL+ NLPL
Sbjct  335  LLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPL  394

Query  392  FKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCK--SKDRND  449
            FKNQLARLNL+YVLEETDP +LA KVL+DPL ALEEP  +  +L+DGIDQC   S  RN+
Sbjct  395  FKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNE  454

Query  450  LLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIG  509
            LL+F++ II   P+W+G  ++SKPS +L   L ++S+LDFS KN  ++ D   L+ DI  
Sbjct  455  LLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQ  514

Query  510  NFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGME--EENGYVPLDVLHDLPESIYE  567
             FSD D  EA+ +L +KSGGNF +L+FTKQALSHPGM     NG VPL VL +LPE++Y+
Sbjct  515  YFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYD  574

Query  568  IYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRR  627
            IY EIFEDKFG+GH R W K +PLL LIV AA+GPY+L+TEEQA++Q  L+ DD+RM+RR
Sbjct  575  IYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRR  634

Query  628  AFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRRL  675
            +F DI+ V+H                     EQFY +I  ++  LR++
Sbjct  635  SFVDIVAVKH--------------------EEQFYFSIEDALLALRKM  662

>PYVX_23590
Length=689

 Score = 522 bits (1345),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 312/672 (46%), Positives = 417/672 (62%), Gaps = 94/672 (14%)

Query  19   VERAQSDGVRATADEDALRMSKHVAEDAHRYARnttmntsaasstssymsDDVEDMFYNG  78
            ++RAQSDGV    D+++LR+S+ VAEDA R+ R+TT+++++++ +       VE+MFY  
Sbjct  21   LKRAQSDGV-PLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDD-----VEEMFY--  72

Query  79   GGGITRSTSDYTTGRTTSSMRDANGMNRST--SLRVTDVYRTTEQLRNTNLMPLNEDEVL  136
                                    G +RST  S+R TDVYRTTEQLR+T L PL ED VL
Sbjct  73   -------GGGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRSTGLEPLAEDRVL  125

Query  137  PaamrtttgaaggS-EAD------ALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEIT  189
            P A+   +        AD      ALRAEL +++ E Q IRRE+MNE+HV RYDVLKE+T
Sbjct  126  PPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVMNELHVLRYDVLKEVT  185

Query  190  MLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAR  249
            +LKG + QL+AAL          GG A  +P  + +     T  ++     +  DR A  
Sbjct  186  VLKGAVAQLLAALAP-------GGGDAGSRPGSAGSATSAATTASSSSAELSPADRAA--  236

Query  250  EVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTS  309
             +   PT           LAPV D ALS PL   Q+D++FPLVD S D+   A+   P +
Sbjct  237  -IGVAPT-----------LAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGT  284

Query  310  REWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRK  369
            R+WA  R Q+W+DSRFNVG D LL +VG  G+GKST  G++CD    N++A H CKFDRK
Sbjct  285  RDWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRK  344

Query  370  SKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPL  429
            +KS+PR VLLSLV Q++ANLP FK QLARLNLKYVLEE D  VLA KVL+DPL A EEP+
Sbjct  345  AKSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPI  404

Query  430  TAKVLLVDGIDQCKSKD----RNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITS  485
            TAK L++DG+DQCK+      RN+LL+FLA ++P+ P+WLG+ ++SKP+PEL  +L  TS
Sbjct  405  TAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTS  464

Query  486  LLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPG  545
            LLDFS KN  ++ D   L++DI  NF+D   +EAR +L+ K+GGNF +LDFT+QALS PG
Sbjct  465  LLDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPG  524

Query  546  MEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYAL  605
            +  ++G + LD+LHDLPES+YEIY EIFED                              
Sbjct  525  L--DDGELELDMLHDLPESLYEIYLEIFEDN-----------------------------  553

Query  606  ITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNI  665
                          DD+R+++R+F DII VR G YR+E+SA++EWL DP RSGE F+ + 
Sbjct  554  --------------DDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDA  599

Query  666  SASMDILRRLHR  677
             A +D LRRL +
Sbjct  600  DAGVDELRRLQQ  611

>CCI44111
Length=576

 Score = 405 bits (1041),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 218/533 (41%), Positives = 324/533 (61%), Gaps = 18/533 (3%)

Query  151  EADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALES------  204
            + +A R E+  M++E+Q +R+E++  +  TRYD+LKEI  LKG +  +   ++S      
Sbjct  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKI  111

Query  205  KGVRTLDAGGVAEPQPELSPAQLDTITRTTAVHTSKAT--KDRLAAREVTAIPTIIRGTN  262
              +    A G A      S    D    +  V   ++T   D      + +  +I+R   
Sbjct  112  NKLNHTTANGSA-----CSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILR--E  164

Query  263  SRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVD  322
            S L  L  + +  LS PL + +ID+MFPL+D S D++ +A K    +R WA +    W+ 
Sbjct  165  SGLPTLMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQ  224

Query  323  SRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLV  382
            S F  G + +L +VG+GG+GKSTL G +C +F  N+ A H  +FDRK  SS R+V+LSLV
Sbjct  225  SNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLV  284

Query  383  NQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCAL-EEPLTAKVLLVDGIDQ  441
            +Q  + L L+K QL RLNL+Y+L E++PLV+A K+L+DPL A+ E   T   +L DGIDQ
Sbjct  285  SQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQ  344

Query  442  CKSKDR-NDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDT  500
            C  K++ NDLL+ L+ I   FP+W+G  +TSK  P   A+L   S++     N +++ D+
Sbjct  345  CLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDS  404

Query  501  IILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHD  560
             IL+ +++  F  K  +EA DIL RKSGGN  +L F  +ALSHP +  E  ++ LDVL +
Sbjct  405  RILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDE  464

Query  561  LPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRD  620
            LPES+ EI   IF+DKFG+GH R+WK  +P+L++IV AA+GPY L+ E Q ++QF L  +
Sbjct  465  LPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELREN  524

Query  621  DIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILR  673
            + RMI RAFTDII      YR+  S++Y+WLV  +RS + F++N  A    LR
Sbjct  525  EWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 403 bits (1035),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 208/542 (38%), Positives = 330/542 (61%), Gaps = 33/542 (6%)

Query  150  SEADALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRT  209
            ++ +A+R E+ +M+ E+Q++R+E++  +  TRYD++KEI  L+G +  +   L    V++
Sbjct  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117

Query  210  LDAGGVAEPQPELSPAQLDTITRTTAVHTSKATKDRLAAREVTAIPTII-----------  258
               G              +  T      +  A  D + +R +T   + I           
Sbjct  118  SPTG-----------TNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFV  166

Query  259  ----RGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAF  314
                   +S  +   P+ +  LS PL + + D+MFP +D  +DL+ +A K    +R WA 
Sbjct  167  TERLNTKDSSFSTSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWAL  226

Query  315  ERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSP  374
            +R ++W++S F    D++L ++G+GGSGKSTL G +C +F   + A H C+FDRKS+SS 
Sbjct  227  DRVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSS  286

Query  375  RNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPL---TA  431
            R+V+LSLV+Q  +  PL+K QL  LNL+Y+L+E++PLV+A K+L++PL A+  P+   T 
Sbjct  287  RDVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAI--PVSNSTR  344

Query  432  KVLLVDGIDQC-KSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFS  490
              +L DGIDQC    + NDLLD ++ I   FP+ +G  +TSK SP   AK    S++   
Sbjct  345  GFVLFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLH  404

Query  491  PKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEEN  550
             +N  +MND+ IL+ + I NF  K  +EA DIL RKSGGN  +L FT++ALSHP +  E 
Sbjct  405  ERNGKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGER  464

Query  551  GYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQ  610
             ++ LDVL +LP+S+ +I+  IFEDKFG+GH R+WK V+P+L+ IV AA+G + L+ E Q
Sbjct  465  TFLSLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQ  524

Query  611  AQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMD  670
             +++F L +++ RM++R+FTDII      YR+ TS+++ WL+   RS + FY++  A + 
Sbjct  525  IKQRFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGIK  583

Query  671  IL  672
             L
Sbjct  584  FL  585

>SPRG_06355
Length=713

 Score = 282 bits (722),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/574 (30%), Positives = 307/574 (53%), Gaps = 71/574 (12%)

Query  154  ALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKG-------  206
            A+ A + EMK+ +  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +        
Sbjct  141  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL  200

Query  207  -----------------------VRTLDAGGVAEPQPELS-----------PAQLDTITR  232
                                     TL+   V EP P++            P +  T+ R
Sbjct  201  LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVR  260

Query  233  TTAVHTSKATKDRLAAREVTAIPTIIRGTNSRL---TQLAPVADDALSTPLLQHQIDDMF  289
             +   +SK +++   + +++   + I   +S+L   +   P+ D AL+ P  ++ ++   
Sbjct  261  ESIRASSKLSRE---SSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQHL  316

Query  290  PLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGA  349
            P ++     Q  A +  P++R WA  ++  W           +L +VG  G+GKSTL+  
Sbjct  317  PFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSH  372

Query  350  LCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETD  409
            L   + + I+A H  ++D +  +S   +L+SL +Q+   LP F+ QL RLNL Y+++E D
Sbjct  373  LVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPD  430

Query  410  PLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFI  469
            P+VLA K+L++PL ++  PL ++V+++D +D+  S    +L+  LA +  EFP+W+   +
Sbjct  431  PVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFLL  490

Query  470  TSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDII--GNFSDKDVSEARDILKRKS  527
            +S+P   +   L    +L F  ++  +  D  I +  ++      DK++     +LK KS
Sbjct  491  SSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNI---LFLLKAKS  547

Query  528  GGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKK  587
             G+F +L F  QA +    E + G     ++ +LP+++YEIYD++FE+K+GKG  R+W+K
Sbjct  548  QGSFLYLQFVDQAFAMIHSEIDAG-----MILELPKTLYEIYDQVFEEKYGKGRRRVWQK  602

Query  588  VQPLLDLIVTAASGPY-----ALITEEQAQEQFSLSRDDIRMIRRAFTDI--IDVRHGTY  640
            VQP+L+ IV AA+  +       +TE   Q  F L + D+ +I R+F DI  +D   G Y
Sbjct  603  VQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  662

Query  641  RMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674
            R+++  ++++LVD  RS E  ++N+   +  L +
Sbjct  663  RLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

>SDRG_01763
Length=736

 Score = 269 bits (688),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 171/581 (29%), Positives = 305/581 (52%), Gaps = 75/581 (13%)

Query  154  ALRAELVEMKQEMQTIRREMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKG-------  206
            A+ A + EMK+ +  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +        
Sbjct  154  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVAT  213

Query  207  --VRTLDAG-----------------------GVAEPQPELS-----------PAQLDTI  230
              +RT D                          V EP P++            P +  T+
Sbjct  214  PLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  273

Query  231  TRTTAVHTSKATKD--RLA------AREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQ  282
             R +   +SK +++  +L+      +RE + +         R +   P+ D AL+ P  +
Sbjct  274  FRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQPW-E  332

Query  283  HQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSG  342
            + ++   P ++     Q  A +  P++R WA  ++  W           +L +VG  G+G
Sbjct  333  NVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAG  388

Query  343  KSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLK  402
            KSTL+  L   + + I+A H  ++D +   +P  +L+SL +Q+   LP ++ QL RLNL 
Sbjct  389  KSTLLSHLVSNYPEQIMASHFVRYDERH--APSAILMSLAHQISCKLPDYQQQLVRLNLP  446

Query  403  YVLEETDPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFP  462
            Y+++E DP+VLA K+L++PL ++  PL ++V+++D +D+  S    +L+  LA +  EFP
Sbjct  447  YLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFP  506

Query  463  TWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDII--GNFSDKDVSEAR  520
            +W+   ++S+    +   L    +L F  ++  +  D  I +  ++      DK++    
Sbjct  507  SWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDDKNI---L  563

Query  521  DILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKG  580
             +LK KS G+F +L F  QA S    E + G     ++ +LP++++EIYD++FE+K+GKG
Sbjct  564  FLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG-----MILELPKTLHEIYDQVFEEKYGKG  618

Query  581  HNRLWKKVQPLLDLIVTAASGPY-----ALITEEQAQEQFSLSRDDIRMIRRAFTDIIDV  635
              R+W+KVQ +L+ IV AA+  +       +TE   Q  F L + D+ +I R+F DI+ V
Sbjct  619  RRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTV  678

Query  636  RH--GTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674
                G YR+++  ++++LVD  RS E  ++N+   +  L +
Sbjct  679  DEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYLTK  719

>PHYSO_470533
Length=1084

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 110/469 (23%), Positives = 188/469 (40%), Gaps = 73/469 (16%)

Query  263  SRLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVD  322
            SR  QL    +  L     Q ++  +    +F   +    ++F    REW FERFQ WV 
Sbjct  427  SRKGQLISALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERF--IGREWLFERFQQWVQ  484

Query  323  SRF---------NVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSS  373
                         +    +  LVG  GSGK+++   +     + I A H  + + +   +
Sbjct  485  GSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPE-IAAFHFARQEDEQTHN  543

Query  374  PRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLCALEEPL  429
             R  +LSL  QL   LP + + L        LEE  P+     L  ++L+ PL A+  P 
Sbjct  544  ARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVSQLLIGPLNAIARPT  600

Query  430  TAK--VLLVDGIDQC----------------KSKDRNDLLDFLAAIIPEFPTWLGIFITS  471
            T K  VLL+DGI+                   SKD   L+  L A+    P W+ + + S
Sbjct  601  TYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLS  660

Query  472  KPSPELPAKLAITSLLDFSPKNANYMNDTII--LIN---------------------DII  508
            +  P + +KL      D    +  + ND  I   +N                     D+ 
Sbjct  661  REDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVP  720

Query  509  GNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEI  568
             N  +  + +  +++ R+S G F +     QA++        G + L  L +LP  +   
Sbjct  721  ANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRLRLHELAELPVGMGAY  773

Query  569  YDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRA  628
              + F   F   H+   ++V+P+L+ ++ AA  P  L T  +  E     + D   +  +
Sbjct  774  LQQFFASHFSD-HDMYKQRVRPVLE-VLCAAYEPLPLATLARVLEWDVYEQRDASSVLGS  831

Query  629  FTDI---IDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILRR  674
               I    D      R   S++ +W+ D   SG+ F+V++++  + L R
Sbjct  832  LFCIEAGYDANSQLLRPFHSSVLDWIQDSNSSGD-FFVDVASGHERLGR  879

>SDRG_04575
Length=1003

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 104/422 (25%), Positives = 181/422 (43%), Gaps = 47/422 (11%)

Query  264  RLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDS  323
            RL Q+A      L    LQ ++  +F    F   +  + Q F    REW   +   W  +
Sbjct  404  RLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLDQWKQT  461

Query  324  RFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL-CKFDRKSKSSPRNVLLSLV  382
                  D +  + G  G+GKS L   +       I A HL CK D +++S  R  +LSL 
Sbjct  462  H-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSH-RRCILSLA  514

Query  383  NQLIANLPLFKNQLARLN-LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VLLVDGID  440
             QL   LP + + L + + L+ V+  +  + L   +LV PL A+ EP T   V+L+DG+D
Sbjct  515  YQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVILLDGLD  574

Query  441  QCKSKDRND--LLDFLAAIIPEFPTWLGIFITSKPSPELPAKL-------AITSLLDFSP  491
              +     D  L+  L  ++ + P+W+ + +TS+  P +  KL       A+   +D S 
Sbjct  575  SLEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKLQGFTPQIALDKCVDNSR  634

Query  492  KN-ANYMNDTII----------LINDIIGNFS-DKDVSEARDILKRKSGGNFTFLDFTKQ  539
            ++  NY+   ++            + + G    ++D +  RD+L R   G F +      
Sbjct  635  QDIMNYLQRALVPYLPSVRHRRRCSSLRGAPKVERDATTHRDLLLRI--GLFLYASHIVH  692

Query  540  ALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAA  599
            ALS   +        LD L   P  +     + FE +F   H +  + ++PLL+ ++ AA
Sbjct  693  ALSQHRLT-------LDHLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-VLCAA  742

Query  600  SGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGE  659
              P  L       +  S  + ++    ++   + D      +   +++ EWL D   +G 
Sbjct  743  YEPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTD--SNVLKPFHTSVLEWLQDSNAAGP  800

Query  660  QF  661
             F
Sbjct  801  FF  802

>PPTG_11365
Length=1106

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 99/421 (24%), Positives = 170/421 (40%), Gaps = 70/421 (17%)

Query  310  REWAFERFQDWV------DSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL  363
            REW FE+FQ WV       S   +    +  +VG  GSGK+++   +     + I A HL
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSCPE-IAAFHL  561

Query  364  CKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV----LARKVLV  419
               + +   + R  +LSL  QL   LP + + L        LEE  P+     L   +L+
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLI  618

Query  420  DPLCALEEPLTAK--VLLVDGIDQC------------------KSKDRNDLLDFLAAIIP  459
             PL A+  P   K  VLL+DG++                    ++KD    +  L  ++ 
Sbjct  619  GPLTAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVS  678

Query  460  EFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTII--LINDII---------  508
              P W+ I + S+  P + +KL      D + +   + ND  I   IN  +         
Sbjct  679  RLPEWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVE  738

Query  509  ------------GNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLD  556
                        GN  +  + +  +++ R+S G F +     QA+S        G + L 
Sbjct  739  FEKAAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLHLH  791

Query  557  VLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFS  616
             L +LP  +     + F   F   H+    +V+P+L+ +  AA  P  + T  +  E   
Sbjct  792  ELAELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLE-VCCAAYEPLPVATIARVLEWDV  849

Query  617  LSRDDIRMIRRAFTDI---IDVRHGTYRMETSAMYEWLVDPQRSGEQFYVNISASMDILR  673
              + D   +  +   I    D    T R   +++ +W+ D   SG  F+V++++  + L 
Sbjct  850  YEQRDAATVLGSLFSIEAGNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDVASGHERLG  908

Query  674  R  674
            R
Sbjct  909  R  909

>PITG_17250
Length=1046

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 174/422 (41%), Gaps = 75/422 (18%)

Query  308  TSREWAFERFQDWVD----SRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL  363
              REW F+ FQ WV     S   +    +  ++G  GSGKS++   +     + I A H 
Sbjct  448  VGREWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQACPE-IAAFHF  506

Query  364  CKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV----LARKVLV  419
               + +   + R  +LSL  QL   LP + + L        LEE  P+     L   +L+
Sbjct  507  ATQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLI  563

Query  420  DPLCALEEPLTAK--VLLVDGID-----QC---------KSKDRNDLLDFLAAIIPEFPT  463
             PL A+  P   K  VLL+DG++      C         +SKD   L+  L  ++   P 
Sbjct  564  GPLNAIARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPE  623

Query  464  WLGIFITSKPSPELPAKLAITSLLDFSPKNANYMNDTII-----------LINDI-----  507
            W+ I + S+  P + +KL      D   +     ND  I            ++D+     
Sbjct  624  WVRIVLLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQA  683

Query  508  ---IGNFSDK---DVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDL  561
               IG+ SD     + +  +++ R+S G F +     QA+S        G + L  L +L
Sbjct  684  SAQIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAEL  736

Query  562  PESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALIT-----EEQAQEQFS  616
            P  +     + F   F   H+    +++P+L+ +  AA  P  L T     E    EQ  
Sbjct  737  PVGMGAYLHQFFASHFAD-HDVYKHRIRPVLE-VCCAAYEPLPLATLARVLEWDVYEQ--  792

Query  617  LSRDDIRMIRRAFTDIIDVRH----GTYRMETSAMYEWLVDPQRSGEQFYVNISASMDIL  672
              RD   M+   F+  I+  H       R   S++ +W+ D   SG  F+V++++  + L
Sbjct  793  --RDAAAMLGSLFS--IEAGHDPEAQLLRPFHSSVLDWVRDSNSSG-VFFVDVASGHERL  847

Query  673  RR  674
             R
Sbjct  848  GR  849

>H257_11773
Length=1026

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 101/409 (25%), Positives = 168/409 (41%), Gaps = 32/409 (8%)

Query  264  RLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDS  323
            RL QL       L     Q ++  +F    F A++    Q F    REW  ++  +W   
Sbjct  426  RLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLTEW---  480

Query  324  RFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVN  383
                       + G  G+GK T V A   +    + A HL   + +   + R  +LSL  
Sbjct  481  --KASSSQTFWITGQIGTGK-TAVAASVIQNQPEVRAFHLVSKEDEQTQNHRRCVLSLAY  537

Query  384  QLIANLPLFKNQLARLN--LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VLLVDGID  440
            QL   LP +   L + +  L+ ++  +    L   +LV PL A+ +P T   V+L+DG+D
Sbjct  538  QLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVILIDGLD  597

Query  441  QCKSKD--RNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKL-AITSLLDFSPKNANYM  497
              +  +   N  +  LAA +   P W+   +TS+  P +  KL  +   +          
Sbjct  598  AFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKCGHQTR  657

Query  498  NDTIILINDIIGNF---SDKDVSEA--RDILKRKSGGNFTFLDFTKQALSHPGMEEENGY  552
            +D +  +   +  F   +DKDV  A  R I++R S G F +      ALS   +      
Sbjct  658  DDMLKYLQLALVQFVANADKDVPAATLRFIVER-SEGLFLYASHIVNALSQKRLT-----  711

Query  553  VPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQ  612
              LD L   P  +     + FED+F   H      V+PLL+ ++ AA  P  + T     
Sbjct  712  --LDKLESFPVGMGGYLRQYFEDQFTALHYE--TSVRPLLE-VLCAAFEPLHMSTLHNIM  766

Query  613  EQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDPQRSGEQF  661
            +  S +  D     ++   + D      +   ++++EWL D   +G  F
Sbjct  767  KWDSYAHRDFLGSFKSLLYVSD--ENELKPFHTSVFEWLEDAHAAGRFF  813

>SPRG_12621
Length=1003

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 90/349 (26%), Positives = 156/349 (45%), Gaps = 37/349 (11%)

Query  264  RLTQLAPVADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDS  323
            RL Q+A      L    LQ ++  +F    FS     + Q F    REW  ++   W  +
Sbjct  419  RLAQIATALRGKLDHDGLQARLFSIF--SPFSFQTNKYTQGF--AGREWVLDQLDQWKQT  474

Query  324  RFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL-CKFDRKSKSSPRNVLLSLV  382
                  D +  + G  G+GKS L   +       + A HL CK D +++S  R  +LSL 
Sbjct  475  H-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDEQTQSH-RRCVLSLA  527

Query  383  NQLIANLPLFKNQLARLN-LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VLLVDGID  440
             QL   LP + + L + + L+ V+  +  + L   +LV PL A+ EP T   V+L+DG+D
Sbjct  528  YQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVILLDGLD  587

Query  441  QCKSKDRND--LLDFLAAIIPEFPTWLGIFITSKPSPELPAKL-------AITSLLDFSP  491
              +     D  L+  L A++ + P+W+ + +TS+  P +  KL       A+    D S 
Sbjct  588  SLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGFAPQIALDKCADHSR  647

Query  492  KN-ANYMNDTIILINDIIGNFSDKDVSEAR-DILKRKSGGNFTFLDFTKQALSHPGMEEE  549
            ++  +Y+   ++     + + +   V EA    +  ++ G F +      ALS   +   
Sbjct  648  QDIMSYLQKALL---PYLPSTTAGVVPEATLQFIAGRAEGLFLYASHIVHALSQHRLT--  702

Query  550  NGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTA  598
                 LD L   P  +     + FE +F   H +  + ++PLL+++  A
Sbjct  703  -----LDNLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLEVLCAA  744

>H310_08292
Length=1007

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 94/402 (23%), Positives = 165/402 (41%), Gaps = 47/402 (12%)

Query  282  QHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGS  341
            Q ++  +F    F A++    Q F    REW  ++   W              + G  G+
Sbjct  429  QARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLTQW-----KASASQTFWVTGQIGT  481

Query  342  GKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLN-  400
            GK+ L   +       + A HL   D +   +PR  +LSL  QL   LP +   L +   
Sbjct  482  GKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCILSLAYQLTTQLPAYAAFLQQGEP  540

Query  401  LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VLLVDGID--QCKSKDRNDLLDFLAAI  457
            L+ ++  +    L   +LV PL A+ +P T   V+L+DG+D  Q  +   N  +  L A+
Sbjct  541  LEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLDGLDAFQDAAALDNCFVSSLVAL  600

Query  458  IPEFPTWLGIFITSKPSPELPAKL-------AITSLLDFSPKNANYMNDTIILINDIIGN  510
            + + P+W+ +  TS+  P +  KL       A+   +D S        D +  +   +  
Sbjct  601  VRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVDQSSA------DMLKYLQAALVP  654

Query  511  FSDKDVS-----EARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESI  565
            F   D       E    +  +S G F +      AL           + LD L   P  +
Sbjct  655  FVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHAL-------HQKRLTLDKLESFPVGM  707

Query  566  YEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASG-PYALITEEQAQEQFSLSRDDIRM  624
                 + FED+F   H      ++PLL+++  A    P A++ +    + +S  RD +  
Sbjct  708  GGYLRQFFEDQFSAHHYE--TSIRPLLEVLCAALEPMPMAMLHDVMKWDTYS-HRDCL--  762

Query  625  IRRAFTDIIDVRHG-TYRMETSAMYEWLVDPQRSGEQFYVNI  665
               AF  ++ V      +   ++++EWL D   +G +F+V +
Sbjct  763  --GAFKSLLYVSESDDIKPFHTSVFEWLQDANAAG-RFFVRV  801

>H257_01934
Length=1022

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 96/388 (25%), Positives = 164/388 (42%), Gaps = 41/388 (11%)

Query  291  LVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGAL  350
            L  FS   Q+         R W    F +WV S  +     +  L G  GSGK+ L   +
Sbjct  444  LSPFSFQSQISTATQGYCGRAWVLHEFDEWVTSPPS-NARRVFLLTGVIGSGKTALAAHI  502

Query  351  CDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET--  408
                   +VA HL   + +   + R  +L+LV QL   LP + N L   + K  LEET  
Sbjct  503  IQN-RPEVVAFHLASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVF  559

Query  409  --DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLG  466
              +   L +++L+ PL  +  P +  V+L+DGI+     D N L+  L A +  +P W+ 
Sbjct  560  VGNLADLVQELLIAPLERIATPPSTMVILIDGIECFPCADDN-LVAILTASLNRWPAWMR  618

Query  467  IFITSKPSPELPAKLAITSL----LDFSPKNANYMNDTIILINDIIGNFSDKDVS-----  517
               TS+  P + + L    L    LD +   A    D    ++  +G  S  D+S     
Sbjct  619  FVFTSREDPRVLSLLQAYMLPPIALDLA--CAQSKRDVRQYLDTALG--SHFDISPPMPP  674

Query  518  EARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKF  577
               D+L  ++ G F +      ++S       +G   LD L ++P ++     + F  +F
Sbjct  675  HVIDLLVDRTQGLFLYARHLVDSIS-------SGQWNLDNLDNVPTTMGGFLHQNFATQF  727

Query  578  GKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRH  637
                ++    V+P+L+ +V AA  P  L          ++   D+   ++  +D   + H
Sbjct  728  PVV-DKYKVDVRPVLE-VVCAAHEPLTLDALS------AIMHFDVYQAQKLQSDFGSLFH  779

Query  638  ----GTYRMETSAMYEWLVDPQRSGEQF  661
                G       ++ +WL DP+ +G+ F
Sbjct  780  AGEGGVILPFHLSLLDWLQDPRSAGDYF  807

>PYIR_14107
Length=1176

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 89/417 (21%), Positives = 170/417 (41%), Gaps = 78/417 (19%)

Query  310  REWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRK  369
            REW F + ++W+ S        +  + G  GSGK+ L   +     + I A H    + +
Sbjct  550  REWLFMQLENWIASP---TATQVFWVTGQIGSGKTALAARMVQVIPE-IAAFHFALQEDE  605

Query  370  SKSSPRNVLLSLVNQLIANLPLFKNQL-ARLNLKYVLEETDPLVLARKVLVDPLCALEEP  428
               + R  +LSL  QL   LP +   L +R  L+ ++  ++   L  ++LV+PL  +  P
Sbjct  606  QTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARP  665

Query  429  LTAK--VLLVDGI--------------------------------DQCKSKDRND--LLD  452
             + K  VLL+DG+                                D C S    D  L+ 
Sbjct  666  QSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVS  725

Query  453  FLAAIIPEFPTWLGIFITSKPSPELPAKL-AITSLLDFSPKNANYMNDTIILINDIIGN-  510
             L +++   P W+ + + S+  P + AKL   T  +      +    D    + +++G  
Sbjct  726  ALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQQDIKRYVENMLGES  785

Query  511  --------------------FSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEEN  550
                                FS+K   E  D++ ++S G F +     Q++       E 
Sbjct  786  PATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-------EE  838

Query  551  GYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQ  610
              + +D L  LP  +   + + F+  F +   +    ++P+L+ ++ A+  P++L     
Sbjct  839  KRLAVDQLESLPIGMGGYFRQFFDGHFDE--QQYQDSIRPVLE-VLCASFEPFSLWN---  892

Query  611  AQEQFSLSRDDIRMIRRAFTDIIDV-RHGTYRMETSAMYEWLVDPQRSGEQFYVNIS  666
                 +    D + I  +F  ++ +   G  R   S+M +W+ DP  +G +++VNI+
Sbjct  893  IVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAG-KYFVNIA  948

>SDRG_07983
Length=991

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 153/376 (41%), Gaps = 56/376 (15%)

Query  308  TSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFD  367
             +REW   ++  WV +     G  +  + G  GSGKS ++  +       I A HL   +
Sbjct  440  VAREWVLAKYDAWVQTP---NGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHE  495

Query  368  RKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLC  423
                 S R  +LSLV QL   LP + N    +N +  LEE  P+     L   +L+ PL 
Sbjct  496  EDQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLS  552

Query  424  ALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPEL------  477
            A+  P +  VLL+DGID  +       +  L A +  +P+W+     ++  P +      
Sbjct  553  AIAHPASILVLLIDGIDCFEP----GFVATLTAHMDLWPSWVRFVFGTREDPSVLQTLQA  608

Query  478  ---PAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFL  534
               PA     SL D       Y++   + +   + + S    +E  D +  +S G F + 
Sbjct  609  YMPPAVSLDPSLPDSKLDIKAYLH---LALTPQLTSESQSKRNEIVDFIAARSEGLFLYA  665

Query  535  DFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDL  594
                 A++        G + L+ L   P S+       F+ +F        K ++P+L+ 
Sbjct  666  RHLVNAIA-------VGQLQLNQLDAFPTSMGGCLQHCFDAQF-PSIEYYKKTIRPVLE-  716

Query  595  IVTAASGPYAL-----ITEEQAQEQFSLSRDDIRMIRRAF----TDIIDVRHGTYRMETS  645
            ++ AA+ P  L     I      EQ    +D +      F    +DII   H       S
Sbjct  717  VLCAANEPLPLSMFRSILALAVYEQ----QDILAWFGSLFYITDSDIIKPFH-------S  765

Query  646  AMYEWLVDPQRSGEQF  661
            ++ +WL D + +G  F
Sbjct  766  SVLDWLQDAKSAGPYF  781

>SPRG_19030
Length=1000

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/373 (24%), Positives = 153/373 (41%), Gaps = 50/373 (13%)

Query  308  TSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFD  367
             +REW   ++  WV +     G  +  + G  GSGKS ++  +       I A HL   +
Sbjct  448  VAREWVLAKYDAWVQTP---NGSRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHE  503

Query  368  RKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLC  423
                 S R  +LSLV QL   LP + N    LN +  LEE  P+     L   +L+ PL 
Sbjct  504  EDQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLS  560

Query  424  ALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPEL------  477
            A+  P +  VLL+DGI+  +       +  L A +  +P+W+     ++  P +      
Sbjct  561  AIAHPASILVLLIDGIECFEP----GFVATLTAHMDLWPSWVRFVFGTREDPSVLQTLQA  616

Query  478  ---PAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFL  534
               PA     SL +       Y++   + +   +   S    +E  D +  ++ G F + 
Sbjct  617  YMPPAVSLDPSLYESKLDIKAYLH---LALTPQLTTESQGKRNEIVDFIAARAEGLFLYA  673

Query  535  DFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGK-GHNRLWKKVQPLLD  593
                 A++        G + L+ L   P S+       F+ +F   G+ +  K ++P+L+
Sbjct  674  RHLVNAIA-------VGQLQLNELDAFPTSMGGCLQHCFDAQFPSIGYYK--KTIRPVLE  724

Query  594  LIVTAASGPYAL-----ITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMY  648
             ++ AA+ P  L     I      EQ  +      +     +DII   H       S++ 
Sbjct  725  -VLCAANEPLPLSMFRSILSLDVYEQHDILAWFGSLFYITDSDIIKPFH-------SSVL  776

Query  649  EWLVDPQRSGEQF  661
            +WL D + +G  F
Sbjct  777  DWLQDAKSAGPYF  789

>PYAP_22230
Length=1116

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 100/447 (22%), Positives = 173/447 (39%), Gaps = 99/447 (22%)

Query  291  LVDFSADLQLH--AQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348
            L  FS  LQ+    Q+F  T R W  E  + W+++     G  +  + G  GSGK++ V 
Sbjct  477  LSPFSFQLQISQLTQRF--TGRAWLLESIRQWINTPVT-SGSKVFWVTGQIGSGKTS-VA  532

Query  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408
            A   +    I A H    D       R  +LSL  QL   LP +      L     LEE 
Sbjct  533  ARMVQLMPEIAAFHFALQDDDQTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEI  589

Query  409  DPL----VLARKVLVDPLCALEEPLTAK--VLLVDGIDQCKSKDRN--------------  448
             P+     L   +LV+PL A+  P + K  VLL+DG++   S + N              
Sbjct  590  VPVSSVQALLTHLLVNPLNAIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGR  649

Query  449  ----------------------DLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITS-  485
                                   L+  L ++I   P W+ + + S+  P +  KL + + 
Sbjct  650  GTGSTNSTTASLCDESSGSSDECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTP  709

Query  486  --------------LLDF------SP-KNANYMNDTI------------ILINDIIGNFS  512
                          + +F      SP   +++++ T+            I    +  N  
Sbjct  710  SIALDRHERENEADIREFVEMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTP  769

Query  513  DKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEI  572
             K  +E  +++ ++S G F +     QA+       E G + +D L  LP  +     + 
Sbjct  770  RKISAEQVEVITKRSEGLFLYAANIVQAI-------EEGRLAVDQLETLPVGLGGYLRQF  822

Query  573  FEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDI  632
            FE  F     +   K++P+L+++  A    Y  +T       F  S  + + +  +F+ +
Sbjct  823  FESHFDDATYK--TKIRPVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSAL  876

Query  633  IDVRHGTY-RMETSAMYEWLVDPQRSG  658
            + V    Y R   S++ EW+ D + +G
Sbjct  877  LFVSDDDYVRPFHSSVLEWVQDFKTAG  903

>PYU1_G002110
Length=999

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 100/434 (23%), Positives = 181/434 (42%), Gaps = 76/434 (18%)

Query  282  QHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGS  341
            Q ++  +   V F   +   A +F    R+W   +   W+DS        +  + G  GS
Sbjct  406  QARLHSILAPVPFQQQISKLASRF--VGRKWLIAQLTKWIDSP---TASQMFWVTGQIGS  460

Query  342  GKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNL  401
            GK+ L   L     + I A H    + +   + R  +LSL  QL   L   K+  A L  
Sbjct  461  GKTALAARLVQTIPE-IKAFHFAFEEDEQTQNARRCVLSLAYQLTTQL---KDYAAFLQA  516

Query  402  KYVLEETDPLV----LARKVLVDPL---CALEEPLTAKVLLVDGIDQCKSKDRND-----  449
            +  LEE  P+     L   +L+ PL     L+   T  VLL+DG++   S  ++D     
Sbjct  517  REPLEELVPVSTFNELVTHLLIKPLNEIAQLQSQNTPLVLLIDGLENL-SDGKSDVSSLP  575

Query  450  -----------LLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANYMN  498
                       L+  L +++ + P W+ + + S+  P + AKL      +F+P   N + 
Sbjct  576  VMTSRQSFAQCLVSALPSLVSQLPKWVRVIVLSRNDPAINAKLQ-----NFTP---NIVL  627

Query  499  DTIILIN-DIIGNFSDKDVSEAR---------------DILKRKSGGNFTFLDFTKQALS  542
            +  +  N + I  F +K +  +                D++  +S G F +     Q+L 
Sbjct  628  EAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQIDLIVERSEGLFLYAANVVQSL-  686

Query  543  HPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFG-KGHNRLWKKVQPLLDLIVTAASG  601
                 EE  +    V   LP  +     + F   FG K + RL   ++P+L+ ++ AA  
Sbjct  687  -----EEKWFA---VGQSLPIGMNGYLYDFFVSHFGAKQYKRL---IRPVLE-VLCAAFE  734

Query  602  PYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDV-RHGTYRMETSAMYEWLVDPQRSGEQ  660
            P +L T         L  ++ + I  AF  ++ +   G+ R   S++  W+ + Q S + 
Sbjct  735  PLSLPT---IASILKLQTNEQQEIATAFGSLLSIGADGSVRPFHSSVLNWVQELQ-SVDP  790

Query  661  FYVNISASMDILRR  674
            FYV+++   +++ +
Sbjct  791  FYVDVATGHELIGK  804

>PYVX_21513
Length=1446

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 96/226 (42%), Gaps = 31/226 (14%)

Query  274  DALSTPL---LQH--QIDDMFPLVD-FSADLQLHAQKFDPTSREWAFERFQDWVDSRFNV  327
            D L+T L   L H  Q   +F L+  FS   Q+    +  T R+W F+R Q W++   + 
Sbjct  396  DQLATALRGQLDHEGQQARLFSLLSPFSFQQQISKLTYRFTGRDWLFKRVQQWINDSSSG  455

Query  328  GGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIA  387
                +  + G  GSGK+++   +   F + I A H    +       R  +LSL  QL  
Sbjct  456  TDHRVFWITGQIGSGKTSVAARMVQTFPE-IAAFHFALQEDDQTHIARRCVLSLAYQLTT  514

Query  388  NLPLFKNQLARLNLKYVLEETDPL----VLARKVLVDPLCALEEPLTAKVLLVDGIDQCK  443
             LP +      L  +  LEE  P+     L   +LV+PL  ++ P    +LL+DG++   
Sbjct  515  QLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILLIDGLECIV  571

Query  444  SKDR-----------------NDLLDFLAAIIPEFPTWLGIFITSK  472
            S                      L+  L +++   P+W+ + + S+
Sbjct  572  SGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSR  617

>PYIW_15717
Length=1121

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 91/433 (21%), Positives = 168/433 (39%), Gaps = 99/433 (23%)

Query  310  REWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRK  369
            REW F + + W+ S        +  + G  GSGK+ L   +     + I A H    + +
Sbjct  525  REWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMVQLIPE-IAAFHFALQEDE  580

Query  370  SKSSPRNVLLSLVNQLIANLPLFKNQL-ARLNLKYVLEETDPLVLARKVLVDPLCALEEP  428
               + R  +LSL  QL   LP + + L +R  L+ ++  ++   L  ++LV+PL  +  P
Sbjct  581  QTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARP  640

Query  429  LTAK---VLLVDGIDQCKSKDRND---------------------------------LLD  452
             TA    VLL+DG++   S D+N                                  L+ 
Sbjct  641  QTATKPLVLLIDGLEHLVS-DKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLVS  699

Query  453  FLAAIIPEFPTWLGIFITSKPSPELPAKLA------------------ITSLLD------  488
             L +++   P W+ + + S+  P + AKL                   I S ++      
Sbjct  700  ALPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFERENQQDIKSYVEKILGEP  759

Query  489  ------------------FSPKNANYMNDTIILINDIIGNFSDKDVS-EARDILKRKSGG  529
                                P+N +    T+   N I        +S E  +++ ++S G
Sbjct  760  SPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVKRSEG  819

Query  530  NFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQ  589
             F +     Q++       E   +P+  L  LP  +   + + F+  F +   +    ++
Sbjct  820  LFLYAVNIVQSI-------EERRLPVSQLESLPIGMGGYFRQFFDSHFDEQQYK--DSIR  870

Query  590  PLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDV-RHGTYRMETSAMY  648
            P+L+ ++ A+  P++L T        S S  D + I  +F  ++ V   G  R   S++ 
Sbjct  871  PVLE-VLCASFEPFSLAT---IASILSWSVYDQQEIAASFGSLLFVGADGNIRPFHSSVL  926

Query  649  EWLVDPQRSGEQF  661
            +W+ D   +GE F
Sbjct  927  DWVQDLATAGEYF  939

>PYAR_14788
Length=795

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 77/374 (21%), Positives = 143/374 (38%), Gaps = 72/374 (19%)

Query  335  LVGDGGSGKSTLVGALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKN  394
            + G  G+GK+++   +       I A H    +       R  +LSL  QL   LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTI-PEIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  395  QLARLNLKYVLEETDPL----VLARKVLVDPLCALEEPLTAK--VLLVDGIDQCKSK--D  446
                L     LEE  P+     L   +L+ PL A+  P + K  +LL+DG++   S    
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  447  RNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNA------------  494
                +  L ++I   P+W+ + + S+    +  KL      D+SP  +            
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQ-----DYSPSVSLDRREQENEEDI  591

Query  495  -NYMNDTIILIN-----------------DIIGNFSD-----------KDVSEARDILKR  525
              ++   +   +                  I  +F++           K  SE  +++ +
Sbjct  592  RGFVEAALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITK  651

Query  526  KSGGNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLW  585
            +S G F +     Q++       E G + +D L  LP  +     + FE  F     +  
Sbjct  652  RSEGLFLYAVNIVQSI-------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYK--  702

Query  586  KKVQPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTY-RMET  644
             K++P+L+++  A    Y  +T       F  S  D   +  +F+ +  +    Y R   
Sbjct  703  TKIRPVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFH  758

Query  645  SAMYEWLVDPQRSG  658
            S++ EW+ D + +G
Sbjct  759  SSVLEWVQDIKTAG  772

>SPRG_09182
Length=1092

 Score = 38.5 bits (88),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (48%), Gaps = 5/80 (6%)

Query  279  PLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGD  338
            P +    +D   L D   +L+LH   F   SR  A      + D    V     LALVG 
Sbjct  830  PTINCAANDGLVLGDVKGELELHHVAFAYPSRPDAII----YKDYSLTVRAGQTLALVGG  885

Query  339  GGSGKSTLVGALCDRFHDNI  358
             GSGKST + +L +RF+D +
Sbjct  886  SGSGKSTAI-SLLERFYDPV  904

>SPRG_09179
Length=1262

 Score = 38.5 bits (88),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (48%), Gaps = 5/80 (6%)

Query  279   PLLQHQIDDMFPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGD  338
             P +    +D   L D   +L+LH   F   SR  A      + D    V     LALVG 
Sbjct  1000  PTINCAANDGLVLGDVKGELELHHVAFAYPSRPDAII----YKDYSLTVRAGQTLALVGG  1055

Query  339   GGSGKSTLVGALCDRFHDNI  358
              GSGKST + +L +RF+D +
Sbjct  1056  SGSGKSTAI-SLLERFYDPV  1074

>H257_02565
Length=1005

 Score = 38.1 bits (87),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query  304  KFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFH--DNIVAL  361
            ++DPTS  W     QD V++ F +G  + + +VG  G GKSTL+G L   +   D ++A+
Sbjct  682  QYDPTSDVW---NLQD-VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGVIAV  735

Query  362  HLCKFDRKSKSS  373
                    SKSS
Sbjct  736  DDHNLHAYSKSS  747

>H310_08568
Length=554

 Score = 37.4 bits (85),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (43%), Gaps = 1/70 (1%)

Query  491  PKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFLDFTKQALSHPGMEEEN  550
            P N N  + T +L+   +G+     V  A D+    SG  F +       L + G E   
Sbjct  452  PVNKNLWSITFVLVAAGLGSVVFGGVYLAVDVFHMWSGAPFLYAGM-NPILLYCGHEVLQ  510

Query  551  GYVPLDVLHD  560
            GY P D+ HD
Sbjct  511  GYFPFDIAHD  520

>PYAR_22431
Length=1349

 Score = 36.2 bits (82),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 38/80 (48%), Gaps = 7/80 (9%)

Query  278  TPLLQHQIDDMFPLVDFSADLQLHAQKFDPTSR-EWAFERFQDWVDSRFNVGGDNLLALV  336
            TPL+     D  PL D   +L   +  F   SR +    R     D    V     +ALV
Sbjct  751  TPLIDPTTSDGTPLDDVQGELAFKSVAFAYPSRPDQPVYR-----DYHLRVQAGQTVALV  805

Query  337  GDGGSGKSTLVGALCDRFHD  356
            G  GSGKST+V +L +RF+D
Sbjct  806  GPSGSGKSTVV-SLLERFYD  824

>SPRG_21334
Length=181

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 23/39 (59%), Gaps = 1/39 (3%)

Query  318  QDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
            + + D    +     LALVG  GSGKST +G L +RF+D
Sbjct  14   RSYKDYSLTIHAGQTLALVGGSGSGKSTAIG-LLERFYD  51

>PHYSO_338544
Length=1109

 Score = 34.7 bits (78),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 1/32 (3%)

Query  325  FNVGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
              +G    +ALVG  GSGKST+V AL +RF+D
Sbjct  338  LTIGAGETVALVGPSGSGKSTIV-ALLERFYD  368

>PYAP_24112
Length=1316

 Score = 34.7 bits (78),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 8/80 (10%)

Query  284   QIDDMFPLVDFSA--DLQLHAQKFDPTSR--EWAFERFQD---WVDSRFNVGGDNLLALV  336
             QI D  PL+D +A    +L+A K D   R  E+A+    D   +      +     +ALV
Sbjct  1046  QIIDRVPLIDPTALDGDELNAVKGDLEFRSVEFAYPSRPDQLIYHGYNLKIASGQTIALV  1105

Query  337   GDGGSGKSTLVGALCDRFHD  356
             G  GSGKST + AL +RF+D
Sbjct  1106  GASGSGKSTTI-ALLERFYD  1124

 Score = 33.9 bits (76),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 10/80 (13%)

Query  286  DDMFPLVDFSADLQLHAQKFDPTSR-EWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKS  344
            DD   L   + D+ + +  F   SR E    R     D   ++     +ALVG  GSGKS
Sbjct  408  DDGIILPQIAGDIAIKSVTFAYPSRPEVNVCR-----DYSLSIAAGETVALVGPSGSGKS  462

Query  345  TLVGALCDRFHD---NIVAL  361
            T+V +L +RF+D    IVAL
Sbjct  463  TIV-SLLERFYDPQSGIVAL  481

>SDRG_17291
Length=227

 Score = 33.5 bits (75),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 22/37 (59%), Gaps = 1/37 (3%)

Query  320  WVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
            + D    +     LALVG  GSGKST +G L +RF+D
Sbjct  2    YKDYSLTIHAGQTLALVGGSGSGKSTAIG-LLERFYD  37

>PHYCA_532676
Length=1662

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (51%), Gaps = 6/77 (8%)

Query  332  LLALVGDGGSGKSTLVGALCDRF--HDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANL  389
            L  ++G  GSGKS+L+  L  RF    N+       ++  S+   R+ L     QL++ +
Sbjct  324  LTLVLGQPGSGKSSLMKILSGRFPASKNVTVEGEVTYNGTSQEELRSKL----PQLVSYV  379

Query  390  PLFKNQLARLNLKYVLE  406
            P     LARL++K  LE
Sbjct  380  PQHDKHLARLSVKETLE  396

>PYVX_20285
Length=62

 Score = 30.8 bits (68),  Expect = 4.0, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 15/17 (88%), Gaps = 0/17 (0%)

Query  335  LVGDGGSGKSTLVGALC  351
            +VGD G GK+TL+GALC
Sbjct  10   VVGDSGVGKTTLLGALC  26

>PPTG_03602
Length=382

 Score = 33.5 bits (75),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  562  PESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYA  604
            P  I  +++ IF   FG+   R  K +  LL+ IV+ AS P+A
Sbjct  112  PSDIDRVHNSIFNRLFGQNGQRATKTISKLLEGIVSRASMPHA  154

>H257_10608
Length=1292

 Score = 33.9 bits (76),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 1/24 (4%)

Query  333  LALVGDGGSGKSTLVGALCDRFHD  356
            LALVG  GSGKST+VG L +RF+D
Sbjct  429  LALVGASGSGKSTIVG-LLERFYD  451

>PYIR_19174
Length=557

 Score = 33.9 bits (76),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  562  PESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDLIVTAASGPYALITEEQAQEQFSL  617
            PE+   +    FED FGK H R+W+ ++ LL   + A +GP  +   + A   FSL
Sbjct  106  PEAFGHVLKTKFED-FGKEH-RMWQIMEDLLGNGIFAVNGPLWMHQRKTASHLFSL  159

>H257_02562
Length=989

 Score = 33.9 bits (76),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 23/72 (32%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query  304  KFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFH--DNIVAL  361
            ++D T   W  E     V++ F +G  + + +VG  G GKSTL+G L   +   D ++A+
Sbjct  686  QYDSTVDHWDLED----VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGVIAV  739

Query  362  HLCKFDRKSKSS  373
                    SKSS
Sbjct  740  DDHNLHAYSKSS  751

>PHYSO_545378
Length=224

 Score = 33.1 bits (74),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 45/83 (54%), Gaps = 3/83 (4%)

Query  305  FDPTSREWAFERFQDWV-DSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL  363
            FD  S E +FE+ ++W+ D + +VG D +LA+VG+     ST   +   +F D I AL +
Sbjct  92   FDLQS-EASFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVPSTFDFSKAQQFADEIGAL-V  149

Query  364  CKFDRKSKSSPRNVLLSLVNQLI  386
             +   KS    + +  SL  QL+
Sbjct  150  FRTSAKSGEGVQALFESLAVQLL  172

>PYU1_G001169
Length=1200

 Score = 33.5 bits (75),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 38/84 (45%), Gaps = 16/84 (19%)

Query  284   QIDDMFPLVDFSA-----------DLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNL  332
             Q+ D  P +D SA           +++ H   F   SR  A    Q +      V     
Sbjct  930   QVIDRVPAIDSSAPTGDIPTILTGEIEFHDVAFTYPSRPDA----QIYRSYSLKVASGQT  985

Query  333   LALVGDGGSGKSTLVGALCDRFHD  356
             +ALVG  GSGKST + AL +RF+D
Sbjct  986   VALVGASGSGKSTAI-ALLERFYD  1008

>PYU1_G008219
Length=1289

 Score = 33.5 bits (75),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 48/120 (40%), Gaps = 22/120 (18%)

Query  252  TAIPTIIRGTNSRLTQLAP---VADDALSTPLLQHQIDDMFPLVDFSADLQLHAQKFDPT  308
            TA   I+ GT + L Q++P       A    L    I D+ P +D S D         P 
Sbjct  349  TAFFAILTGTGT-LAQISPNISAVSAATGAALQLFAILDIEPEIDASKD-----DGIIPE  402

Query  309  SREWAFERF------------QDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
            S E A E              Q   +    +     +A VG  G GKSTL+ +L +RF+D
Sbjct  403  SCEGAIEAIDINFTYPGRPDAQILKNYSVKIAAGETVAFVGSSGGGKSTLI-SLLERFYD  461

>PYVX_21776
Length=203

 Score = 32.3 bits (72),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 3/83 (4%)

Query  305  FDPTSREWAFERFQDWV-DSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL  363
            FD TS    FE+ ++W+ D + +VG D +LA+VG+     S+   A   +F D I AL +
Sbjct  96   FDLTSAA-TFEKIKEWLRDLQSHVGEDIVLAVVGNKSDCASSFDFAQAQQFADQIGAL-V  153

Query  364  CKFDRKSKSSPRNVLLSLVNQLI  386
             +   KS    + +  +L  +L+
Sbjct  154  FRTSAKSGDGVQTLFEALAAELL  176

>PYVX_24134
Length=709

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 1/24 (4%)

Query  333  LALVGDGGSGKSTLVGALCDRFHD  356
            +ALVG  GSGKST+VG L +RF+D
Sbjct  373  IALVGPSGSGKSTIVG-LVERFYD  395

>SDRG_09904
Length=1282

 Score = 33.1 bits (74),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 1/37 (3%)

Query  320   WVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
             +VD    +     +ALVG  GSGKST +G L +RF+D
Sbjct  1055  YVDYNLVIEAGTTVALVGASGSGKSTAIG-LIERFYD  1090

>H310_02210
Length=999

 Score = 33.1 bits (74),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query  304  KFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFH--DNIVAL  361
            ++D T   W     QD V++ F +G  + + +VG  G GKSTL+G L   +   D ++A+
Sbjct  683  QYDATVDHW---DLQD-VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGVIAV  736

Query  362  HLCKFDRKSKSS  373
                    SKSS
Sbjct  737  DNHNLQGYSKSS  748

>PYAP_21608
Length=1298

 Score = 33.1 bits (74),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (66%), Gaps = 3/38 (8%)

Query  321   VDSRFN--VGGDNLLALVGDGGSGKSTLVGALCDRFHD  356
             V  R+N  +G    +ALVG  GSGKST + +L +RF+D
Sbjct  1071  VYKRYNLKIGSGQTVALVGASGSGKSTAI-SLLERFYD  1107

>PYAP_14982
Length=1444

 Score = 33.1 bits (74),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 88/212 (42%), Gaps = 25/212 (12%)

Query  331  NLLALVGDGGSGKSTLVG--ALCDRFHDNIVALHL-------CKFDRKSKSSPRNVLLSL  381
            +LL +VG  G+GKS+L+   A   R  D+  A+         C +D    S     L  L
Sbjct  98   SLLVVVGPPGTGKSSLLAHFAAHRRSSDHDSAIDFVYEHYGGCSYDSVKLSL---FLFRL  154

Query  382  VNQLIANLPLFKNQLARLN----LKYVLEET-DPLVLARKVLVDPLCALEEPLTAKVLLV  436
            +NQL     L   +L   +    LK+      +  V  RK  V    +  + L   +L++
Sbjct  155  MNQLKTTFGLRDFELPHEHEEEKLKFSFARCLEAAVSRRKKSVGASGSTHKRLNI-ILIL  213

Query  437  DGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPSPELPAKLAITSLLDFSPKNANY  496
            DGID  +++D  D L +L      FP  + + +++  S    A +     +   P   +Y
Sbjct  214  DGIDCIRTEDGGDSLSWLPNT---FPVGVRVIVSATHSLSY-ASVQNARAVKRKPAAYDY  269

Query  497  MNDTIILINDIIGNFSDKDVSEARDILKRKSG  528
              D   LI D     SD D    R++ +R + 
Sbjct  270  DGD---LIYDTTLPPSDSDSHTIRELRRRHAA  298

>PITG_15525
Length=224

 Score = 32.3 bits (72),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 3/83 (4%)

Query  305  FDPTSREWAFERFQDWV-DSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVALHL  363
            FD  S E +FE+ ++W+ D + +VG D +LA+VG+     S    A   +F D I AL +
Sbjct  92   FDLQS-EASFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNFDFAKAQQFADEIGAL-V  149

Query  364  CKFDRKSKSSPRNVLLSLVNQLI  386
             +   K+    +++  SL  QL+
Sbjct  150  FRTSAKTGEGVQSLFESLAVQLL  172

>SPRG_02378
Length=1351

 Score = 33.1 bits (74),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (43%), Gaps = 14/89 (16%)

Query  281   LQHQIDDMFPLVDFSAD---LQLHAQKFDPTSREWAFERFQ----------DWVDSRFNV  327
             + H   ++F L+D       +    +  D  +   AFE  Q           + D    +
Sbjct  1072  VAHAASNVFSLIDRVPKIDAMSTTGRTLDRVAGTIAFESVQFAYPARPDSRVYTDYNLVI  1131

Query  328   GGDNLLALVGDGGSGKSTLVGALCDRFHD  356
                  +ALVG  GSGKST +G L +RF+D
Sbjct  1132  EAGTTVALVGASGSGKSTAIG-LIERFYD  1159

>PYIW_27925
Length=116

 Score = 31.2 bits (69),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 20/24 (83%), Gaps = 1/24 (4%)

Query  333  LALVGDGGSGKSTLVGALCDRFHD  356
            +ALVG  GSGKST+V +L +RF+D
Sbjct  16   VALVGPSGSGKSTIV-SLLERFYD  38

>H310_12516
Length=316

 Score = 32.3 bits (72),  Expect = 10.0, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 44/87 (51%), Gaps = 4/87 (5%)

Query  321  VDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRFHDNIVA-LHLCKFDRKSKSSPRNVLL  379
            VD+   +       LVG  G+GKSTL+ AL D   + I + +H+    +       N  L
Sbjct  57   VDAELKLEAGAHYGLVGRNGTGKSTLLQALGDGLFEGISSHIHVMYVHQLFHVDLENPEL  116

Query  380  SLVNQLIANLPLFKNQLARLNLKYVLE  406
            S+VN L++     K +++R ++  +LE
Sbjct  117  SVVNVLLSG---DKQRVSRQHMIELLE  140

Lambda      K        H        a         alpha
   0.318    0.134    0.383    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58624969662

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40