Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_199721475360960931780.0
PYIR_134521475364563927790.0
PYAP_177619907562262523950.0
PHYKE_83911475377864522530.0
PHYCA_5561601475364964522090.0
PITG_184521475385663921990.0
PYAR_135699907549449321490.0
HYAP_070951475361361321220.0
PHYSO_3489011475352649920780.0
PHYRA_508551475348948920610.0
PHALS_064811475364461419940.0
H310_085901475364063219940.0
H257_084361475364260819800.0
PYVX_181701475351046619350.0
SPRG_141031475362863419220.0
SDRG_167201475362863419070.0
SPRG_0407412408750949911098e-145
SDRG_1440812408752850011101e-144
SDRG_038221356704944746622e-78
SDRG_150451241574944736492e-76
SDRG_111311368074944736447e-76
PYIR_17506109045094836459e-76
SDRG_03823114284974766441e-75
PYAP_21882109045024846431e-75
SDRG_12187109044624776322e-74
PYAR_17512109045335176302e-73
SPRG_11769109044534706242e-73
CCI11048114284964666178e-72
PYIW_25301109045124946161e-71
PHYSO_254571109044894956132e-71
SPRG_05609114284964806124e-71
PYAP_234351008029515096356e-71
PHALS_08068109044975026108e-71
H257_09722114285184836083e-70
CCA23647114284964666063e-70
PHYRA_72037114284934825983e-69
PHYCA_504517114284934815984e-69
PPTG_09787114284934825976e-69
H310_144471462305014805942e-68
PHYSO_550665114284914815914e-68
PHYKE_103271090612005116196e-68
PITG_14083114284934825862e-67
H257_170371462304984625821e-66
PHYRA_71927109044854935765e-66
PPTG_18033109045004875767e-66
HYAP_08763114284734665712e-65
PHALS_09136114284934775705e-65
PHYKE_6836114284934795549e-63
H310_11259114285194815542e-62
PITG_13427109044634855422e-61
PYVX_21517109044824975424e-61
PHYCA_7619109044624745265e-59
PYIR_23431114284684574907e-54
HYAP_04843109044304044852e-53
PYAR_177141008024444744773e-52
PYVX_16175114284464584328e-46
PYIR_20273124015054804182e-43
CCA22989124014944764172e-43
CCI10477124014944754146e-43
PYAP_226451707615654834268e-43
HYAP_12621124015014813698e-37
PHYSO_556052124015004323531e-34
SPRG_199431356703432383396e-34
PYVX_21248124015024333442e-33
PHYKE_9680124014984303353e-32
PITG_15359124014964793344e-32
PHALS_09942124014964383301e-31
PYU1_G014259109042442173132e-31
PYAR_20075170764694723263e-31
PHYCA_123621124014954773264e-31
SPRG_09825124014924843211e-30
SDRG_06945124014924843184e-30
PHYRA_72215124014994323167e-30
H257_16541124014944443113e-29
H310_02523124014944423104e-29
H310_00561151564974863104e-29
H257_01186151564964833096e-29
PYU1_G00173714753133992831e-28
CCA16670151565204823018e-28
CCI50816151568074813032e-27
PHYRA_47253151564814932937e-27
PYVX_20512151565284922947e-27
PYAR_16840151565365042948e-27
PYU1_G011605151565244892931e-26
PPTG_0093815665505062931e-26
PHYRA_7388315665515052921e-26
PITG_18935150674804782873e-26
PYIW_19795151565194852884e-26
PYIW_251901648732061852697e-26
SDRG_0506015665595162822e-25
SPRG_1205415665585162823e-25
PHALS_1202815665795052823e-25
PPTG_09121151565205292795e-25
PHYCA_50444515665485052796e-25
PYIR_1413215665135052706e-24
SDRG_14446151564954762706e-24
PHALS_10055151565164922662e-23
PHYKE_980715665575092672e-23
PYIW_2025715665034912652e-23
PYAP_19280151565124882662e-23
PYU1_G00569915665505092663e-23
PHYCA_555180151565214972601e-22
CCI3999315665505402531e-21
H310_0764115665485102521e-21
PYIR_21896151565184942467e-21
PYIW_24688114282592662351e-20
PPTG_13000124013873862411e-20
PHYKE_2864151564864912431e-20
HYAP_0414915665645172441e-20
PYAP_1914815665355202432e-20
CCA1403015665605352432e-20
PYVX_2349915665195092413e-20
PHYSO_48941815664714632394e-20
H257_0745015665673752371e-19
PITG_0177815664704632297e-19
PYAR_1666415665774092211e-17
HYAP_08069650262552142102e-17
PHYSO_562795151564153321975e-15
PITG_19065151564164041922e-14
SPRG_04114151563763331682e-11
HYAP_13613151564232161512e-09
PPTG_247122910367671257e-08
PITG_19802156311851561222e-06
SPRG_0423112415790521073e-05
PYIW_2756812401128119950.003
SPRG_186431333348530890.008
SDRG_05159241655178900.066
CCI40989241655279870.16
PYAP_15943241513930810.20
HYAP_080686502510057790.24
PITG_02760241516530820.26
SPRG_08354241655078840.34
PYU1_G004385241656230830.51
PYVX_18330241655830820.58
PHYKE_5677241621130800.62
H310_07705241654664820.73
H310_0629614909759053810.81
PPTG_05518241655430801.1
SPRG_04526124345334102781.4
SPRG_17626132408148119751.5
PHYRA_48183241653229782.0
PYIW_147818177733946772.1
PYIR_136108177733946772.2
PYU1_G0099888177728446762.4
PPTG_162941508840634763.1
SDRG_1190612434533460753.4
SDRG_0650112817662348763.5
PHYSO_261176241654130753.9
SPRG_1164112817662348763.9
H257_04036125006104962745.9
SPRG_0871712651838759736.0
SDRG_07672200336168736.3
PHYCA_565409241655130746.5
PYAR_139088177763446746.5
H257_1057612382688273746.5
PYAP_164508177733856737.2
SDRG_0815913634153785729.4
SDRG_0824612301281763729.6
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_19972

Length=609
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_19972                                                            1228       0.0   
PYIR_13452                                                            1075       0.0   
PYAP_17761                                                            927        0.0   
PHYKE_8391                                                            872        0.0   
PHYCA_556160                                                          855        0.0   
PITG_18452                                                            851        0.0   
PYAR_13569                                                            832        0.0   
HYAP_07095                                                            822        0.0   
PHYSO_348901                                                          805        0.0   
PHYRA_50855                                                           798        0.0   
PHALS_06481                                                           772        0.0   
H310_08590                                                            772        0.0   
H257_08436                                                            767        0.0   
PYVX_18170                                                            749        0.0   
SPRG_14103                                                            744        0.0   
SDRG_16720                                                            739        0.0   
SPRG_04074                                                            431        8e-145
SDRG_14408                                                            432        1e-144
SDRG_03822                                                            259        2e-78 
SDRG_15045                                                            254        2e-76 
SDRG_11131                                                            252        7e-76 
PYIR_17506                                                            253        9e-76 
SDRG_03823                                                            252        1e-75 
PYAP_21882                                                            252        1e-75 
SDRG_12187                                                            248        2e-74 
PYAR_17512                                                            247        2e-73 
SPRG_11769                                                            244        2e-73 
CCI11048                                                              242        8e-72 
PYIW_25301                                                            241        1e-71 
PHYSO_254571                                                          240        2e-71 
SPRG_05609                                                            240        4e-71 
PYAP_23435                                                            249        6e-71 
PHALS_08068                                                           239        8e-71 
H257_09722                                                            238        3e-70 
CCA23647                                                              238        3e-70 
PHYRA_72037                                                           234        3e-69 
PHYCA_504517                                                          234        4e-69 
PPTG_09787                                                            234        6e-69 
H310_14447                                                            233        2e-68 
PHYSO_550665                                                          232        4e-68 
PHYKE_10327                                                           243        6e-68 
PITG_14083                                                            230        2e-67 
H257_17037                                                            228        1e-66 
PHYRA_71927                                                           226        5e-66 
PPTG_18033                                                            226        7e-66 
HYAP_08763                                                            224        2e-65 
PHALS_09136                                                           224        5e-65 
PHYKE_6836                                                            218        9e-63 
H310_11259                                                            218        2e-62 
PITG_13427                                                            213        2e-61 
PYVX_21517                                                            213        4e-61 
PHYCA_7619                                                            207        5e-59 
PYIR_23431                                                            193        7e-54 
HYAP_04843                                                            191        2e-53 
PYAR_17714                                                            188        3e-52 
PYVX_16175                                                            171        8e-46 
PYIR_20273                                                            165        2e-43 
CCA22989                                                              165        2e-43 
CCI10477                                                              164        6e-43 
PYAP_22645                                                            168        8e-43 
HYAP_12621                                                            146        8e-37 
PHYSO_556052                                                          140        1e-34 
SPRG_19943                                                            135        6e-34 
PYVX_21248                                                            137        2e-33 
PHYKE_9680                                                            133        3e-32 
PITG_15359                                                            133        4e-32 
PHALS_09942                                                           131        1e-31 
PYU1_G014259                                                          125        2e-31 
PYAR_20075                                                            130        3e-31 
PHYCA_123621                                                          130        4e-31 
SPRG_09825                                                            128        1e-30 
SDRG_06945                                                            127        4e-30 
PHYRA_72215                                                           126        7e-30 
H257_16541                                                            124        3e-29 
H310_02523                                                            124        4e-29 
H310_00561                                                            124        4e-29 
H257_01186                                                            123        6e-29 
PYU1_G001737                                                          113        1e-28 
CCA16670                                                              120        8e-28 
CCI50816                                                              121        2e-27 
PHYRA_47253                                                           117        7e-27 
PYVX_20512                                                            117        7e-27 
PYAR_16840                                                            117        8e-27 
PYU1_G011605                                                          117        1e-26 
PPTG_00938                                                            117        1e-26 
PHYRA_73883                                                           117        1e-26 
PITG_18935                                                            115        3e-26 
PYIW_19795                                                            115        4e-26 
PYIW_25190                                                            108        7e-26 
SDRG_05060                                                            113        2e-25 
SPRG_12054                                                            113        3e-25 
PHALS_12028                                                           113        3e-25 
PPTG_09121                                                            112        5e-25 
PHYCA_504445                                                          112        6e-25 
PYIR_14132                                                            108        6e-24 
SDRG_14446                                                            108        6e-24 
PHALS_10055                                                           107        2e-23 
PHYKE_9807                                                            107        2e-23 
PYIW_20257                                                            106        2e-23 
PYAP_19280                                                            107        2e-23 
PYU1_G005699                                                          107        3e-23 
PHYCA_555180                                                          104        1e-22 
CCI39993                                                              102        1e-21 
H310_07641                                                            101        1e-21 
PYIR_21896                                                            99.4       7e-21 
PYIW_24688                                                            95.1       1e-20 
PPTG_13000                                                            97.4       1e-20 
PHYKE_2864                                                            98.2       1e-20 
HYAP_04149                                                            98.6       1e-20 
PYAP_19148                                                            98.2       2e-20 
CCA14030                                                              98.2       2e-20 
PYVX_23499                                                            97.4       3e-20 
PHYSO_489418                                                          96.7       4e-20 
H257_07450                                                            95.9       1e-19 
PITG_01778                                                            92.8       7e-19 
PYAR_16664                                                            89.7       1e-17 
HYAP_08069                                                            85.5       2e-17 
PHYSO_562795                                                          80.5       5e-15 
PITG_19065                                                            78.6       2e-14 
SPRG_04114                                                            69.3       2e-11 
HYAP_13613                                                            62.8       2e-09 
PPTG_24712                                                            52.8       7e-08 
PITG_19802                                                            51.6       2e-06 
SPRG_04231                                                            45.8       3e-05 
PYIW_27568                                                            41.2       0.003 
SPRG_18643                                                            38.9       0.008 
SDRG_05159                                                            39.3       0.066 
CCI40989                                                              38.1       0.16  
PYAP_15943                                                            35.8       0.20  
HYAP_08068                                                            35.0       0.24  
PITG_02760                                                            36.2       0.26  
SPRG_08354                                                            37.0       0.34  
PYU1_G004385                                                          36.6       0.51  
PYVX_18330                                                            36.2       0.58  
PHYKE_5677                                                            35.4       0.62  
H310_07705                                                            36.2       0.73  
H310_06296                                                            35.8       0.81  
PPTG_05518                                                            35.4       1.1   
SPRG_04526                                                            34.7       1.4   
SPRG_17626                                                            33.5       1.5   
PHYRA_48183                                                           34.7       2.0   
PYIW_14781                                                            34.3       2.1   
PYIR_13610                                                            34.3       2.2   
PYU1_G009988                                                          33.9       2.4   
PPTG_16294                                                            33.9       3.1   
SDRG_11906                                                            33.5       3.4   
SDRG_06501                                                            33.9       3.5   
PHYSO_261176                                                          33.5       3.9   
SPRG_11641                                                            33.9       3.9   
H257_04036                                                            33.1       5.9   
SPRG_08717                                                            32.7       6.0   
SDRG_07672                                                            32.7       6.3   
PHYCA_565409                                                          33.1       6.5   
PYAR_13908                                                            33.1       6.5   
H257_10576                                                            33.1       6.5   
PYAP_16450                                                            32.7       7.2   
SDRG_08159                                                            32.3       9.4   
SDRG_08246                                                            32.3       9.6   

>PYIW_19972
Length=609

 Score = 1228 bits (3178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/609 (100%), Positives = 609/609 (100%), Gaps = 0/609 (0%)

Query  1    MAELQASGTKREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPD  60
            MAELQASGTKREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPD
Sbjct  1    MAELQASGTKREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPD  60

Query  61   AVDCEIHEFPDREAFRAWLsasaadfaanfgadsKAATHTSSPFFGKDESPTPTMVAAPV  120
            AVDCEIHEFPDREAFRAWLSASAADFAANFGADSKAATHTSSPFFGKDESPTPTMVAAPV
Sbjct  61   AVDCEIHEFPDREAFRAWLSASAADFAANFGADSKAATHTSSPFFGKDESPTPTMVAAPV  120

Query  121  VDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGC  180
            VDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGC
Sbjct  121  VDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGC  180

Query  181  IPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKK  240
            IPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKK
Sbjct  181  IPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKK  240

Query  241  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300
            VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW
Sbjct  241  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESK  360
            RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESK
Sbjct  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESK  360

Query  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420
            IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ
Sbjct  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420

Query  421  LNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKV  480
            LNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKV
Sbjct  421  LNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKV  480

Query  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540
            CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD
Sbjct  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540

Query  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSS  600
            TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSS
Sbjct  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSS  600

Query  601  GESAAAGGC  609
            GESAAAGGC
Sbjct  601  GESAAAGGC  609

>PYIR_13452
Length=645

 Score = 1075 bits (2779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/639 (85%), Positives = 565/639 (88%), Gaps = 31/639 (5%)

Query  2    AELQASGTKREAT----MATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVL  57
            A+LQASG KREA     M   NIKETLV  GGP  YH+AGWRGCGFYKKASDV+ AMRVL
Sbjct  7    AQLQASGRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVL  66

Query  58   YPDAVDCEIHEFPDREAFRAWLsasaadfaanf--gadsKAATHTSSPFF---------G  106
            YPD VD E+HEFPDREAFR WL+AS+         GADSKA TH SSPF          G
Sbjct  67   YPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANTRGFIGG  126

Query  107  KDES---------------PTPTMVAAPVVDDNVT-YDYDLIVIGGGSGGLACSKEAAKY  150
             D++                TPTMVAA     +   YDYDLIVIGGGSGGLACSKEA+KY
Sbjct  127  CDDTLALFRSGVSAPATLAATPTMVAAAPAPADDAKYDYDLIVIGGGSGGLACSKEASKY  186

Query  151  GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQ  210
            GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGETIHKDA AFGW+VGEQ
Sbjct  187  GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQ  246

Query  211  KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT  270
             FDW+QMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT
Sbjct  247  TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT  306

Query  271  RDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYD  330
            RDVVIAVGGRPKPLSCEGG+LAISSDDIFWRKEAPGKTLV+GASYVALECAGFMKGMGYD
Sbjct  307  RDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYD  366

Query  331  VKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGD  390
            VKIMVRSILLRGFDQDMA+KIGEFME ESKIEFIRGAVPQSITKLESGQLLVKWVS+DG+
Sbjct  367  VKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGE  426

Query  391  ICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAP  450
             CEEAFDTVLNATGRDPDVAKL LD VGV+LNPKTGRIAVTNEQTS PNI+AIGDVIDAP
Sbjct  427  TCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAP  486

Query  451  ELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLE  510
            ELTPVAIQAGR+LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEK+GE+ LE
Sbjct  487  ELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLE  546

Query  511  IYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKL  570
            IYHQNFTPLEWSLSSDR+AAGSCYVKVICDT RNKHVVGFHYLGPNAGEVTQAIGLAMKL
Sbjct  547  IYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKL  606

Query  571  GFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            GFTYD MVNVVGIHPTTAEIFTTLEVTKSSGESAA+GGC
Sbjct  607  GFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645

>PYAP_17761
Length=622

 Score = 927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/625 (75%), Positives = 524/625 (84%), Gaps = 33/625 (5%)

Query  15   MATVNIKETLV--RGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDR  72
            MA V+  +++V    G P TY++AGW  C +Y+KA DV QAM++LY DAV  E  EF  R
Sbjct  1    MAPVDFPQSVVPPASGAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESR  60

Query  73   EAFRAWLsasaadfaanfgadsKAATHTSSPFF---------------------------  105
            +AF+AWL+ S A FA  FG DS A THTSSPF                            
Sbjct  61   DAFKAWLAESNAAFAQAFGTDSPALTHTSSPFVWSNARGFIGGCDATLAHFRSGVAARPL  120

Query  106  -GKDESPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSP  164
             G   SPT T VA   VD++ TYDYDL+VIGGGSGGLACSKEAAKYGKKVCVLDYVKPSP
Sbjct  121  AGPSASPTMTPVA---VDESKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSP  177

Query  165  GGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSY  224
             GTTWGLGGTCVNVGCIPKKLMHQS+LIGE +HKDA AFGW++GEQKF W Q+++SVN+Y
Sbjct  178  LGTTWGLGGTCVNVGCIPKKLMHQSALIGELMHKDAGAFGWNMGEQKFTWTQLVESVNNY  237

Query  225  IKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPL  284
            IK INFKYKVELRDKKVKYEN LGSFVD HT+ELWH KKGTKT+TTR VV+AVGGRP+ L
Sbjct  238  IKGINFKYKVELRDKKVKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQL  297

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFD  344
            SC GGE AISSDDIFWRK  PGKTLV+GASYVALECAGF+KGMGY+VK+MVRSILLRGFD
Sbjct  298  SCPGGEHAISSDDIFWRKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFD  357

Query  345  QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATG  404
            +DMA++IG+FM+ ESKIEFIRGAVP+SI KLE+GQLLVKW S+DG+  EE FD+VLNATG
Sbjct  358  EDMANRIGDFMQDESKIEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATG  417

Query  405  RDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLA  464
            RDPDV+KLNLD  GVQLNPKTGRIAVTNEQTS PN+FAIGDVIDAPELTPVAIQAGR+LA
Sbjct  418  RDPDVSKLNLDKAGVQLNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLA  477

Query  465  RRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLS  524
            RRLYNNET LMDYDKVCTAVFTPIEYGCCGLSEEA+ +K+GED LEIYHQ+F PLEWSLS
Sbjct  478  RRLYNNETTLMDYDKVCTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLS  537

Query  525  SDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIH  584
             DR AA +CYVKVICD TR+K+VVGFHYLGPNAGEVTQA+GLAMK+GFTYD MVNVVGIH
Sbjct  538  QDRVAANTCYVKVICDKTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIH  597

Query  585  PTTAEIFTTLEVTKSSGESAAAGGC  609
            PTTAE+FTTLEVTKSSG SAAAGGC
Sbjct  598  PTTAEVFTTLEVTKSSGASAAAGGC  622

>PHYKE_8391
Length=778

 Score = 872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/645 (68%), Positives = 496/645 (77%), Gaps = 52/645 (8%)

Query  17   TVNIKETLVRGGGPP--TYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREA  74
            T N+ ETL         T+HI+GWR C  + KA +V  AM++LYPD V  E H F DR+A
Sbjct  134  TKNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVSFETHAFEDRDA  193

Query  75   FRAWLsasaadfaanfgadsKAATHTSSPFF-----------------------------  105
            F+ WLS S   F  +FGADSKA TH +SPF                              
Sbjct  194  FKQWLSTSKDHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLLAFFRSGVAVGSPQ  253

Query  106  GKD---------------ESPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKY  150
            G D                S T T   A  +++  +YDYDL+VIGGGSGGLACSKEAA +
Sbjct  254  GADPAEKAEAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGGSGGLACSKEAASF  313

Query  151  GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSV--G  208
            G+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGET+H D+A FGW+V  G
Sbjct  314  GQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMHHDSANFGWNVASG  373

Query  209  EQK---FDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGT  265
            E K   FDW Q++ +V+SYIKSINFKYKVELR K VKYEN LGSF+D HTLELWHP+KGT
Sbjct  374  EGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLDPHTLELWHPRKGT  433

Query  266  KTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-RKEAPGKTLVIGASYVALECAGFM  324
            K +TTR VV+AVGGRPK L+C G E AISSDDIFW +K APGKTLV+GASYVALECAGF+
Sbjct  434  KQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVVGASYVALECAGFL  493

Query  325  KGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKW  384
            KGMGYDVK+MVRSILLRGFDQDMA+KIGE+MEV++ IEFIR  VP+SITKLE+GQLLVKW
Sbjct  494  KGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPESITKLENGQLLVKW  553

Query  385  VSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIG  444
             + D + CEE FDTVLNATGRDPDVAKL LD  GV+LN KTGRI   NEQTS PNIFAIG
Sbjct  554  TTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTKNEQTSTPNIFAIG  613

Query  445  DVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKF  504
            DVIDAPELTPVAIQAGR L+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE S E+F
Sbjct  614  DVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYGCCGLSEEDSNERF  673

Query  505  GEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAI  564
            GED +E+YH+NF PLEWSLS  R ++ SCYVKVICDTTR+K VVGFHYLGPNAGEVTQA+
Sbjct  674  GEDNVEVYHKNFVPLEWSLSESRTSSESCYVKVICDTTRDKFVVGFHYLGPNAGEVTQAM  733

Query  565  GLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  734  GLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PHYCA_556160
Length=649

 Score = 855 bits (2209),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/645 (69%), Positives = 499/645 (77%), Gaps = 53/645 (8%)

Query  18   VNIKETLVRG--GGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAF  75
            V + ETLV        T+HIAGW+ C  + KA +V  AM++LYPD V  E+H F DREAF
Sbjct  5    VRLAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAF  64

Query  76   RAWLsasaadfaanfgadsKAATHTSSPFF----------GKDE----------------  109
            + WLS S  +FA +FG DSKA  H +SPF           G D+                
Sbjct  65   KHWLSESQDEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQG  124

Query  110  -----SPTPTMVAAPV------VDDNVT-------YDYDLIVIGGGSGGLACSKEAAKYG  151
                 SPT     A V      V++  T       YDYDL+VIGGGSGGLACSKEAA +G
Sbjct  125  ATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFG  184

Query  152  KKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGE--  209
            +KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGE IH D A FGW++    
Sbjct  185  QKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD  244

Query  210  ---QKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTK  266
                 F+W Q++ +V+ YIKSINFKYKVELR K VKYEN LGSFV+ HTLELWHP+KGTK
Sbjct  245  GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTK  304

Query  267  TVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-RKEAPGKTLVIGASYVALECAGFMK  325
             +TTRDVVIAVGGRPK L+C GGE AISSDDIFW +K+ PGKTLV+GASYVALECAGF+K
Sbjct  305  QITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLK  364

Query  326  GMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWV  385
            GMGYDVK+MVRSILLRGFDQDMA KIGE+MEV+S IEFIR  VPQSITKLE+GQLLVKW 
Sbjct  365  GMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424

Query  386  SSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGD  445
            S DG+ CEEAFDTVLNATGRDPDVAKLNLD  GV+LN K+GRI V NEQTS PNI+AIGD
Sbjct  425  SEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGD  484

Query  446  VIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFG  505
            VIDAPELTPVAIQAGR+L+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE S E+FG
Sbjct  485  VIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFG  544

Query  506  EDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAI  564
            ED +E+YH NF PLEWSLS+D R AA SCY+KVICD TR+K VVGFHYLGPNAGEVTQA+
Sbjct  545  EDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604

Query  565  GLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGGATTGGGC  649

>PITG_18452
Length=856

 Score = 851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/639 (68%), Positives = 496/639 (78%), Gaps = 55/639 (9%)

Query  18   VNIKETL--VRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAF  75
            VN+ +TL         T++IAGW+ C  + KA +V  AM++LYPD V  E H F DR AF
Sbjct  5    VNLGDTLSTALSSSVATFYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAF  64

Query  76   RAWLsasaadfaanfgadsKAATHTSSPFF--------GKDE------------------  109
            + WLSAS  D  A+FGADS+A  H +SPF         G DE                  
Sbjct  65   KQWLSASQDDITAHFGADSRATKHVTSPFVWSSTIFVGGCDELLAFFRSGIAVGKPQGVM  124

Query  110  ----SPTPTMVAAPVVD----------------DNVTYDYDLIVIGGGSGGLACSKEAAK  149
                 PTP+   AP  D                +  +YDYDL+VIGGGSGGLACSKEAA 
Sbjct  125  PSEKQPTPSSALAPETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAAS  184

Query  150  YGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGE  209
            +G+KVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGE +H D+A+FGW+V  
Sbjct  185  FGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSS  244

Query  210  QK-----FDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  264
             +     FDW Q++ +V+ YI+ INFKYKVELR K VKYEN LGSF+D HTLELWHP+KG
Sbjct  245  GQGSAPIFDWKQLVTNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKG  304

Query  265  TKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRK-EAPGKTLVIGASYVALECAGF  323
            +K +TTRDVVIAVGGRP+ L+  GGE AISSDDIFW K + PGKTLV+GASYVALECAGF
Sbjct  305  SKQITTRDVVIAVGGRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGF  364

Query  324  MKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVK  383
            +KGMGYDVK+MVRSILLRGFDQDMA+KIGE+MEV+S IEFIR  VPQSITKLE+GQLLVK
Sbjct  365  LKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVK  424

Query  384  WVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAI  443
            W S DG+ CEEAFD+VLNATGRDPD+AKL+LD  GV+LN KTGRI V +EQTS PNI+AI
Sbjct  425  WTSEDGESCEEAFDSVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAI  484

Query  444  GDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEK  503
            GDVIDAPELTPVAIQAGR+L+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE SI++
Sbjct  485  GDVIDAPELTPVAIQAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKR  544

Query  504  FGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQ  562
            FG+DK+E+YH NF PLEWSLS++ R AA SCYVKVICD  R+K VVGFHYLGPNAGEVTQ
Sbjct  545  FGKDKIEVYHTNFVPLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQ  604

Query  563  AIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSG  601
            A+GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSSG
Sbjct  605  AMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSG  643

>PYAR_13569
Length=494

 Score = 832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/493 (82%), Positives = 443/493 (90%), Gaps = 1/493 (0%)

Query  118  APV-VDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCV  176
            AP+ VDD  TYDYDL+VIGGGSGGLACSKEAAK+GKKV VLDYVKPSP GTTWGLGGTCV
Sbjct  2    APMDVDDEATYDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCV  61

Query  177  NVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVEL  236
            NVGCIPKKLMHQS+L+GE +HKDA AFGW+ G Q F W Q++ SVN+YIK INFKYKVEL
Sbjct  62   NVGCIPKKLMHQSALLGELMHKDAPAFGWTTGAQSFTWTQLVASVNNYIKGINFKYKVEL  121

Query  237  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSD  296
            RDKKVKYEN LGSFVDAHT+ELWH KK  KTVTTR VVIAVGGRP+ L+C GGE AISSD
Sbjct  122  RDKKVKYENFLGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSD  181

Query  297  DIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFME  356
            DIFWRK  PGKTLV+GASYVALECAGF+KGMGYDVKIMVRSILLRGFDQDMA++IG+FM+
Sbjct  182  DIFWRKTEPGKTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQ  241

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
             ES+IEFIRG VP+SI K E+G+LLVKW S DGD  EE FDTVLNATGRDPDV KLNLD 
Sbjct  242  DESRIEFIRGVVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDK  301

Query  417  VGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMD  476
             GV+LNPK+GRIA TNEQTS PNIFAIGDVIDAPELTPVAIQAGR+LARRLYNNET LMD
Sbjct  302  AGVELNPKSGRIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMD  361

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVK  536
            YDK+CTAVFTPIEYGCCGLSEE +  K+GE+ LEIYHQ+F PLEWSLS +R AA +CYVK
Sbjct  362  YDKICTAVFTPIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVK  421

Query  537  VICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEV  596
            VICD TR+KHVVGFHYLGPNAGEVTQA+GLAMK+GFTYD MVNVVGIHPTTAE+FTTLE+
Sbjct  422  VICDKTRDKHVVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEI  481

Query  597  TKSSGESAAAGGC  609
            TKSSG SAAAGGC
Sbjct  482  TKSSGASAAAGGC  494

>HYAP_07095
Length=613

 Score = 822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/613 (68%), Positives = 475/613 (77%), Gaps = 57/613 (9%)

Query  54   MRVLYPDAVDCEIHEFPDREAFRAWLsasaadfaanfgadsKAATHTSSPFF--------  105
            M V+YP  V  E H F DR+AF+ WLS S  DF   FG DSKA TH +SPF         
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWLSTSYEDFVTQFGLDSKATTHVTSPFVWISNPTTF  60

Query  106  --GKDE------------------------------SPTPTMVAA---------PVV-DD  123
              G D+                              +P     +A         P+V +D
Sbjct  61   VGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVVED  120

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            + +YDYDL+VIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPK
Sbjct  121  DASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCIPK  180

Query  184  KLMHQSSLIGETIHKDAAAFGWSVGEQK-----FDWAQMLKSVNSYIKSINFKYKVELRD  238
            KLMHQSSLIGE +H D A+FGW+VG        FDW Q++ +V+SYIKSI+FKYKVELR 
Sbjct  181  KLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVELRS  240

Query  239  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDI  298
            K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GGELA+SSDDI
Sbjct  241  KQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSDDI  300

Query  299  FWRKEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEV  357
            FW K+  PGKTLV+GASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMASKIGE+ME+
Sbjct  301  FWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYMEM  360

Query  358  ESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSV  417
            +S IEFIR  VPQSITKL+SGQLLVKW++ DGD  EE FDTVLNATGRDPDVAKL LD  
Sbjct  361  QSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLDEA  420

Query  418  GVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDY  477
            GV+LN KTGRI V NEQT+ PN++AIGDVIDAPELTPVAIQAGR+L+RRLYN  T  MDY
Sbjct  421  GVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQMDY  480

Query  478  DKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVK  536
            DK+CTAVFTPIEYGCCGLSEE S E++G+D +E+YH+NF PLEWSL+   R AA SCYVK
Sbjct  481  DKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCYVK  540

Query  537  VICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEV  596
            V+CD TRN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYD +V+ VGIHPTTAE FTTLE 
Sbjct  541  VVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTLET  600

Query  597  TKSSGESAAAGGC  609
            TKSSG+S   GGC
Sbjct  601  TKSSGDSTTGGGC  613

>PHYSO_348901
Length=526

 Score = 805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/499 (77%), Positives = 433/499 (87%), Gaps = 7/499 (1%)

Query  118  APVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVN  177
            + V +   +YDYDL+VIGGGSGGLACSKEAA +G+KVCVLDYVKPSP GT+WGLGGTCVN
Sbjct  28   SAVDEAETSYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVN  87

Query  178  VGCIPKKLMHQSSLIGETIHKDAAAFGWSVGE-----QKFDWAQMLKSVNSYIKSINFKY  232
            VGCIPKKLMHQSSLIGE +H D+A FGW++         F W Q++ +V+ YI+ INFKY
Sbjct  88   VGCIPKKLMHQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKY  147

Query  233  KVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELA  292
            KVELR K VKYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GGE A
Sbjct  148  KVELRSKYVKYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHA  207

Query  293  ISSDDIFW-RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKI  351
            ISSDDIFW +K+ PGKTLV+GASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMA+KI
Sbjct  208  ISSDDIFWMKKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKI  267

Query  352  GEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAK  411
            GE+MEV+S IEFIR  VPQSITKLE+GQLLVKW + DG+ CEEAFDTVLNATGRDPDVAK
Sbjct  268  GEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAK  327

Query  412  LNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE  471
            L LD   V+LN KTGRI V NEQTS PNI+AIGDVIDAPELTPVAIQAGR+L+RRLYNN 
Sbjct  328  LGLDKARVKLNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNS  387

Query  472  TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAA  530
            TA MDYDK+CTAVFTPIEYGCCGLSEE S E++GED +E+YH+NF PLEWSLS + R AA
Sbjct  388  TAQMDYDKICTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAA  447

Query  531  GSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEI  590
             SCY+KVICD TR+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+ VGIHPTTAE 
Sbjct  448  ESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAET  507

Query  591  FTTLEVTKSSGESAAAGGC  609
            FTTLE+TKSSG +   GGC
Sbjct  508  FTTLEITKSSGGTTTGGGC  526

>PHYRA_50855
Length=489

 Score = 798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/489 (79%), Positives = 429/489 (88%), Gaps = 5/489 (1%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            +YDYDL+VIGGGSGGLACSKEAA +GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKL
Sbjct  1    SYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKL  60

Query  186  MHQSSLIGETIHKDAAAFGWSVGEQ----KFDWAQMLKSVNSYIKSINFKYKVELRDKKV  241
            MHQSSLIGE +H D+A FGW+V  +     F+W Q++ +V++YIKSINFKYKVELR K V
Sbjct  61   MHQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYV  120

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW-  300
            KYEN LGSFVD HTLELWH +KGTK +TTRDVVIAVGGRPK LSC GGE AISSDDIFW 
Sbjct  121  KYENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWM  180

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESK  360
            +K+ PGKTLV+GASYVALECAGF+KGMGY+VK+MVRSILLRGFDQDMA+KIGE+MEV+S 
Sbjct  181  KKKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSG  240

Query  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420
            IEFIR  VPQSIT LE+GQLLVKW + DG+ CEEAFDTVLNATGRDPDVAKL LD  GV+
Sbjct  241  IEFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVK  300

Query  421  LNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKV  480
            LN K+GRI V NEQTS  NI+A+GDVIDAPELTPVAIQAGR+L+RRLYNN TA MDY+KV
Sbjct  301  LNEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKV  360

Query  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540
            CTAVFTPIEYGCCGLSEE S E+FGED +E+YH NF PLEWSLS  R +A SCYVKVICD
Sbjct  361  CTAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICD  420

Query  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSS  600
             TR+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYD MV+ VGIHPTTAE FTTLEVTKSS
Sbjct  421  KTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSS  480

Query  601  GESAAAGGC  609
            G +   GGC
Sbjct  481  GGATTGGGC  489

>PHALS_06481
Length=644

 Score = 772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/614 (64%), Positives = 467/614 (76%), Gaps = 36/614 (6%)

Query  32   TYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLsasaadfaanfg  91
            T+++AGW+ C  + KA +++ AM++LYPD +  +I  F DRE FR WL AS  DFA +FG
Sbjct  31   TFYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQGDFAVSFG  90

Query  92   adsKAATHTSSPFF-----------------------------GKDESPTPTMVAAPVVD  122
            A SKA  H +SPF                              G   S     +++  V 
Sbjct  91   AKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAVQ  150

Query  123  DNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIP  182
            +   +DYDL+VIGGG GGLACSKEAA +G+KVCVLDYVKPSP GT WGLGGTCVNVGCIP
Sbjct  151  EKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCIP  210

Query  183  KKLMHQSSLIGETIHKDAAAFGWSVGEQK-----FDWAQMLKSVNSYIKSINFKYKVELR  237
            KKL+HQSSLIGE I  D+A FGW    +      FDW Q++ +V+ YIK+INFKYKV+LR
Sbjct  211  KKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKLR  270

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
             K VKYEN LGSFVD HT++L HP+KGTK +TTR+VVIAVG RP+ L+C GGE A+SSDD
Sbjct  271  SKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSDD  330

Query  298  IFWRKEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFME  356
            IFW KE  PGKTLVIGASYVALECAGF+KGMGY+VK+MVRSILLR FDQ+MA KIGE+ME
Sbjct  331  IFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYME  390

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
            V+S I+FIR  VPQSI++LE+ QLLVKWV   G  CEEAF+TVLNATGRDP+VA L LD 
Sbjct  391  VQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLDK  450

Query  417  VGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMD  476
             GV+LN KTGRI V NEQTS  NI+AIGDV+DAPELTPVAIQ+GR+L++RLYNN +  MD
Sbjct  451  AGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQMD  510

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYV  535
            YDKVCT VFTPIEYGCCGLSEE S  ++GED +EIYH NF PLEWSLSS+ R A+ SCY+
Sbjct  511  YDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCYI  570

Query  536  KVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLE  595
            KV+CD +R+K V+GFHYLGPNAGEV QA+GLAM+L FTYD MVN VGIHP TAE  T LE
Sbjct  571  KVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTILE  630

Query  596  VTKSSGESAAAGGC  609
            VTKSSG +   GGC
Sbjct  631  VTKSSGGATTGGGC  644

>H310_08590
Length=640

 Score = 772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/632 (62%), Positives = 462/632 (73%), Gaps = 50/632 (8%)

Query  10   KREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEF  69
            ++ + M+T+N             YH+ GW+ C +Y KA+ V+ +M+ L+P  V   IHE 
Sbjct  27   RQSSKMSTIN-------------YHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEH  73

Query  70   PDREAFRAWLsasaadfaanfgadsKAATHTSSPF--FGKDESP----------------  111
            P++E+F  WL+ S  +FA  F  D++   H SSPF    +D++P                
Sbjct  74   PNKESFANWLNESQTEFARQFDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRAR  133

Query  112  --------TPTMVAAPVVD----DNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDY  159
                     P+   A V D    D   YD+DL+VIGGGSGGLACSKEA+K G+KV VLDY
Sbjct  134  TQSAPSTGAPSAANAHVSDTSSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDY  193

Query  160  VKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLK  219
            VKPSP G+TWGLGGTCVNVGCIPKKLMHQSS+IGE +HKDA  FGW+V    FDW +++ 
Sbjct  194  VKPSPVGSTWGLGGTCVNVGCIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVS  253

Query  220  SVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAV  277
            SV  YI  +NFKY+++LRDKKVKYEN+LG+F DAHTL L +   KKG   VT R  VIAV
Sbjct  254  SVQDYIHGLNFKYRIDLRDKKVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAV  313

Query  278  GGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRS  337
            GGRPKPLSC G E AISSDDIF + EAPGKTLV+GASYVALECAGF+KG G+DV IMVRS
Sbjct  314  GGRPKPLSCPGWEHAISSDDIFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRS  373

Query  338  ILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFD  397
            ILLRGFDQD+A +IGE+ME ES I FI+ +VP SI KL +GQL V     +G      +D
Sbjct  374  ILLRGFDQDIARRIGEYMENESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYD  428

Query  398  TVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAI  457
            TVLNATGR PDV  LNL + GV LNPK+GRI VTNEQTS P+I+AIGDVIDAPELTPVAI
Sbjct  429  TVLNATGRSPDVQMLNLPAAGVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAI  488

Query  458  QAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFT  517
            QAG++LARRL+ N TALMDY K+CTAVFTP+EYGCCGLSEE +I   G D +++YHQNFT
Sbjct  489  QAGKLLARRLFGNGTALMDYTKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFT  548

Query  518  PLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDM  577
            PLEWSLS +R  A  CY K+I DTT+ K VVGFHYLGPNAGEVTQAIG+AMKL  TYDD 
Sbjct  549  PLEWSLSHERPLAKECYAKLIVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDF  608

Query  578  VNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            VN VGIHPTTAEIFTTLE+TK SGE A+A GC
Sbjct  609  VNTVGIHPTTAEIFTTLEITKESGEDASASGC  640

>H257_08436
Length=642

 Score = 767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/608 (62%), Positives = 452/608 (74%), Gaps = 35/608 (6%)

Query  32   TYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCEIHEFPDREAFRAWLsasaadfaanfg  91
             YH+ GW+ C +Y KA+ V  +M+ L+P  V   IHE P++E+F  WL+ S  +FA  F 
Sbjct  40   NYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQTEFAHQFD  99

Query  92   adsKAATHTSSPFFGKDESPTPTMV----------------------------AAPVVDD  123
             D++   H SSPF   ++  TP  V                            A    D 
Sbjct  100  NDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTSDA  159

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YD+DL+VIGGGSGGLACSKEA+K G+KV VLDYVKPSP G+TWGLGGTCVNVGCIPK
Sbjct  160  DVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCIPK  219

Query  184  KLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKY  243
            KLMHQSS+IGE +HKDA  FGWSV    FDW++++ SV  YI  +NFKY+V+LRDKKVKY
Sbjct  220  KLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKVKY  279

Query  244  ENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWR  301
            EN+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G E A+SSDDIF +
Sbjct  280  ENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIFSK  339

Query  302  KEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKI  361
             +APGKTLV+GASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME ES I
Sbjct  340  PDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESESGI  399

Query  362  EFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQL  421
             FI+ +VP SI KLE+GQ  V   +      ++ +DT+LNATGR PDV KLNLD+ GV L
Sbjct  400  AFIKESVPTSIVKLENGQFQVTHTTG-----QDVYDTILNATGRSPDVQKLNLDAAGVAL  454

Query  422  NPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVC  481
            NPK+GRI V NEQTS PNI+A+GDVIDAPELTPVAIQAG++L+RRL+ N T LMDY K+C
Sbjct  455  NPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTKIC  514

Query  482  TAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDT  541
            TAVFTP+EYGCCGLSEE +I   G + +E+YHQNFTPLEWSLS DR  A  CY K+I DT
Sbjct  515  TAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIVDT  574

Query  542  TRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSG  601
            T+ K V+GFHYLGPNAGEVTQAIG+A+KL  TYDD +N VGIHPTTAEIFTTLE+TK SG
Sbjct  575  TQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKESG  634

Query  602  ESAAAGGC  609
              A+A GC
Sbjct  635  VDASASGC  642

>PYVX_18170
Length=510

 Score = 749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/466 (79%), Positives = 410/466 (88%), Gaps = 2/466 (0%)

Query  146  EAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGW  205
            EA+K+G+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQS+LIGE +HKDAA FGW
Sbjct  45   EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGEVMHKDAALFGW  104

Query  206  SV-GEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  264
                  KFDW+Q+  SV++YIK++NFKYKV+LRDKKVKYEN LG+FVD HT+EL +P+K 
Sbjct  105  QFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDPHTIELSNPRKP  164

Query  265  TKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFM  324
            +KTVTTR VV+AVGGRP+ L C GGEL+I+SDDIFWRK APGKTLV+GASYVALECAGF+
Sbjct  165  SKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRKTAPGKTLVVGASYVALECAGFL  224

Query  325  KGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKW  384
            KG GYDVK+MVRSILLRGFDQDMA++IGE+MEVE+ IEFIR  VP SITKLE G+LLVKW
Sbjct  225  KGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSITKLEDGKLLVKW  284

Query  385  VSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIG  444
               DG   EEAFDTVLNATGR+PDV KL LD  GV+LNPKTGRI VTNEQTS PNIFAIG
Sbjct  285  TLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNEQTSTPNIFAIG  344

Query  445  DVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKF  504
            DVIDAPELTPVAIQAGR+LARRLYNNET LMDY+KVCTAVFTPIEYGCCGLSEE SIE+F
Sbjct  345  DVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCCGLSEEESIERF  404

Query  505  GEDKLEIYHQNFTPLEWSLSSD-RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQA  563
            GED +E+YHQNFTPLEW+LS D R +  +CY+KVICD TR+  VVGFHYLGPNAGEVTQA
Sbjct  405  GEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHYLGPNAGEVTQA  464

Query  564  IGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            IGLAMKLGFTY+ MV+VVGIHPTTAE FTTLEVTKSSG SAA G C
Sbjct  465  IGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>SPRG_14103
Length=628

 Score = 744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/634 (61%), Positives = 464/634 (73%), Gaps = 47/634 (7%)

Query  5    QASGTKREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDC  64
            Q S  +  +TM++VN             YH+ GW+ C +Y++A++V  +M+ L+P  V  
Sbjct  13   QRSTWRSSSTMSSVN-------------YHVVGWKSCPYYERAANVASSMQTLFPGQVKA  59

Query  65   EIHEFPDREAFRAWLsasaadfaanfgadsKAATHTSSPF-FGKDESPTPTM--------  115
             IHE   +++F  WL AS A FA  F  D++A  H +SPF + +D + T  +        
Sbjct  60   TIHEHATKQSFNDWLEASQATFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLA  119

Query  116  ------------------VAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVL  157
                              V A  VDD  TYD+DL+VIGGGSGGLA SKEAAKYG+KV VL
Sbjct  120  FFRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVL  179

Query  158  DYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQM  217
            DYVKPSP G+TWGLGGTCVNVGCIPKKLMHQS+++GE +HKDA AFGW+V    FDW ++
Sbjct  180  DYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKL  239

Query  218  LKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGT--KTVTTRDVVI  275
            + SV  YI  +NFKY+V+LRDKKVKYEN LG+F DAHTL L +P KG   K VT R  +I
Sbjct  240  VTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALI  299

Query  276  AVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMV  335
            AVGGRPK L C G +LAISSDDIF R   PGKTLV+GASYVALECAGF+K  G+DV +MV
Sbjct  300  AVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKAQGFDVTVMV  359

Query  336  RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEA  395
            RSILLRGFD DMA++IG +ME E+KI+FI+GAVP SI +L +GQL V     +G      
Sbjct  360  RSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-----I  414

Query  396  FDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPV  455
            +DTVLNATGR+PDV+ LNL + GV LNPKTGRIAVT+EQTS P+I+A+GDVID PELTPV
Sbjct  415  YDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGPELTPV  474

Query  456  AIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQN  515
            AIQAGR+LA+RL++N   LM YDKVCTAVFTPIEYGCCGLSE+A+IE  G D L +YHQ+
Sbjct  475  AIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLGVYHQS  534

Query  516  FTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYD  575
            FTPLEWSLS DR  A  CY K+I D T+N  VVGFHYLGPNAGEVTQA+G+AMKL  +YD
Sbjct  535  FTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKLNASYD  594

Query  576  DMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            D V+ VGIHPTTAEIFTTLE+TK SG  A+A GC
Sbjct  595  DFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/634 (60%), Positives = 462/634 (73%), Gaps = 47/634 (7%)

Query  5    QASGTKREATMATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDC  64
            Q S  +  +TM++VN             YH+ GW+ C +Y++A++V  +M+ L+P  V  
Sbjct  13   QRSTWRSSSTMSSVN-------------YHVVGWKSCPYYERAANVAVSMQTLFPGQVKA  59

Query  65   EIHEFPDREAFRAWLsasaadfaanfgadsKAATHTSSPF-FGKDESPTPTM--------  115
             IHE   +++F  WL  S + FA  F  D++A  H +SPF + +D + T  +        
Sbjct  60   TIHEHATKQSFNDWLETSQSTFATQFVGDARATNHYTSPFCYLEDGAGTKFVGGCDDTLA  119

Query  116  ------------------VAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVL  157
                              V A  VDD  TYD+DL+VIGGGSGGLA SKEAAKYG+KV VL
Sbjct  120  FFRSRTQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQKVLVL  179

Query  158  DYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQM  217
            DYVKPSP G+TWGLGGTCVNVGCIPKKLMHQS+++GE +HKDA AFGW+V    FDW ++
Sbjct  180  DYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATFDWTKL  239

Query  218  LKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGT--KTVTTRDVVI  275
            + SV  YI  +NFKY+V+LRDKKVKYEN LG+F DAHTL L +P KG   K VT R  +I
Sbjct  240  ITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTFRRALI  299

Query  276  AVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMV  335
            AVGGRPK L C G +LAISSDDIF R   PGKTLV+GASYVALECAGF+KG G+DV +MV
Sbjct  300  AVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFDVTVMV  359

Query  336  RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEA  395
            RSILLRGFD DMA++IG +ME E+KI FI+GAVP SI +L +GQL V     +G      
Sbjct  360  RSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-----I  414

Query  396  FDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPV  455
            +DTVLNATGR PDV+ LNL + GV LNPKTGRIAVT+EQTS P+I+A+GDVID PELTPV
Sbjct  415  YDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGPELTPV  474

Query  456  AIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQN  515
            AIQAGR+L++RL++N   LM YDKVCTAVFTPIEYGCCGLSE+A++E  G D L +YHQ+
Sbjct  475  AIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLGVYHQS  534

Query  516  FTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYD  575
            FTPLEWSLS DR  A  CY K+I D T+N  VVGFHYLGPNAGEVTQA+G+A+KL  +Y+
Sbjct  535  FTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKLNASYE  594

Query  576  DMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609
            D V+ VGIHPTTAEIFTTLE+TK SG  A+A GC
Sbjct  595  DFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 431 bits (1109),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 239/499 (48%), Positives = 322/499 (65%), Gaps = 22/499 (4%)

Query  127  YDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +DYD +VIGGGSGG+A +KEAA+ G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+M
Sbjct  4    FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  63

Query  187  HQSSLIGETIHKDAAAFGWSVGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            H S ++G  +H DAA  GW V E+ + +W  ++++V +++K +NF Y+V LR  KV+Y N
Sbjct  64   HYSGILGAGLH-DAAHLGWQVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQYIN  122

Query  246  LLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK-PLSCEG-GELAISSDDIFWRKE  303
             L  F D HTL        T+T+T   ++IA GGRP  P    G  E AI+SDD+F    
Sbjct  123  ALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLFSLST  182

Query  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEF  363
            APGKTLV+G SY+ALECAGF+  + Y   + VRSILLRGFD+ +A+KI + M V   ++F
Sbjct  183  APGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VAQGMDF  241

Query  364  IRGAVPQSITKLE-SGQLLVKWVSSD-GDICEEAFDTVLNATGRDPDVAKLNLDSVGVQL  421
                +P SI K E +GQL V + +S+  +   EAFDTVL A GR  D   + L+  GV+ 
Sbjct  242  RFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEKAGVKA  301

Query  422  NPKTGRIAVTNEQTSVPNIFAIGDVIDA-PELTPVAIQAGRMLARRLYN-NETALMDYDK  479
             P  G+    NE T+VP+I A+GDV+   PELTPVAI+AG  L RRL+  N T  M+YD 
Sbjct  302  LPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYDL  360

Query  480  VCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQA----------  529
            + T VFTP+EYG  GLSEE +I ++G+D + +Y   F  LEW     ++A          
Sbjct  361  IPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQEGDYDT  420

Query  530  --AGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTT  587
                +C  K++C  + N+ V+GFH++GPNAGEVTQ   +A+ +G T +D  NV+GIHPT 
Sbjct  421  EFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPTD  480

Query  588  AEIFTTLEVTKSSGESAAA  606
            AE F  L VTK SG S  A
Sbjct  481  AESFMALTVTKESGASWVA  499

>SDRG_14408
Length=528

 Score = 432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 324/500 (65%), Gaps = 24/500 (5%)

Query  127  YDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +DYD +VIGGGSGG+A +KEAA+ G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+M
Sbjct  23   FDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKIM  82

Query  187  HQSSLIGETIHKDAAAFGWSVGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            H S ++G  +H DAA  GW + E+ + +W  ++++V +++K +NF Y+V LR  KV+Y N
Sbjct  83   HYSGILGAGLH-DAAHLGWQLPEKVEHNWETLVETVQAHVKKLNFSYRVGLRSNKVQYIN  141

Query  246  LLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK-PLSCEG-GELAISSDDIFWRKE  303
             L  F D HTL        T+T+T   ++IA GGRP  P    G GE AI+SDD+F    
Sbjct  142  ALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAITSDDLFSLTT  201

Query  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIEF  363
            APGKTLV+G SY+ALECAGF+  + Y   + VRSILLRGFD+ +A+KI + M V   ++F
Sbjct  202  APGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIM-VAQGMDF  260

Query  364  IRGAVPQSITKLE-SGQLLVKWVSSD-GDICEEAFDTVLNATGRDPDVAKLNLDSVGVQL  421
                +P SI K + +GQL V + +S+  +   E FDTVL A GR  D   + L+ VGV+ 
Sbjct  261  RFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGLEKVGVKA  320

Query  422  NPKTGRIAVTNEQTSVPNIFAIGDVIDA-PELTPVAIQAGRMLARRLYN-NETALMDYDK  479
             P  G+    NE T+VP+I A+GDV+   PELTPVAI+AG  L RRL+  N T  M+YD 
Sbjct  321  LPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYDL  379

Query  480  VCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS-------  532
            + T VFTP+EYG  GLSEE +I ++G+D + +Y   F  LEW  +  RQ A S       
Sbjct  380  IPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWG-AVHRQKAESAQEGDYD  438

Query  533  ------CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPT  586
                  C  K++C  + N+ V+GFH++GPNAGEVTQ   +A+ +G T +D  NV+GIHPT
Sbjct  439  TEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPT  498

Query  587  TAEIFTTLEVTKSSGESAAA  606
             AE F  L VTK SG S  A
Sbjct  499  DAESFMALTVTKESGASWVA  518

>SDRG_03822
Length=494

 Score = 259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 168/474 (35%), Positives = 252/474 (53%), Gaps = 21/474 (4%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IV+G GSGG++ +  A  YG KV V++  + + G    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQANDGA---GLGGTCVNVGCVPKKIMFN  60

Query  189  SSLIGETIHKDAAAFGWSVGEQ-----KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKY  243
            ++L  E +H  A A+ +  G Q      FDWA M    ++Y+K +N  Y   + + KV  
Sbjct  61   AALHAEMLHS-ARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  244  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKE  303
                  FVD HT+E+   +   K      ++IAVGG P      G E AISSD  F  + 
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAK-----HILIAVGGVPAMPPLPGIEHAISSDGFFALET  173

Query  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIE  362
             P K  V+GA Y+A+E AG    +  D  +  R + +LR FD  +   +   ME  + + 
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVR  232

Query  363  FIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLN  422
            F+R +   SI K E G L ++   +        F+TVL A GR P    L L++  + L+
Sbjct  233  FVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  423  PKTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNE-TALMDYDKV  480
            P         E T+VPN+ A+GDV     ELTPVAI AGR LA RL+ NE  A ++Y ++
Sbjct  293  PDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQI  352

Query  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540
             T VF+    G  GL+E  ++ ++G   +  +  +F+ + +++S+++    +  +K++C 
Sbjct  353  PTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA-MKLVCI  411

Query  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
                  VVG H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  412  GVEET-VVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 253/473 (53%), Gaps = 19/473 (4%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IV+G GSGG++ +  A  YG KV V++  + + G    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGRENDGA---GLGGTCVNVGCVPKKIMFN  60

Query  189  SSLIGETIHKDAAAFGWS----VGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYE  244
            ++L  E +H  A A+ +     +    FDWA M    ++Y+  +N  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  245  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEA  304
                 FVD HT+E+       +  T + ++IAVGG P      G E AISSD  F  +  
Sbjct  120  MGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALETQ  174

Query  305  PGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEF  363
            P K  V+GA Y+A+E AG    +  +  +  R + +LR FD  +   +   ME  + ++F
Sbjct  175  PRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQF  233

Query  364  IRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNP  423
            +R +   +I K   G L ++   +        F+TVL A GR P    L L++  + L+ 
Sbjct  234  VRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALST  293

Query  424  KTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNE-TALMDYDKVC  481
            +        E T+VPN++AIGDV     ELTPVAI AGR LA RL+ NE  A ++Y ++ 
Sbjct  294  EKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIP  353

Query  482  TAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDT  541
            T VF+    G  GL+E  +IE++G   +  +  +F+ + +++ +++    +  +K++C  
Sbjct  354  TVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVCIG  412

Query  542  TRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
               + VVG H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  413  VE-EAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_11131
Length=494

 Score = 252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 252/473 (53%), Gaps = 19/473 (4%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IV+G GSGG++ +  A  YG KV V++  + + G    GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGRENDGA---GLGGTCVNVGCVPKKIMFN  60

Query  189  SSLIGETIHKDAAAFGWS----VGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYE  244
            ++L  E +H  A A+ +     +    FDWA M    ++Y+  +N  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  245  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEA  304
                 FVD HT+E+       +  T + ++IAVGG P      G E AISSD  F  +  
Sbjct  120  MGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALETQ  174

Query  305  PGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEF  363
            P K  V+GA Y+A+E AG    +  +  +  R + +LR FD  +   +   ME  + ++F
Sbjct  175  PRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQF  233

Query  364  IRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNP  423
            +R +   +I K   G L ++   +        F+TVL A GR P    L L++  + L+ 
Sbjct  234  VRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALST  293

Query  424  KTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNE-TALMDYDKVC  481
            +        E T+VPN++AIGDV     ELTPVAI AGR LA RL+ NE  A ++Y ++ 
Sbjct  294  EKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIP  353

Query  482  TAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDT  541
            T VF+    G  GL+E  +I ++G   +  +  +F+ + +++ +++    +  +K++C  
Sbjct  354  TVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVCIG  412

Query  542  TRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
               + VVG H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  413  VE-EAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>PYIR_17506
Length=509

 Score = 253 bits (645),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 167/483 (35%), Positives = 261/483 (54%), Gaps = 37/483 (8%)

Query  129  YDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            YD +VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  188  QSSLIGETIHKDAAAFGWS------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKK  240
             ++ +  T+H+DA  +G+       +G+  +F W+++ +  ++YI  +N  Y+  L + K
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  241  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300
            V       +F     +E+       K ++ R+V+IAVGG+P      G E  I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVES  359
             +E P K  V+GA Y+A+E AG + G+G D  I  R   +LR FD+ +   + + M  + 
Sbjct  205  LEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMAKDG  264

Query  360  KIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419
             +   +  V +    L+  + LV    S+       FDTV+ A GR P  + LN+ + G+
Sbjct  265  IVVRPQSNVARIEKTLDGKKTLVLADGSE----HAGFDTVIYAAGRIPLTSNLNISAAGI  320

Query  420  QLNPKTGRIAVTNEQ-TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDY  477
            + + K G I V   Q TS  N+FA+GDV     LTPVAI AGR L+ RL+   E A + Y
Sbjct  321  ETD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAKISY  379

Query  478  DKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS-----  532
            + + T VF+    G  GL+E+ + EK+G+ +++ Y   F  + + L ++  A G+     
Sbjct  380  NNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTKPKP  439

Query  533  -CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
               +K++C   +++ VVG H +G  A E+ Q  G+A+K+G T  D  N V IHPT  E  
Sbjct  440  MTAMKLVC-LGKDEKVVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEEL  498

Query  592  TTL  594
             TL
Sbjct  499  VTL  501

>SDRG_03823
Length=497

 Score = 252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 171/476 (36%), Positives = 256/476 (54%), Gaps = 19/476 (4%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            T  YD IVIGGGSGG + ++ AA YG KV V++    + G    G+GGTCVNVGC+PKK+
Sbjct  4    TTTYDYIVIGGGSGGNSSARRAAAYGAKVLVIERGHANDGA---GMGGTCVNVGCVPKKV  60

Query  186  MHQSSLIGETIHKDAAAFGWS----VGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKV  241
            M  +++  E +H  A A+ +     V    FDWA + K  ++Y+  +N  Y+  L + K+
Sbjct  61   MFNAAMHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKI  119

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWR  301
                    FVD HT+E+     G +  T + ++IAVGG P      G E AISSD  F  
Sbjct  120  PLIYGAAKFVDNHTIEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFAL  174

Query  302  KEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESK  360
            +  P K  V+GA Y+A+E AG    +  D  +  R + +LR FD  +   +   ME  + 
Sbjct  175  ETQPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAG  233

Query  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420
            + F+R +   SI K E G L ++   +        F+TVL A GR P    L L++  + 
Sbjct  234  VRFVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIA  293

Query  421  LNPKTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNE-TALMDYD  478
            L+P         E T+VPN+ A+GDV     ELTPVAI AGR LA RL+ NE  A ++Y 
Sbjct  294  LSPDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYH  353

Query  479  KVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVI  538
            ++ T VF+    G  GL+E  +IE++G   +++Y   F  + +++S   +   +  +K++
Sbjct  354  QIPTVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQKTA-MKLM  412

Query  539  CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            C     + V+G H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  413  C-IGEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PYAP_21882
Length=502

 Score = 252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 164/484 (34%), Positives = 256/484 (53%), Gaps = 38/484 (8%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGK-KVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            YD +VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  188  QSSLIGETIHKDAAAFGWS-------VGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKK  240
             ++ +G T+H+D   +G+          E +F W ++ +  ++Y+  +N  Y   L + K
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  241  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300
            V       +F     +E+       K +  ++V+IAVGG+P      G E  I SD  F 
Sbjct  142  VDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  196

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVES  359
             +E P K  V+GA Y+A+E AG + G+G D  I  R   +LRGFD+ + + + + M  E 
Sbjct  197  LEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAMAKEG  256

Query  360  KIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419
                   +V + I   +  + LV    S+       FD+V+ A GR P    LNL++ G+
Sbjct  257  VNLRPHSSVTKVIKAADGTKTLVLADGSE----HSGFDSVIYAAGRVPLTESLNLEAAGI  312

Query  420  QLNPKTGRIAVTNEQ--TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMD  476
            + +   G I +   Q  T+  NIFA+GDV   P LTPVAI AGR LA RL+   + A   
Sbjct  313  ETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKAS  371

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS----  532
            Y+ + T VF+    G  GL+E+ +  KFG+D++++Y   F  + + + ++    G     
Sbjct  372  YENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKPK  431

Query  533  --CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEI  590
                +K++C   +++ VVG H +G  A E+ Q  G+A+K+G T  D  + V IHPT AE 
Sbjct  432  PMTAMKLVCQ-GKDEKVVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTAAEE  490

Query  591  FTTL  594
              T+
Sbjct  491  LVTM  494

>SDRG_12187
Length=462

 Score = 248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 251/477 (53%), Gaps = 35/477 (7%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+V+GGGSGG+A ++ AA YGKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  189  SSLIGETIHKDAAAFGW-SVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            ++ +  ++  DA A+G+ +V     DWA + +  ++Y+  +N  Y   L+   V +   L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFAQGL  115

Query  248  GSF-------VDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFW  300
             SF       +DA  L+              +V++AVGG+P      G E  ISSD  F 
Sbjct  116  CSFGSDGRVQIDATPLD----------AEATNVLVAVGGQPVMPDIPGIEHCISSDGFFE  165

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVES  359
              E P +  V+GA Y+A+E AG ++G+G D  I  R   +LR FD  + + + +  + + 
Sbjct  166  LDERPARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQAVLHDAFQRDG  225

Query  360  KIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419
                    + +      +G L V   + +       FD VL ATGR P    L L+  G+
Sbjct  226  ITLQPHSTIARVDKDPTTGSLSVTTTAGEH---HSGFDCVLVATGRTPMTKDLGLEHRGI  282

Query  420  QLNPKTGRIAVTNEQ-TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDY  477
            QL+P  G I V   Q TS P +FA+GDV+D   LTPVAI AGR LA RL+     A  DY
Sbjct  283  QLSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADY  341

Query  478  DKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKV  537
              + + VF+    G  GL+E+ + + + +D+L++Y   F  + +SL        +  +K+
Sbjct  342  TNIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTAMKL  401

Query  538  ICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            IC     K +VG H +G  A E+ Q  G+A+K+G    D+   + IHPT AE   TL
Sbjct  402  ICVGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PYAR_17512
Length=533

 Score = 247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 172/517 (33%), Positives = 269/517 (52%), Gaps = 57/517 (11%)

Query  128  DYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +YD +VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  187  HQSSLIGETIHKDAAAFGWS--------VGEQKFDWAQMLKSVNSYIKSINFKYKVELRD  238
            + ++ +G  +H+D   +G+         + E +F W ++ +  ++Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  239  KKVKYENLLGSFVDAHTLEL---WHPKKGT------------------KTVTTRDVVIAV  277
             KV+      +F     +E+     P K                    K ++ ++V+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  278  GGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRS  337
            GG+P   +  G E  I SD  F  +E P K  V+GA Y+A+E AG + G+G D  I  R 
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRK  263

Query  338  I-LLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEA-  395
              +LRGFD+ + S + + M+ +  ++    ++   +TK   G   +  V  DG   E A 
Sbjct  264  DGVLRGFDELIRSTLHDAMD-KDGLKLRPHSLVAKVTKQADGTKTL--VLQDG--TEHAG  318

Query  396  FDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQ--TSVPNIFAIGDVIDAPELT  453
            FDTV+ A GR P    LNL+  GV+ + + G I +   Q  T+  NIFA+GDV   P LT
Sbjct  319  FDTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPALT  377

Query  454  PVAIQAGRMLARRLYNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIY  512
            PVAI AGR L+ RL+   + A M Y+ + T VF+    G  GL+E+ +  K G+D +++Y
Sbjct  378  PVAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVY  437

Query  513  HQNFTPLEWSLSSDRQAAGS------CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGL  566
               F  + + + ++    G         +K++C   + + VVG H +G  A E+ Q  G+
Sbjct  438  SSRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVC-VGKEEKVVGVHLIGMAADEILQGFGV  496

Query  567  AMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGES  603
            A+K+G T  D  + V IHPT AE   T+     SGE 
Sbjct  497  AVKMGATKADFDSCVAIHPTAAEELVTMAPWGLSGEQ  533

>SPRG_11769
Length=453

 Score = 244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 164/470 (35%), Positives = 251/470 (53%), Gaps = 30/470 (6%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+V+GGGSGG+A ++ AA YGKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  189  SSLIGETIHKDAAAFGW-SVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            ++ +  ++  DA A+G+ +V     DWA + +  ++Y+  +N  Y   L+   V + + L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFAHGL  115

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGK  307
             SF             G+      + ++AVGG+P      G E  ISSD  F   E P +
Sbjct  116  CSF-------------GSDGRRGDERLVAVGGQPVMPDIPGIEHCISSDGFFELDERPAR  162

Query  308  TLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVESKIEFIRG  366
              V+GA Y+A+E AG ++G+G D  I  R   +LR FD  + S + +  + +  I     
Sbjct  163  VAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQSVLHDAFKRDG-ITLQPH  221

Query  367  AVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTG  426
            +    + K++     +   ++ GD     FD VL ATGR P    L L+  G++L+P  G
Sbjct  222  STVARVDKVDPATGTLSLTTTAGDY-HTGFDCVLVATGRTPMTKHLGLEHRGIELSPN-G  279

Query  427  RIAVTNEQ-TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDYDKVCTAV  484
             I V   Q TS P +FA+GDV++   LTPVAI AGR LA RL+     A  DY  + + V
Sbjct  280  FIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTSIPSVV  339

Query  485  FTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRN  544
            F+    G  GL+E+ + + + ED++++Y   F  + +SL        +  +K+IC     
Sbjct  340  FSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTAMKLICVGPTE  399

Query  545  KHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            K +VG H +G  A E+ Q  G+A+K+G    D+   + IHPT AE   TL
Sbjct  400  K-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>CCI11048
Length=496

 Score = 242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 160/466 (34%), Positives = 241/466 (52%), Gaps = 28/466 (6%)

Query  145  KEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIH-------  197
            + AA YG KV +++  +   G    G GGTCVN GC+PKK+M+ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHREYDGA---GYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  198  -----KDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  252
                 K+ A+  +S G+  FDW +M    ++YI+ +N  Y   L + K+     +   + 
Sbjct  79   RPFTSKECASHSFSFGD--FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIA  136

Query  253  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIG  312
               +++            + ++IAVGG P   S  G E AI SD  F  +  P K  V+G
Sbjct  137  KDRVQV----NQDSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  313  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQS  371
            A Y+A+E AG    +  D  +  R   +LR FD  +   + E ME +  + F+R +  + 
Sbjct  193  AGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKDG-VNFVRKSHLEK  251

Query  372  ITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-  430
            ITK +  +L +     + +     FD ++ A GR P    L L+ VGV LN +TG I V 
Sbjct  252  ITKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALN-ETGHIIVD  310

Query  431  TNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-ALMDYDKVCTAVFTPI  488
              E TSVP ++A+GDV     ELTPVAI AGR LA RL+NNE  A + Y ++ T VF+  
Sbjct  311  AQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHP  370

Query  489  EYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVV  548
              G  G +E  +I K+GE+ ++ Y   F  L +S++ D +      +K++C  ++   VV
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTAMKLVCVGSKET-VV  429

Query  549  GFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            G H  G  A E+ Q  G+AMK+G T  D  N+V IHPT +E   T+
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PYIW_25301
Length=512

 Score = 241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 170/494 (34%), Positives = 264/494 (53%), Gaps = 41/494 (8%)

Query  129  YDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            YD +VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  188  QSSLIGETIHKDAAAFGWS------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKK  240
             ++ +   +H+DA  +G+       +G+   F W ++ +  ++YI  +N  Y+  L + K
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  241  VKYENLLGSFV-DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIF  299
            V    L G+ V +AH     + +   K +  ++++IAVGG+P      G EL I SD  F
Sbjct  151  VDL--LTGTAVFNAH----GNVEMDGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFF  204

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVE  358
              ++ P K  V+GA Y+A+E AG + G+G +  I  R   +LR FD+ +   + + M  +
Sbjct  205  ELEQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  359  SKIEFIRGAVPQS-ITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSV  417
              +  +R   PQS + ++E      K +          FDTV+ A GR P  ++LNL + 
Sbjct  265  GIV--VR---PQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSAA  319

Query  418  GVQLNPKTGRIAVTNEQ-TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALM  475
            G+  + K G I V   Q TS  N+FA+GDV     LTPVAI AGR L+ RL+     A +
Sbjct  320  GIATD-KHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAKI  378

Query  476  DYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC--  533
             YD + T VF+    G  GL+E  + EK G+ +++ Y   F  + + L +D  A G+   
Sbjct  379  SYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAKP  438

Query  534  ----YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAE  589
                 +K++C   +++ VVG H +G  A E+ Q  G+A+K+G T  D  N V IHPT  E
Sbjct  439  KPMTAMKLVC-LGKDEKVVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAGE  497

Query  590  IFTTLEVTKSSGES  603
               T+     +G+S
Sbjct  498  ELVTMAPWGLNGQS  511

>PHYSO_254571
Length=489

 Score = 240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 167/495 (34%), Positives = 251/495 (51%), Gaps = 53/495 (11%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKK  184
            T +YD +VIG GSGG+A ++ AA Y G +V V++  +         LGGTCVNVGC+PKK
Sbjct  13   TTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKK  63

Query  185  LMHQSSLIGETIHKDAAAFGWS-------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVEL  236
            LM  ++ +   +H D   +G+        +G++  FDW ++    ++Y+  +N  Y+  L
Sbjct  64   LMFIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNL  123

Query  237  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSD  296
             + KV        F D   +E+       K +  ++V+IAVGG+P      G EL I SD
Sbjct  124  ANSKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSD  178

Query  297  DIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFD-------QDMA  348
              F  +  P K  V+GA Y+A+E AG +  +G D  I  R   +LR FD       +D  
Sbjct  179  GFFELETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAM  238

Query  349  SKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPD  408
            +K G  +   S I  +  A   + T           V +DG      +D V+ A GR P 
Sbjct  239  AKDGVHLRPHSNIARVEKADDGTKT----------LVLADGSEY-SGYDVVIYAAGRVPL  287

Query  409  VAKLNLDSVGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRL  467
             + L LD  GV  + K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL
Sbjct  288  TSNLQLDKAGVDTD-KNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRL  346

Query  468  YNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD  526
            +   + A + Y+ + T VF+    G  GL+EE +  K+G+D++++Y   F  + + L ++
Sbjct  347  FGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINE  406

Query  527  RQAAG-------SCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
               A           +K++C   + + VVG H +G  A E+ Q  G+A+K+G T  D  N
Sbjct  407  MDEATGEPKDKPKTAMKLVC-AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDN  465

Query  580  VVGIHPTTAEIFTTL  594
             V IHPT  E   TL
Sbjct  466  CVAIHPTAGEELVTL  480

>SPRG_05609
Length=496

 Score = 240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 172/480 (36%), Positives = 255/480 (53%), Gaps = 33/480 (7%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IVIGGGSGG + ++ AA YG KV +++    + G    G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIERGHANDGA---GMGGTCVNVGCVPKKIMFN  62

Query  189  SSLIGETIHKDAAAFGW----SVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYE  244
            ++L  E +H  A A+ +     V    FDWA + K  ++Y+  +N  Y+  L + ++   
Sbjct  63   AALHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLV  121

Query  245  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEA  304
                 FVD HT+E+     G +  T + ++IAVGG P      G E AISSD  F  +  
Sbjct  122  YGAAKFVDNHTVEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALETQ  176

Query  305  PGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEF  363
            P K  V+GA Y+A+E AG    +  D  +  R + +LR FD  +   +   ME  + + F
Sbjct  177  PRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGVHF  235

Query  364  IRGAVPQSITKLESGQLLVKWVSSDGD-----ICEEAFDTVLNATGRDPDVAKLNLDSVG  418
            +R +   SI K   G     +    GD          F+TVL A GR P    L L++  
Sbjct  236  VRESGITSIEKAVDG-----YADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTD  290

Query  419  VQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNE-TALMD  476
            + L+          E TSVPN++A+GDV     ELTPVAI AGR LA RL+ NE  A ++
Sbjct  291  IALSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACIN  350

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSS--DRQAAGSCY  534
            Y ++ T VF+    G  GL+E  +I ++G + +++Y  +F  + +++S   D+Q      
Sbjct  351  YHQIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA---  407

Query  535  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            +K+IC     + VVG H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  408  MKLIC-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PYAP_23435
Length=951

 Score = 249 bits (635),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 185/509 (36%), Positives = 267/509 (52%), Gaps = 35/509 (7%)

Query  104  FFGKD----ESPTP----TMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVC  155
            F+ KD    E  TP    +  AA  + D V   YD +VIGGGSGG+A ++ AA YG KV 
Sbjct  441  FYNKDSATYERLTPENFHSAFAASRLTDMV---YDYVVIGGGSGGMASARRAATYGAKVL  497

Query  156  VLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDA------AAFGWSVGE  209
            +++  +   G    GLGGTCVN GC+PKK+M  ++   E + ++       A   +  G+
Sbjct  498  LVERGRAHDG---MGLGGTCVNYGCVPKKVMFNAAAHVEHLARNGDYSINTAPKAFEFGD  554

Query  210  QKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVT  269
              FDWA M    ++YI  +N  Y+  + +  +     + + V ++ +E+       K  T
Sbjct  555  --FDWANMKTKRDAYILRLNGIYERNVGNAGIDLVQGVATLVSSNQIEV-----DGKVFT  607

Query  270  TRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGY  329
             + V++AVGG P   +  G E AI SD  F  +  P K  V+GA Y+A+E AG    +  
Sbjct  608  GKHVLVAVGGVPAMPAIPGIEHAIDSDGFFKLESQPKKVAVVGAGYIAVEIAGIFNTLKS  667

Query  330  DVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSD  388
            +  +  R   +LR FD  +   + E ME +  + F+R +  + I K   G+L +      
Sbjct  668  ETFLFCRYDQVLRAFDPYVRDLVNEEME-KHGVNFVRRSRIEKIEKQADGKLTIHAKVDG  726

Query  389  GDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-TNEQTSVPNIFAIGDVI  447
             D   E FD VL A GR+P    L LD  GV+LN   G I V   E TSVP ++AIGD  
Sbjct  727  QDQTLEGFDEVLFAIGREPRTRGLGLDKAGVKLN-DGGFIEVDAQENTSVPGVYAIGDAT  785

Query  448  DAP-ELTPVAIQAGRMLARRLYNNET-ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFG  505
                ELTPVAI AGR LA RL+ NE  A + Y ++ T VF+    G  G +E  ++ KFG
Sbjct  786  TTGWELTPVAIAAGRRLADRLFGNEPDACLHYHQIPTVVFSHPPLGTIGYTEPEAVAKFG  845

Query  506  EDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIG  565
             DK+++Y   F  L  S++ D +  G   +K++C    ++ VVG H  G  A E+ Q  G
Sbjct  846  ADKVKVYTSKFVNLLHSMA-DPENKGKTAMKLVC-VGDDEVVVGLHVAGEGADEMVQGFG  903

Query  566  LAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            +AMK+  T  D  N+V IHPT AE F T+
Sbjct  904  VAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>PHALS_08068
Length=497

 Score = 239 bits (610),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 160/502 (32%), Positives = 257/502 (51%), Gaps = 39/502 (8%)

Query  112  TPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWG  170
            T  +  A  V  ++  +YD +VIG GSGG+A ++ AA Y G +V +++  +         
Sbjct  7    TLRLARAFSVSRHLQTEYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------  57

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIH--------KDAAAFGWSVGEQKFDWAQMLKSVN  222
            LGGTCVNVGC+PKKLM+ ++ +   +H        +DAA  G       F+W+++    +
Sbjct  58   LGGTCVNVGCVPKKLMYIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRD  117

Query  223  SYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK  282
            +Y+  +N  Y+  L + KV        F +   +E+       K V  + ++IAVGGRP 
Sbjct  118  AYVLRLNEIYETNLANSKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPL  172

Query  283  PLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLR  341
                 G EL I SD  F  +  P K  ++GA Y+A+E AG +  +G    +  R   +LR
Sbjct  173  IPDIPGKELCIDSDGFFELETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLR  232

Query  342  GFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLN  401
             FD  + + + E M  +         V +     +  + LV    S+       FD V+ 
Sbjct  233  SFDNILRTTLEEAMANDGVHLRPNSTVARVKEAADGTKTLVLTNGSE----HRGFDVVIC  288

Query  402  ATGRDPDVAKLNLDSVGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPELTPVAIQAG  460
            ATGR P  + LNL+  G+  +   G I V   ++T+  N++A+GDV + P LTPVAI AG
Sbjct  289  ATGRVPLTSTLNLEKAGITTD-DNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAG  347

Query  461  RMLARRLYNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
            R L+ RL+   + A + Y+ + T +F+    G  GL+EE + +K+G++ +++Y   F  +
Sbjct  348  RRLSDRLFGGMKDAKLSYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNM  407

Query  520  EWSLSSDR-QAAG------SCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGF  572
             + L ++  +A G         +K++C   + K VVG H +G  A E+ Q  G+A+K+G 
Sbjct  408  YYGLINETIEATGVPKEKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGA  466

Query  573  TYDDMVNVVGIHPTTAEIFTTL  594
            T  D  N + IHPT  E   TL
Sbjct  467  TKADFDNCIAIHPTAGEELVTL  488

>H257_09722
Length=518

 Score = 238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 173/483 (36%), Positives = 256/483 (53%), Gaps = 28/483 (6%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            T  YD IV+GGGSGG++ ++ AA YG  V V++  +   G    GLGGTCVNVGC+PKK+
Sbjct  25   TTSYDYIVLGGGSGGISSARRAASYGANVLVIERGREQGGA---GLGGTCVNVGCVPKKV  81

Query  186  MHQSSLIGETIHKDAAAFGWS----VGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKV  241
            M+ ++   E +H  A A+ +     VG   FDWA M    +SY+  ++  Y+  L    +
Sbjct  82   MYNAAFHAEILH-SAKAYAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNI  140

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWR  301
               +   SFVD HT+ +        T T   +++AVGG P+  S  G E AISSD  F  
Sbjct  141  TLVSGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGL  195

Query  302  KEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRS-ILLRGFDQDMASKIGEFMEVESK  360
            +  P K  VIGA Y+A+E AG    +  +  +  R   +LR FD  +   + + M   S 
Sbjct  196  ETQPKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSG  254

Query  361  IEFIRGAVPQSITKLESGQLLVK--WVSSDGDICEE----AFDTVLNATGRDPDVAKLNL  414
            ++F+  +  QSI K   G L ++    + DG          FD ++ A GR P  +   +
Sbjct  255  VQFVPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-M  313

Query  415  DSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET  472
            +   +  N K G I V   E TSVP ++AIGDV +   ELTPVAI AGR LA RL+  E 
Sbjct  314  EHTTIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEP  372

Query  473  -ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAG  531
             A + Y ++ T VF+    G  G +E  ++ KFG   +++Y  +F  L +S+ +      
Sbjct  373  DACLHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAPENKPK  432

Query  532  SCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            +  +K+IC   + + VVG H  G  A E+ Q  G+A+K+G    D+ N+V IHPT +E F
Sbjct  433  TA-MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEF  490

Query  592  TTL  594
             T+
Sbjct  491  VTM  493

>CCA23647
Length=496

 Score = 238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 239/466 (51%), Gaps = 28/466 (6%)

Query  145  KEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIH-------  197
            + AA YG KV +++  +   G    G GGTCVN GC+PKK+M+ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHREYEGA---GYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  198  -----KDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  252
                 K   +  +S G+  FDW +M    ++YI+ +N  Y   L + K+     +   + 
Sbjct  79   RPFASKGDTSHSFSFGD--FDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIA  136

Query  253  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIG  312
               +++            + ++IAVGG P   S  G E AI SD  F  +  P K  V+G
Sbjct  137  KDRVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  313  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQS  371
            A Y+A+E AG    +  D  +  R   +LR FD  +   + E ME ++ + F+R +  + 
Sbjct  193  AGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEK  251

Query  372  ITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-  430
            I K E  +L +     D       FD ++ A GR P    L L+ VGV+LN +TG I V 
Sbjct  252  IVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELN-ETGHIIVD  310

Query  431  TNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-ALMDYDKVCTAVFTPI  488
              E TS+P ++A+GDV     ELTPVAI AGR LA RL+NNE  A + Y ++ T VF+  
Sbjct  311  AQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHP  370

Query  489  EYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVV  548
              G  G +E  +I K+GE+ ++ Y   F  L +S++ D +      +K++C  ++   VV
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVCVGSKET-VV  429

Query  549  GFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            G H  G  A E+ Q  G+AMK+G T  D  N+V IHPT +E   T+
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>PHYRA_72037
Length=493

 Score = 234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 171/482 (35%), Positives = 258/482 (54%), Gaps = 28/482 (6%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA YG KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--VVIGGGSGGMASARRAATYGAKVLVVERGREFDG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELR  237
            K+M  ++   E +H++       A   ++ G+  FDWA M K  ++YI  +N  Y+  L 
Sbjct  59   KVMFNAAAHVEHLHRNEDYSIKTATRDFAFGD--FDWANMKKKRDAYILRLNGIYERNLG  116

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
            + KV +   + + V    +E+       K  T + V++A GG P      G E    SD 
Sbjct  117  NAKVDHVQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDG  171

Query  298  IFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFME  356
             F  ++ P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + + ME
Sbjct  172  FFRLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME  231

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICE-EAFDTVLNATGRDPDVAKLNLD  415
             ++ ++F+R      + K + G+L    V+ DG+  +   FD +L A GR+P    L L+
Sbjct  232  -KAGVKFVRNTRAVRVDKQDDGKLTF-VVTVDGEEQKFPDFDVILYAIGREPRTKDLGLE  289

Query  416  SVGVQLNPKTGRIAV-TNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-  472
             VGV+L    G I V   E TSVP ++AIGD      ELTPVAI AGR L+ RL+  E  
Sbjct  290  KVGVKL-ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  473  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS  532
            A ++Y ++ T +F+    G  G +E  ++ KFGE+ +++Y   F  L  S++ D +  G 
Sbjct  349  ACLNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMA-DPERKGK  407

Query  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFT  592
              +K++      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   
Sbjct  408  TAMKLVT-VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELV  466

Query  593  TL  594
            T+
Sbjct  467  TM  468

>PHYCA_504517
Length=493

 Score = 234 bits (598),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 168/481 (35%), Positives = 258/481 (54%), Gaps = 26/481 (5%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA YG KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATYGAKVLVVERGREFDG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELR  237
            K+M  ++   E ++++       A   +  G+  FDW  M    ++YIK +N  Y+  L 
Sbjct  59   KVMFNTAAHVEHLNRNKDYSINTADKEFQFGD--FDWNNMKIKRDAYIKRLNGIYERNLG  116

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
            +  V +   +   V    +++     G K  T + V++A GG P      G E  I SD 
Sbjct  117  NANVDHVQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDG  171

Query  298  IFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFME  356
             F  ++ P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME
Sbjct  172  FFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME  231

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
             ++ ++F+R      + K ++G+L      +  +     FDT+L A GR+P    L L+ 
Sbjct  232  -KAGVKFVRNMRAARVEKQDNGKLTFVVTINGEEQKFPDFDTILYAVGREPRTKDLGLEE  290

Query  417  VGVQLNPKTGRIAV-TNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNET-A  473
            VGV+L+ + G I V   E TSVP ++AIGD  +   ELTPVAI AGR L+ RL+  E  A
Sbjct  291  VGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDA  349

Query  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC  533
             ++Y ++ T +F+    G  G +E  ++EK+GE+ +++Y   F  L  S+ +D +  G  
Sbjct  350  CLNYHQIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSM-ADPERKGKT  408

Query  534  YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTT  593
             +K++      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   T
Sbjct  409  AMKLVT-VGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  594  L  594
            +
Sbjct  468  M  468

>PPTG_09787
Length=493

 Score = 234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 169/482 (35%), Positives = 264/482 (55%), Gaps = 28/482 (6%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA +G KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATFGAKVLVVERGREFDG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELR  237
            K+M  ++   E ++++       A+  +  G+  FDW  M    ++YIK +N  Y+  L 
Sbjct  59   KVMFNTAAHVEHLNRNKDYSINTASKDFEFGD--FDWGNMKTKRDAYIKRLNGIYERNLG  116

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
            + KV +   +   V    +E+       +  T + V++A GG P      G E  I SD 
Sbjct  117  NAKVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDG  171

Query  298  IFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFME  356
             F  ++ P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME
Sbjct  172  FFKLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME  231

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEA-FDTVLNATGRDPDVAKLNLD  415
             ++ ++F+R +    + K E+G+L    V+ +G+  + A FDT++ A GR+P    L L+
Sbjct  232  -KAGVKFVRNSRAVRVEKQENGKLTF-VVTVNGEEQKFADFDTIVFAIGREPRTKDLGLE  289

Query  416  SVGVQLNPKTGRIAV-TNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNET-  472
             +GV+L+ + G I V   E TSVP ++AIGD  +   ELTPVAI AGR L+ RL+  E  
Sbjct  290  EIGVKLS-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  473  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS  532
            A ++Y ++ T +F+    G  G +E  +I K+GE+ +++Y   F  L  S++ D +  G 
Sbjct  349  ACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMA-DPERKGK  407

Query  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFT  592
              +K++      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   
Sbjct  408  TAMKLVT-VGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELV  466

Query  593  TL  594
            T+
Sbjct  467  TM  468

>H310_14447
Length=501

 Score = 233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 168/480 (35%), Positives = 257/480 (54%), Gaps = 24/480 (5%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            N +YDY  IV+GGGSGG++ +  A +YG KV V++  + + G    G+GGTCVNVGC+PK
Sbjct  6    NTSYDY--IVVGGGSGGVSSASRAVEYGAKVLVIERGRVNGGA---GMGGTCVNVGCVPK  60

Query  184  KLMHQSSLIGETIHKDAAAFGW----SVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDK  239
            K+M+ + +  E +H  A  + +    +V    FDWA M    ++Y+  ++  Y+  L ++
Sbjct  61   KIMYNAGVHAEILHS-AKDYSFKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEE  119

Query  240  KVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIF  299
             + +      FVD HT+E+       +  T   ++IAVGG P+  +  G E A+SSD  F
Sbjct  120  NIDHVIGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFF  174

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVE  358
                 P K  V+GA Y+A+E AG    +  D  +  R + +LR FD  +   + + M  +
Sbjct  175  DLPTQPKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AK  233

Query  359  SKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEE--AFDTVLNATGRDPDVAKLNLDS  416
            + + F+  A  +SI K   G L V  V+  G+   E   FD +++A GR P    + LD 
Sbjct  234  AGVAFVTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDK  291

Query  417  VGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-AL  474
              V+L+     +    E T+V  ++AIGDV     ELTPVAI AGR LA RL+  ET A 
Sbjct  292  THVELSDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNAC  351

Query  475  MDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCY  534
            + Y ++ T VF+    G  GL+E  +I K+G D + +Y   F+ + ++L++         
Sbjct  352  IHYHQIPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTA  411

Query  535  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            +K++C       V+G H  G  A E+ Q  G+A+KLG    D  NVV IHPT AE   T+
Sbjct  412  MKLVCIGVEET-VIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>PHYSO_550665
Length=491

 Score = 232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 169/481 (35%), Positives = 254/481 (53%), Gaps = 26/481 (5%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA YG KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--VVIGGGSGGMASARRAATYGAKVLVVERGREFEG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELR  237
            K+M  ++   E + ++       AA  +  G+  FDWA M    ++YIK +N  Y+  L 
Sbjct  59   KVMFNAAAHVEHLARNKDYSINTAAKDFEFGD--FDWANMKTKRDAYIKRLNGIYERNLG  116

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
            + +V +   +   V    +E+       K  T + V++A GG P      G E  I SD 
Sbjct  117  NAQVDHVQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDG  171

Query  298  IFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFME  356
             F  ++ P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME
Sbjct  172  FFKLEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME  231

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
             ++ ++F+R      + K   G+L      +  +     FD +L A GR+P    L L+ 
Sbjct  232  -KAGVKFVRNMRAARVEKQADGKLTFVVTINGEEHKFPDFDAILYAVGREPRTKDLGLEE  290

Query  417  VGVQLNPKTGRIAV-TNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNET-A  473
            VGV+L+ + G I V   E TSVP ++AIGD  I   ELTPVAI AGR L+ RL+  E  A
Sbjct  291  VGVKLS-EGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDA  349

Query  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC  533
             ++Y ++ T +F+    G  G +E  ++ K+GE+ ++ Y   F  L  S+ +D +  G  
Sbjct  350  CLNYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSM-ADPERKGKT  408

Query  534  YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTT  593
             +K++      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   T
Sbjct  409  AMKLVT-VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  594  L  594
            +
Sbjct  468  M  468

>PHYKE_10327
Length=1200

 Score = 243 bits (619),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 169/511 (33%), Positives = 257/511 (50%), Gaps = 53/511 (10%)

Query  110  SPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTT  168
            S  P +  A      +  +YD +VIG GSGG+A ++ AA Y G +V V++  +       
Sbjct  8    SRVPHLARALSASRALQTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR-------  60

Query  169  WGLGGTCVNVGCIPKKLMHQSSLIGETIH--------KDAAAFGWSVGEQKFDWAQMLKS  220
              LGGTCVNVGC+PKKLM  ++ +G  +H        +DAA+ G      +FDWA++   
Sbjct  61   --LGGTCVNVGCVPKKLMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTR  118

Query  221  VNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR  280
             ++Y+  +N  Y+  L + KV+      +F D   + +       K V  ++V+IAVGG+
Sbjct  119  RDAYVLRLNGIYERNLANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGK  173

Query  281  PKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-L  339
            P      G EL I SD  F  +  P K  V+GA Y+A+E AG +  +G D  I  R   +
Sbjct  174  PMIPDIPGKELCIDSDGFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGV  233

Query  340  LRGFD-------QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDIC  392
            LR FD       +D   K G  ++  S I  +  A   + T           V +DG   
Sbjct  234  LRTFDGIVRTTLEDAMKKDGVHLQRHSNIARVNQAADGTKT----------LVLADGSE-  282

Query  393  EEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPE  451
               +D V+ A GR P  + L LD  G+  + K G I V   ++TS   + A+GDV   P 
Sbjct  283  HSGYDVVIYAAGRVPLTSTLKLDKAGIATD-KNGFIQVNKFQETSNSKVLAVGDVCGTPA  341

Query  452  LTPVAIQAGRMLARRLYNNE-TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLE  510
            LTPVAI AGR L+ RL+     A + Y+ + T VF+    G  GL+EE + +K+G+D ++
Sbjct  342  LTPVAIAAGRRLSDRLFGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIK  401

Query  511  IYHQNFTPLEWSL-------SSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQA  563
            +Y   F  + + L       + + +      +K++C   +++ VVG H +G  A E+ Q 
Sbjct  402  VYTSRFVNMYYGLINEMDETTGEPKDKPKTAMKLVC-AGKDEKVVGLHMIGMAADEILQG  460

Query  564  IGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
             G+A+K+G T  D  N + IHPT  E   TL
Sbjct  461  FGVAVKMGATKADFDNCMAIHPTAGEELVTL  491

>PITG_14083
Length=493

 Score = 230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 169/482 (35%), Positives = 260/482 (54%), Gaps = 28/482 (6%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA YG KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATYGAKVLVVERGREFDG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELR  237
            K+M  ++   E ++++       A+  +  G+  FDWA M    ++YIK +N  Y+  L 
Sbjct  59   KVMFNAAAHVEHLNRNKDYSINTASKDFEFGD--FDWANMKTKRDAYIKRLNGIYERNLG  116

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDD  297
            + KV +   +   V    +E+       +  T + V++A GG P      G E  I SD 
Sbjct  117  NAKVDHVQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDG  171

Query  298  IFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFME  356
             F  ++ P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME
Sbjct  172  FFKLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME  231

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICE-EAFDTVLNATGRDPDVAKLNLD  415
             ++ + F+R +    + K ++G+L    V+ DG+  +   FD+++ A GR P    L L+
Sbjct  232  -KAGVNFVRNSRAVRVEKQDNGKLTY-VVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLE  289

Query  416  SVGVQLNPKTGRIAV-TNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNET-  472
             VGV+L  + G I V   E TSV  ++AIGD  +   ELTPVAI AGR L+ RL+  E  
Sbjct  290  EVGVKL-AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKD  348

Query  473  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS  532
            A ++Y ++ T +F+    G  G +E  +I K+GE+ +++Y   F  L  S++ D +  G 
Sbjct  349  ACLNYHQIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSMA-DPERKGK  407

Query  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFT  592
              +K++      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   
Sbjct  408  TAMKLVT-VGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELV  466

Query  593  TL  594
            T+
Sbjct  467  TM  468

>H257_17037
Length=498

 Score = 228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 157/462 (34%), Positives = 240/462 (52%), Gaps = 26/462 (6%)

Query  144  SKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAF  203
            +  A +YG KV V++  + + G    G+GGTCVNVGC+PKK+M+ +    E +H   +A 
Sbjct  23   ASRAVEYGAKVLVIERGRANGGA---GMGGTCVNVGCVPKKIMYNAGFHAEILH---SAK  76

Query  204  GWSVGE------QKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLE  257
             +S  E        FDWA M    ++Y+  +   Y+  L ++ + +     +FVD HT+E
Sbjct  77   DYSFKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVE  136

Query  258  LWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVA  317
            +     G +  T   ++IAVGG P+  +  G E AISSD  F     P K  V+GA Y+A
Sbjct  137  V----NGLR-FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPTQPKKVAVVGAGYIA  191

Query  318  LECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLE  376
            +E AG    +  D  +  R   +LR FD  +   + + M  +S + F+  +  QSI K  
Sbjct  192  VELAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEA  250

Query  377  SGQLLVKWVSSDGDICEE--AFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQ  434
             G L +  V++  DI  E   F+ +++A GR P    + LD   V+L+     +    E 
Sbjct  251  DGTLTI--VATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQEN  308

Query  435  TSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNE-TALMDYDKVCTAVFTPIEYGC  492
            T+VP ++AIGD  I   ELTPVAI AGR LA RL+ +E  A + Y ++ T +F+    G 
Sbjct  309  TTVPGVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGT  368

Query  493  CGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHY  552
             GL+E  +I K+G+  +  Y  +F+ L +SL           +K++C       VVG H 
Sbjct  369  IGLTEPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVCIGVEET-VVGAHV  427

Query  553  LGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
             G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  428  AGLGADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PHYRA_71927
Length=485

 Score = 226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 158/493 (32%), Positives = 250/493 (51%), Gaps = 53/493 (11%)

Query  128  DYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +YD +VIG GSGG+A ++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  11   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  61

Query  187  HQSSLIGETIHKDAAAFGWS-------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRD  238
              ++ +   +  D   +G+        +G++  FDW ++    ++Y+  +N  Y+  L +
Sbjct  62   FIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  121

Query  239  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDI  298
             KV+  +    F +   +E+       K +  ++V++AVGG+P      G EL I SD  
Sbjct  122  SKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSDGF  176

Query  299  FWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFD-------QDMASK  350
            F  +  P K  V+GA Y+A+E AG +  +G D  I  R   +LR FD       +D  +K
Sbjct  177  FELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAMAK  236

Query  351  IGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVA  410
             G  +   S +  +      + T           V +DG      +D V+ A GR P  +
Sbjct  237  DGVHLRPHSNVTRVEQVADGTKT----------LVLADGS-EHSGYDVVIYAAGRVPLTS  285

Query  411  KLNLDSVGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYN  469
             L LD+  +  + K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+ 
Sbjct  286  NLQLDNADIATD-KHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFG  344

Query  470  N-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD-R  527
              + A + Y+ + T VF+    G  GL+EE +  ++G+D  ++Y   F  + + L ++  
Sbjct  345  GMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINEVD  404

Query  528  QAAGS------CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVV  581
            +A G         +K++C   + + VVG H +G  A E+ Q  G+A+K+G T  D  N +
Sbjct  405  EATGEPKDKPKTAMKLVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCI  463

Query  582  GIHPTTAEIFTTL  594
             IHPT  E   TL
Sbjct  464  AIHPTAGEELVTL  476

>PPTG_18033
Length=500

 Score = 226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 157/487 (32%), Positives = 247/487 (51%), Gaps = 41/487 (8%)

Query  128  DYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +YD +VIG GSGG+A ++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  187  HQSSLIGETIHKDAAAFGW---SVGEQ-----KFDWAQMLKSVNSYIKSINFKYKVELRD  238
              ++ +   +  D   +G+   + GE       FDW ++    ++Y+  +N  Y+  L +
Sbjct  77   FIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLAN  136

Query  239  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDI  298
             KV+       F +   +E+       K +  ++V+IAVGG+P      G EL I SD  
Sbjct  137  SKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPGKELCIDSDGF  191

Query  299  FWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEV  357
            F  +  P K  V+GA Y+A+E AG +  +G D  I  R   +LR FD  + + + + M V
Sbjct  192  FELEILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAM-V  250

Query  358  ESKIEFIRGAVPQS-ITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
            +  +       P S + ++E      K V          +D V+ A GR P  + L LD 
Sbjct  251  KDGVHL----RPHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTSNLQLDK  306

Query  417  VGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETAL  474
             GV  + + G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+     + 
Sbjct  307  AGVTTD-EHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNSK  365

Query  475  MDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSL-------SSDR  527
            + Y+ + T VF+    G  GL+E+ +  K+G+D +++Y   F  + + L       + + 
Sbjct  366  VSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTGEP  425

Query  528  QAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTT  587
            +      +K++C   + + VVG H +G  A E+ Q  G+A+K+G T  D  N + IHPT 
Sbjct  426  KDKPKTAMKLVC-VGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  484

Query  588  AEIFTTL  594
             E   TL
Sbjct  485  GEELVTL  491

>HYAP_08763
Length=473

 Score = 224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/466 (33%), Positives = 238/466 (51%), Gaps = 30/466 (6%)

Query  141  LACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM--------HQSSLI  192
            +A ++ AA YG KV V++  +   G    GLGGTCVN GC+PKK+M        H +   
Sbjct  1    MASARRAATYGAKVLVIERGRQYDG---MGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAK  57

Query  193  GETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  252
              +IH    AFG       FDW++M    ++YI  +   Y+  L + +V +   +  FV 
Sbjct  58   DYSIHTAEFAFG------DFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVA  111

Query  253  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIG  312
             + +++       +  T + V+IA GG P      G    I SDD F  ++ P K  V+G
Sbjct  112  KNKVQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQPQKVAVVG  166

Query  313  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQS  371
            A Y+A+E AG    +  D  +  R   +LR F+  +   + E ME ++ + F+R      
Sbjct  167  AGYIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVG  225

Query  372  ITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-  430
            + K   G+L +     + +     FDT+L A GR P    L L+ +GV+L  + G I V 
Sbjct  226  VEKQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVD  284

Query  431  TNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNET-ALMDYDKVCTAVFTPI  488
              E TSVP ++AIGD  +   ELTPVAI AGR LA RL+  E  A ++Y ++ + +F+  
Sbjct  285  AQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHP  344

Query  489  EYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVV  548
              G  G +E  ++ K+GE+ +++Y   F  L  S+ +D +  G   +K++      + VV
Sbjct  345  PIGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSM-ADPEHKGKTAMKLVT-VGEQETVV  402

Query  549  GFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            G H  G  A E+ Q  G+A+K+  T  D  N+V IHPT +E   T+
Sbjct  403  GVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PHALS_09136
Length=493

 Score = 224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 165/477 (35%), Positives = 252/477 (53%), Gaps = 26/477 (5%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD +VIGGGSGG+A ++ AA  G KV V++  +   G    GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLVVERGREFDG---MGLGGTCVNFGCVPKKVMFN  63

Query  189  SSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVK  242
            +++  E ++++        A  +  G+  FDWA M    ++YI+ +N  Y+  L + +V 
Sbjct  64   TAVHVEHLNRNKDYSINTCAKDFEFGD--FDWANMKTKRDAYIQRLNGIYERNLSNAQVD  121

Query  243  YENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRK  302
                +   V    +++          T + V++A GG P      G E  I SD  F  +
Sbjct  122  VIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFKLE  176

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKI  361
            + P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME ++ +
Sbjct  177  QQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  362  EFIRGAVPQSITKLESGQLLVKWVSSDGDICE-EAFDTVLNATGRDPDVAKLNLDSVGVQ  420
            EF+R      I K    +L    V+ +G+  E   FDT+L A GR P    L L+ +GV+
Sbjct  236  EFVRNMSATRIEKSNDDKLTF-VVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIGVK  294

Query  421  LNPKTGRIAV-TNEQTSVPNIFAIGDV-IDAPELTPVAIQAGRMLARRLYNNET-ALMDY  477
            L    G I V   E T+VP ++AIGDV +   ELTPVAI AGR LA RL+  E  A ++Y
Sbjct  295  L-ADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACLNY  353

Query  478  DKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKV  537
             ++ T +F+    G  G +E  +I +FG++ ++IY   F  L  ++ +D +  G   +K+
Sbjct  354  HQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAM-ADPERKGKTAMKL  412

Query  538  ICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            +      + VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT +E   T+
Sbjct  413  VT-VGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>PHYKE_6836
Length=493

 Score = 218 bits (554),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 166/479 (35%), Positives = 256/479 (53%), Gaps = 30/479 (6%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD +VIGGGSGG+A ++ AA YG KV V++  +   G    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGRKYDG---MGLGGTCVNYGCVPKKVMFN  63

Query  189  SSLIGETIHKD------AAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVK  242
            +++  E + ++       A   +  G+  FDW+ M    ++YI  +N  Y+  L++++V 
Sbjct  64   TAMHVEHLARNRDYSINTAQRDFQFGD--FDWSNMKTKRDAYILRLNGIYERNLQNQQVD  121

Query  243  YENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRK  302
            +   +   V    +++       +  T +++++A GG P      G E  I SD  F  +
Sbjct  122  HVQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLE  176

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKI  361
            + P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + E ME ++ +
Sbjct  177  QQPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGV  235

Query  362  EFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAF---DTVLNATGRDPDVAKLNLDSVG  418
            +F+R +    + K   G+L    V+ DG   EE F   DT+L A GR P    L L+ + 
Sbjct  236  KFVRNSRAVRVEKQTDGKLTF-VVTVDGK--EEKFPDFDTILYAVGRTPRTKDLGLEEIN  292

Query  419  VQLNPKTGRIAV-TNEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-ALM  475
            V+L+ + G I V   E TSV  ++AIGD      ELTPVAI AGR L+ RL+  E  A +
Sbjct  293  VKLS-QDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  476  DYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYV  535
            +Y ++ T +F+    G CG +E  ++EKFG++ ++ Y   F  L  S++ D +  G   +
Sbjct  352  NYHQIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMA-DPERKGKTAM  410

Query  536  KVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            K +      + VVG H  G  A E+ Q  G+AMK+  T  D  N+V IHPT AE   T+
Sbjct  411  K-LVCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>H310_11259
Length=519

 Score = 218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 167/481 (35%), Positives = 251/481 (52%), Gaps = 24/481 (5%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            T  YD IV+GGGSGG+A ++ AA YG KV V++  +        GLGGTCVNVGC+PKK+
Sbjct  26   TTSYDYIVLGGGSGGIASARRAASYGAKVLVVERGRTL---GGAGLGGTCVNVGCVPKKV  82

Query  186  MHQSSLIGETIHK-DAAAFGWSVGEQ--KFDWAQMLKSVNSYIKSINFKYKVELRDKKVK  242
            M+ ++ + E +H      F    G +   FDW  M    ++Y+  ++  Y+  L    + 
Sbjct  83   MYNAAFLAEIMHSAKTYTFKGVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGIS  142

Query  243  YENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRK  302
              + + +FVD HT+ +     G K  T   +++AVGG P+  S  G ELAISSD  F  +
Sbjct  143  LVSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIELAISSDGFFALE  197

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKI  361
              P K  V+GA Y+A+E AG    +  D  +  R   +LR FD  +   + + M   + +
Sbjct  198  TQPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGV  256

Query  362  EFIRGAVPQSITKLESGQLLVKWV--SSDGDICEEAF---DTVLNATGRDPDVAKLNLDS  416
             F+  +   SI K  +G L ++      +G    + F   D V+ A GR P       D 
Sbjct  257  AFVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDR  316

Query  417  VGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNET-A  473
              +  + K G I V   E T+VP ++AIGD      ELTPVAI AGR LA RL+  E  A
Sbjct  317  TDIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDA  375

Query  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC  533
             ++Y ++ T VF+    G  G +E  +I K+G   +++Y  +F  L ++L   +    S 
Sbjct  376  CINYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDMP-ST  434

Query  534  YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTT  593
             +KV+C   + + VVG H  G  A E+ Q  G+A+K+G    D+ NV+ IHPT +E   T
Sbjct  435  AMKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELVT  493

Query  594  L  594
            +
Sbjct  494  M  494

>PITG_13427
Length=463

 Score = 213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 247/485 (51%), Gaps = 44/485 (9%)

Query  141  LACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKD  199
            +A ++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +  D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  200  AAAFGWS-------VGEQ-KFDWAQMLKSVNSYIKSINFKY-KVELRDKKVKYENLLGSF  250
               +G+        +G++  FDW ++    ++Y+  +N  Y +  L + KV+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  251  VDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLV  310
             +   +E+     G K +  ++V+IAVGG+P      G EL I SD  F  +  P K  V
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETLPKKVAV  166

Query  311  IGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVESKIEFIRGAVP  369
            +GA Y+A+E AG +  +G D  +  R   +LR FD  + + + + M  E     +R   P
Sbjct  167  VGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAMAKEGV--HLR---P  221

Query  370  QS-ITKLESGQLLVK-WVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGR  427
             S + ++E G    K  V +DG      +D V+ A GR P  + L LD  G+  + + G 
Sbjct  222  HSNVARVELGADGTKTLVLTDGSKY-SGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGF  279

Query  428  IAVTN-EQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDYDKVCTAVF  485
            I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+     A + Y+ + T VF
Sbjct  280  IPVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVF  339

Query  486  TPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSL-------SSDRQAAGSCYVKVI  538
            +    G  GL+EE +  K+G+D +++Y   F  + + L       + + +      +K++
Sbjct  340  SHPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLV  399

Query  539  CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTLEVTK  598
            C   + + VVG H +G  A E+ Q  G+A+K+G T  D  N + IHPT  E   TL    
Sbjct  400  C-AGKEEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTLAPWG  458

Query  599  SSGES  603
             SG S
Sbjct  459  LSGRS  463

>PYVX_21517
Length=482

 Score = 213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 152/497 (31%), Positives = 250/497 (50%), Gaps = 81/497 (16%)

Query  128  DYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            ++DL+VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  187  HQSSLIGETIHKDAAAFGW--------SVGEQ-KFDWAQMLKSVNSYIKSINFKYKVELR  237
            +  + +   +H+DA  +G+        S+G +  FDW ++ +  ++Y+  +N  Y+  L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  238  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK----PLSCEGGELAI  293
            + KV+       F     +E+     G + V  + V++AVGG+P     P++  G EL I
Sbjct  138  NSKVELLTGTARFNVDGKIEV----DGVE-VRAKKVLLAVGGKPLIPDIPVAATGKELCI  192

Query  294  SSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIG  352
             SD  F  ++ P K  V+GA Y+A+E AG +  +G D  I  R   +LR FD   +    
Sbjct  193  DSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS----  248

Query  353  EFMEVESKIEFIRGAVPQSI----------TKLESGQLLVK----WVSSDGDICEEAFDT  398
            +F+  +S+ E +R  +  ++          + +E  +L        V +DG      F++
Sbjct  249  QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADGS-THTGFES  307

Query  399  VLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTN-EQTSVPNIFAIGDVIDAPELTPVAI  457
            V+ A GR P    L LD+ GV  + + G I V   +QT+ P+I A+GD      LTP++ 
Sbjct  308  VIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTPIS-  365

Query  458  QAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFT  517
                               Y+ V T VF+    G  GL+E+ +  KFG+++++IY   F 
Sbjct  366  -------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFV  406

Query  518  PLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDM  577
             + + + ++   AG            ++ +VG H +G  A E+ Q  G+A+K+G T  D+
Sbjct  407  NMYYGVVNELVCAGP-----------DEKIVGLHVIGMGADEMLQGFGVAVKMGATKADL  455

Query  578  VNVVGIHPTTAEIFTTL  594
             + V IHPT AE   T+
Sbjct  456  DSCVAIHPTGAEELVTM  472

>PHYCA_7619
Length=462

 Score = 207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 238/474 (50%), Gaps = 41/474 (9%)

Query  141  LACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKD  199
            +A ++ AA Y G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +H D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  200  AAAFGWS-------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFV  251
               +G+        +G++  FDW ++    ++Y+  +N  Y+  L + KV        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  252  DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVI  311
                +E+       K +   +V+IAVGG+P      G EL I SD  F  +  P K  V+
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETLPKKVAVV  166

Query  312  GASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVESKIEFIRGAVPQ  370
            GA Y+A+E AG +  +G +  I  R   +LR FD  + + + + ME +     +      
Sbjct  167  GAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKDG----VHLCPHS  222

Query  371  SITKLESGQLLVK-WVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIA  429
            ++ ++E      +  V +DG      ++ V+ A GR P    L LD  GV  +   G I 
Sbjct  223  NVVRVEQAADNTRTLVLADGSE-HSGYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQ  280

Query  430  VTN-EQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDYDKVCTAVFTP  487
            V   +QTS  N+FA+GD    P LTPVAI AGR L+ RL+   + A + Y+ + T VF+ 
Sbjct  281  VDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSH  340

Query  488  IEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSL-------SSDRQAAGSCYVKVICD  540
               G  GL+E  +  K+G+D++++Y   F  + + L       + + +      +K++C 
Sbjct  341  PPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVC-  399

Query  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
              +++ VVG H +G  A E+ Q  G+A+K+G T  D  + + IHPT  E   TL
Sbjct  400  AGKDEKVVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PYIR_23431
Length=468

 Score = 193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 144/457 (32%), Positives = 214/457 (47%), Gaps = 43/457 (9%)

Query  145  KEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFG  204
            + AA YG KV V++  +   G    GLGGTCVN GC+PKK+M  +S   E ++++A    
Sbjct  23   RRAATYGAKVLVVERGRKYDG---MGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  79

Query  205  WSVGEQKF-----DWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELW  259
             + G +KF     DWA M    ++YI  +N  Y+  L +  V     +   V  + +E+ 
Sbjct  80   TTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQIEV-  138

Query  260  HPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALE  319
                     T + +++AVGG+P   +  G E  I SD  F  +  P K  V+GA Y+A+E
Sbjct  139  ----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEAQPKKVAVVGAGYIAIE  194

Query  320  CAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESG  378
             AG    +  D  +  R   +LR FD  +   I E  E ++ I F+R +  + I K   G
Sbjct  195  LAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQADG  253

Query  379  QLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVP  438
             L +       +     FDT+L A GR+P    L L+ VGV+L      +    E TSVP
Sbjct  254  TLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENTSVP  313

Query  439  NIFAIGD-VIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSE  497
             I+AIGD  I   ELTP+                          T VF+    G  G +E
Sbjct  314  GIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTIGYTE  348

Query  498  EASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNA  557
              +IEKFG + +++Y   F  L +++ +D    G   +K++        V   H  G  A
Sbjct  349  PQAIEKFGAENVKVYTSKFVNLLYAM-ADPDHKGKTAMKLVTVGEDEVVVG-VHVAGEGA  406

Query  558  GEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
             E+ Q  G+A+K+  T  D  N+V IHPT AE   T+
Sbjct  407  DEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>HYAP_04843
Length=430

 Score = 191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 137/404 (34%), Positives = 212/404 (52%), Gaps = 26/404 (6%)

Query  204  GWSVGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPK  262
            G S+G Q  FDW ++    ++Y++ +N  Y+  L   KV++      F     +E+    
Sbjct  20   GGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGSARFNKQGNVEV----  75

Query  263  KGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAG  322
               K V  ++V+IAVGG+P      G EL I SD  F     P K  VIGA Y+A+E AG
Sbjct  76   -DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTLPKKVAVIGAGYIAVELAG  134

Query  323  FMKGMGYDVKIMVRSI-LLRGFDQDMASKIGEFMEVESKIEFIRGAVPQS-ITKLE-SGQ  379
             +  +G +  I  R   +LR FD  + + + + M ++     +R   P S + ++E +  
Sbjct  135  VLNALGSETSIFCRKEGVLRTFDDIVRTTLEDAMAIDGL--HLR---PNSNVARVEQAAD  189

Query  380  LLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTN-EQTSVP  438
                 V +DG      FD V+ A GR P   KL+LD+ GV  N K G I V   ++TS  
Sbjct  190  GTNTLVLTDGS-AHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYIVVNEFQETSNS  247

Query  439  NIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-ETALMDYDKVCTAVFTPIEYGCCGLSE  497
             +FA+GDV   P LTPVA+ AGR L+ RL+ N + A + Y+ + T VF+    G  GL+E
Sbjct  248  KVFAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTE  307

Query  498  EASIEKFGEDKLEIYHQNFTPLEWSLSSD-RQAAGSCY------VKVICDTTRNKHVVGF  550
            + +  K+G+D +++Y  +F  + + L ++  +A G         +K++C   + K VVG 
Sbjct  308  KQAQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEK-VVGL  366

Query  551  HYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            H +G  A E+ Q  G+A+K+G T  D  N + IHPT +E   TL
Sbjct  367  HMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYAR_17714
Length=444

 Score = 188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 153/474 (32%), Positives = 226/474 (48%), Gaps = 63/474 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IVIGGGSGG+A ++ AA +G KV +++  + + G    GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRANDG---MGLGGTCVNFGCVPKKVMWN  63

Query  189  SSLIGETIHKDAAAFGWSVGEQK---FDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            ++   E + ++A     S  E +   FDWA M    ++YI  +N  Y+  + + K+    
Sbjct  64   AASHVEHLARNADYSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDLIE  123

Query  246  LLGSFV--DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKE  303
             + S    DA T++       T     + +++AVGG P      G E AI SDD F  K 
Sbjct  124  GIASLTAKDAVTVD-----GKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLKT  178

Query  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIE  362
             P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  +   +   M+ +  + 
Sbjct  179  QPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMD-KHGVH  237

Query  363  FIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLN  422
            F+R +   +I K   G+L V+      D     FD VL A GR+P    L L+SVGV+L+
Sbjct  238  FVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKLS  297

Query  423  PKTGRIAVTN-EQTSVPNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNETALMDYDKV  480
               G I V   E TSV  ++AIGD      ELTP                          
Sbjct  298  -DAGFIEVDKFENTSVDGVYAIGDATTTGYELTP--------------------------  330

Query  481  CTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICD  540
                               ++EKFG D +++Y   F  L +++ +D        +K++C 
Sbjct  331  -----------------PEAVEKFGADHVKVYTSTFVNLLYAM-ADPDHKSKTAMKLVC-  371

Query  541  TTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
               N+ VVG H  G  A E+ Q  G+A+K+  T  D  N+V IHPT AE   T+
Sbjct  372  VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYVX_16175
Length=446

 Score = 171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/458 (30%), Positives = 213/458 (47%), Gaps = 63/458 (14%)

Query  145  KEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFG  204
            + AA +G KV +++  + + G    GLGGTCVN GC+PKK+M  ++   E +++      
Sbjct  23   RRAASHGAKVLLVERGRANDGA---GLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSV  79

Query  205  WSVGEQKF-----DWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELW  259
             ++GE+KF     DW  M    ++YI  +N  Y+  L + K+     +   V  + LE+ 
Sbjct  80   TTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLEV-  138

Query  260  HPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALE  319
                  K  T +++++A GG P      G E AI SD  F  ++ P K  V+GA Y+A+E
Sbjct  139  ----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQQPRKVAVVGAGYIAVE  194

Query  320  CAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESG  378
             AG    +  +  +  R   +LR FD  +   +   ME ++ ++F+R +    I KLE G
Sbjct  195  IAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLEDG  253

Query  379  QLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-TNEQTSV  437
            +L +             FDTVL A GR+P  A L L+++GV L+ K G I V   E TS 
Sbjct  254  KLQITAEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQENTSA  312

Query  438  PNIFAIGDVIDAP-ELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLS  496
              ++AIGD      ELTP                                          
Sbjct  313  AGVYAIGDATTTGWELTP------------------------------------------  330

Query  497  EEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPN  556
               ++ K+G + +++Y   F  L  ++ +D    G   +K++      + VVG H  G  
Sbjct  331  -PDAVAKYGAENVKVYTSTFVNLVHAM-ADPDHKGKTAMKLVT-VGAQETVVGVHVAGEG  387

Query  557  AGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            A E+ Q  G+A+KLG T  D  N+V IHPT +E   T+
Sbjct  388  ADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>PYIR_20273
Length=505

 Score = 165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 137/480 (29%), Positives = 218/480 (45%), Gaps = 37/480 (8%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+VIGGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  33   EYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALL  84

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             S+ +  +   D A +G  V E   ++ +M+KS    +K++    +   +  KV Y    
Sbjct  85   HSTHLYHSAQHDFAKYGIEVSEVSMNFGKMMKSKEKAVKTLTGGIEQLFKKNKVTYIKGH  144

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFWRK  302
            G  V  + + +     G +TVT ++++IA G       P P+    G++ + S      K
Sbjct  145  GKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKI-VDSTGALELK  203

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLR---GFDQDMASKIGEFMEVES  359
            + P   +V+GA  + LE     K +G   K+ V   L R   G D ++  +  + ++ + 
Sbjct  204  KVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFTKLLKKQG  261

Query  360  -KIEFIRGAVPQSIT----KLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNL  414
               EF        +      L           + G       D VL ATGR P    L L
Sbjct  262  LGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRPYTNGLGL  321

Query  415  DSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETA  473
            +++G+Q + K GRI+V +  +T +PNIFAIGDVI  P L   A + G   A  +      
Sbjct  322  ENMGIQTD-KFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAETIAGKH-G  379

Query  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC  533
             ++Y+ +   ++T  E    G +EE       + K E    N        +S  +A G  
Sbjct  380  HVNYNAIPGVIYTFPEVASVGKTEE-------QLKEEGVTYNVGKFPMLANSRARAVGEA  432

Query  534  --YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
               VKVI D   +K ++G H +  NAGE+     L M+ G + +D+      HPT +E F
Sbjct  433  DGLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHPTLSEAF  491

>CCA22989
Length=494

 Score = 165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 138/476 (29%), Positives = 228/476 (48%), Gaps = 37/476 (8%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYG-KKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +YDLIVIGGG GG   + +AA+ G K VC+         GT   LGGTC+NVGCIP K +
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCI------ESRGT---LGGTCLNVGCIPSKAL  76

Query  187  HQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENL  246
              SS +  T   D  A G    + + ++ +M+K+    +K +    +   +  KV Y   
Sbjct  77   LHSSHMFHTAQHDFKAIGIEASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKG  136

Query  247  LGSFV--DAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIF  299
             G+ V  D  ++      KG +T+  ++++IA G       P P+  E G + + S    
Sbjct  137  HGTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI-VDSTGAL  195

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASKIGEFMEVE  358
              K  P + +V+GA  + LE     + +G +V ++   + +  G D ++  +  + ++ +
Sbjct  196  VLKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGREFAKTLQKQ  255

Query  359  S-KIEFIRGAVPQSITKLESGQLLVKWVSSD-GDICEEAFDTVLNATGRDPDVAKLNLDS  416
              K +F   A   + TK+   ++ +    +  G+      D VL ATGR P    L L++
Sbjct  256  GFKFKF---ATKVTSTKVNEDRVTITMEDAKGGNETNMECDVVLVATGRRPFTQNLGLEN  312

Query  417  VGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALM  475
            +G+Q + K GRI V N  +T VPNI+AIGDVI  P L   A + G + A  +   +   +
Sbjct  313  LGIQTD-KLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKQGHV  370

Query  476  DYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC--  533
            +Y+ +   ++T  E  C G +EE       + K E    N        +S  +A G    
Sbjct  371  NYNAIPGVIYTFPEVACVGRTEE-------QLKEEGVSYNVGKFPMIANSRARAVGETDG  423

Query  534  YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAE  589
            +VKV+     N  ++G H +  NAGE+     L ++ G + +D+      HPT +E
Sbjct  424  FVKVLAQKD-NDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

>CCI10477
Length=494

 Score = 164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 132/475 (28%), Positives = 228/475 (48%), Gaps = 35/475 (7%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+VIGGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             SS +  T   D  + G  V + + ++ +M+K+    +K +    +   +  KV Y    
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  248  GSFVDAH--TLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFW  300
            G  V  +  ++ L    KG +T+T ++++IA G       P P+  E G++ + S     
Sbjct  138  GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKI-VDSTGALV  196

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASKIGEFMEVES  359
             K  P + +V+GA  + LE     + +G +V ++   + +  G D ++  +  + ++ + 
Sbjct  197  LKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQKQG  256

Query  360  -KIEFIRGAVPQSITKLESGQLLVKWVSSD-GDICEEAFDTVLNATGRDPDVAKLNLDSV  417
             K +F   A   + TK+    + +    +  G+      D VL ATGR P    L L+S+
Sbjct  257  LKFKF---ATRVTSTKVNGDNVTITMEDAKGGNETSMECDVVLVATGRRPFTNGLGLESM  313

Query  418  GVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMD  476
            G+Q + K GRI V +  +T++P+I+AIGDVI  P L   A + G + A  +   +   ++
Sbjct  314  GIQTD-KMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKHGHVN  371

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC--Y  534
            Y+ +   ++T  E  C G +EE       + K E    N        +S  +A G    +
Sbjct  372  YNAIPGVIYTHPEVACVGKTEE-------QLKEEGISYNVGKFPMIANSRARAVGETDGF  424

Query  535  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAE  589
            VKV+     N  ++G H +  NAGE+     L ++ G   +D+      HPT +E
Sbjct  425  VKVLAQKD-NDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

>PYAP_22645
Length=1565

 Score = 168 bits (426),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 138/483 (29%), Positives = 226/483 (47%), Gaps = 27/483 (6%)

Query  117   AAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCV  176
             AA       + +YDL+VIGGG GG   + +AA+ G K   ++        +   LGGTC+
Sbjct  1088  AARAFSSTASSEYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCL  1139

Query  177   NVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVEL  236
             NVGCIP K +  ++ +      D + +G  V + K ++  M+KS    +K++    +   
Sbjct  1140  NVGCIPSKALLHATHMYHAAQHDFSKYGIEVSDVKMNFDGMMKSKEKAVKTLTGGIEGLF  1199

Query  237   RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGEL  291
             +  KV Y    G  V A+ + +     G +T+  ++++IA G       P P+    G++
Sbjct  1200  KKNKVTYVKGFGKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKI  1259

Query  292   AISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASK  350
              + S      K+ P   +VIG   + LE     K +G  V ++     +  G DQ++  +
Sbjct  1260  -VDSTGALELKKVPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKE  1318

Query  351   IGEFMEVES-KIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDV  409
               + ++ +  + EF    V  S    +   L V+  +       EA DTVL ATGR P  
Sbjct  1319  FTKLLKKQGLQFEF-STKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFT  1376

Query  410   AKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLY  468
               L L+ +G+Q + K GRI V N  +T +PNIFAIGDVI  P L   A + G      + 
Sbjct  1377  KGLGLEQMGIQTD-KLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIA  1435

Query  469   NNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQ  528
                   ++YD +   ++T  E    G +E    E+  E+ +  Y+    P+  +  +   
Sbjct  1436  GLH-GHVNYDAIPGVIYTYPEVASVGKTE----EQLKEEGV-AYNVGKFPMMANSRARAV  1489

Query  529   AAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTA  588
             A    +VKVI D T ++ ++G H +  NAGE+     L M+ G   +D+      HPT +
Sbjct  1490  AESDGFVKVIADKTTDR-ILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLS  1548

Query  589   EIF  591
             E F
Sbjct  1549  EAF  1551

>HYAP_12621
Length=501

 Score = 146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 131/481 (27%), Positives = 219/481 (46%), Gaps = 44/481 (9%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYG-KKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            DYDL+VIGGG GG   + +AA+ G K  CV    K         LGGTC+NVGCIP K +
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVESRGK---------LGGTCLNVGCIPSKAL  84

Query  187  HQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENL  246
              S+ +  T   +  ++G        ++ QM+K+    ++++    +      KV Y   
Sbjct  85   LHSTHLLHTAQHEFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  247  LGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFW  300
            +G       + +    ++G  T+T +++++A G       P P+  + G++ + S     
Sbjct  145  VGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGALA  203

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASKIGEFMEVES  359
                P   +V+GA  + LE     K +G  V ++        G D+     + EF+++  
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDK---GAVKEFLKLLK  260

Query  360  K--IEFIRGAVPQSITKLESGQL------LVKWVSSDGDICEEAFDTVLNATGRDPDVAK  411
            K  +EF  G      TK+ + ++      L    ++ GD      DTVL ATGR    A 
Sbjct  261  KQGLEFQFG------TKVTASEVNGDVVTLTTEPANGGDGSTIKCDTVLVATGRRAFTAG  314

Query  412  LNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN  470
            L L+ +G+Q + K GRI V +  QT VP +FAIGDVI    L   A + G      +   
Sbjct  315  LGLEQMGIQTD-KQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGK  373

Query  471  ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAA  530
                ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+  +  +   A 
Sbjct  374  H-GHVNYGAIPNVIYTFPEFASVGKTE----EELKAEGVE-YNVGKFPMMANSRARTVAE  427

Query  531  GSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEI  590
                VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+      HPT +E 
Sbjct  428  ADGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEA  486

Query  591  F  591
            F
Sbjct  487  F  487

>PHYSO_556052
Length=500

 Score = 140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 198/432 (46%), Gaps = 24/432 (6%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINF  230
            LGGTC+NVGCIP K +  S+ +  T   D  ++G    E K ++ QM+K+    +K++  
Sbjct  68   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVKTLTG  127

Query  231  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  128  GIESLFKKNKVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  187

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  343
              E G++ I S      K  P   +V+GA  + LE     K +G  V ++  +     G 
Sbjct  188  DNEAGKI-IDSTGALSLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  246

Query  344  DQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWV---SSDGDICEEAFDTVL  400
            D++   +  + ++ +  +EF  G     +T  E    +VK     S  GD      DTVL
Sbjct  247  DKESVKEFTKLLKKQG-LEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVL  302

Query  401  NATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQA  459
             ATGR    A L L+ +G+Q + K GRI V +  +T VP IFAIGDVI    L   A + 
Sbjct  303  VATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  361

Query  460  GRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
            G      +       ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+
Sbjct  362  GVACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  415

Query  520  EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
              +  +   A     VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+  
Sbjct  416  MANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGVIGIEYGAASEDLAR  474

Query  580  VVGIHPTTAEIF  591
                HPT +E F
Sbjct  475  TCHAHPTLSEAF  486

>SPRG_19943
Length=343

 Score = 135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 90/238 (38%), Positives = 126/238 (53%), Gaps = 16/238 (7%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD IV+G GSGG++ +  A  YG KV V++    + G    GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGHANDGA---GLGGTCVNVGCVPKKIMFN  77

Query  189  SSLIGETIHKDAAAFGWSVGEQ-----KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKY  243
            ++L  E +H  A A+ +  G Q      FDWA M    ++Y+K +N  Y   + + KV  
Sbjct  78   AALHAEMLHS-ARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  135

Query  244  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKE  303
                  FVD HT+E+     G +  T + ++IAVGG P      G E AISSD  F  + 
Sbjct  136  VMGAAKFVDNHTVEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALET  190

Query  304  APGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMASKIGEFMEVESK  360
             P K  V+GA Y+A+E AG    +  D  +  R + +LR FD  +   +   ME   K
Sbjct  191  QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAGK  248

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 6/86 (7%)

Query  514  QNFTPLEWSL-SSDRQAAG----SCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAM  568
            + F P+   L +S+ + AG       +K++C       VVG H  G  A E+ Q  G+A+
Sbjct  229  RTFDPIVRDLVNSEMEHAGKEKVQTAMKLVCIGVEET-VVGVHVAGLGADEMIQGFGVAV  287

Query  569  KLGFTYDDMVNVVGIHPTTAEIFTTL  594
            K+G    D  N+V IHPT +E   T+
Sbjct  288  KMGAYKSDFDNIVAIHPTASEELVTM  313

>PYVX_21248
Length=502

 Score = 137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 121/433 (28%), Positives = 203/433 (47%), Gaps = 26/433 (6%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINF  230
            LGGTC+NVGCIP K +  S+ +  +   D A +G  V   K +   M+K+    + ++  
Sbjct  70   LGGTCLNVGCIPSKALLHSTHLYHSAQHDFAKYGVEVEGVKANLGGMMKAKEKAVTTLTG  129

Query  231  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGRPKPLS---C  286
              +   +  KV Y    G  V  + + +  +  KG +TVT ++++IA G  P PL     
Sbjct  130  GIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGNQTVTAKNIMIATGSEPAPLPPVPV  189

Query  287  EGGELAI-SSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLR---G  342
            +  +  I  S       + P   +V+GA  + LE     K +G   K+ V   L R   G
Sbjct  190  DNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KVTVVEFLDRACPG  247

Query  343  FDQDMASKIGEFMEVESKIEF-IRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLN  401
             D +++ +  + ++ +  +EF     V  S  K ++  L V+  S+ G       DTVL 
Sbjct  248  LDLEVSKEFTKLLKKQG-LEFQFSTKVTASEVKGDNVTLTVEP-SAGGSAASIECDTVLV  305

Query  402  ATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAG  460
            ATGR P    L L+ +G+Q + K GR+ V +  +T +PNI+A GDVI    L   A + G
Sbjct  306  ATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSHFRTQIPNIYAFGDVIKGAMLAHKAEEEG  364

Query  461  RMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLE--IYHQNFTP  518
               A  + + +   ++YD +   ++T  E    G +EE       E K E   Y+    P
Sbjct  365  VACA-EIISGKHGHVNYDAIPGVIYTTPEVASVGKTEE-------ELKNEGVTYNVGKFP  416

Query  519  LEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMV  578
            +  +  +   A    +VK++ D   ++ ++G H +  NAGE+     L ++ G + +D+ 
Sbjct  417  MMANSRARTIAEADGFVKILADKATDR-ILGVHIIAGNAGEMVAEGVLGLEYGASSEDIA  475

Query  579  NVVGIHPTTAEIF  591
                 HPT +E F
Sbjct  476  RTCHAHPTLSEAF  488

>PHYKE_9680
Length=498

 Score = 133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 117/430 (27%), Positives = 198/430 (46%), Gaps = 24/430 (6%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINF  230
            LGGTC+NVGCIP K +  S+ +  T   D  ++G      K ++ QM+K+    +K++  
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVKANFPQMMKAKEKAVKTLTG  125

Query  231  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
              ++  +  KV Y    G       + +     KG +TV  ++++IA G       P P+
Sbjct  126  GIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPLPPVPV  185

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  343
              E G++ I S      K  P   +V+GA  + LE     K +G  V ++  +     G 
Sbjct  186  DNEAGKI-IDSTGALVLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  244

Query  344  DQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVS---SDGDICEEAFDTVL  400
            D++   +  + ++ +  ++F  G     +T  E    +VK  +     GD      DTVL
Sbjct  245  DKECVKEFTKLLKKQG-LDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASIECDTVL  300

Query  401  NATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQA  459
             ATGR    A L L+ +G+Q + K GR+ V +  +T VP IFAIGDVI    L   A + 
Sbjct  301  VATGRRAYTAGLGLEQMGIQTD-KLGRVEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  359

Query  460  GRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
            G      +       ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+
Sbjct  360  GIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  413

Query  520  EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
              +  +   A     VKV+ D   +K ++G H +  NAGE+     +A++ G + +D+  
Sbjct  414  MANSRARTVAEADGLVKVLSDKKTDK-MLGVHIIASNAGEMIAEGVIALEYGASSEDIAR  472

Query  580  VVGIHPTTAE  589
                HPT +E
Sbjct  473  TCHAHPTLSE  482

>PITG_15359
Length=496

 Score = 133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 135/479 (28%), Positives = 217/479 (45%), Gaps = 36/479 (8%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            + DYD++VIGGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K 
Sbjct  27   SSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKA  78

Query  186  MHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            +  S+ +  T   D  ++G    E K ++ QM+KS    +K++    +   +  KV Y  
Sbjct  79   LLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIESLFKKNKVTYIK  138

Query  246  LLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIF  299
              G       + +  +  KG +TV  ++++IA G       P P+    G++ I S    
Sbjct  139  GHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGAL  197

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVES  359
              K  P   +V+GA  + LE     K +G   K+ V   L           + EF ++  
Sbjct  198  ELKRVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEFLDAACPGSDKEAVKEFTKLLK  255

Query  360  KIEFIRGAVPQSITKLESGQL------LVKWVSSDGDICEEAFDTVLNATGRDPDVAKLN  413
            K    +G   Q  TK+ + ++      L    S  GD      DTVL ATGR    + L 
Sbjct  256  K----QGLDFQFNTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTSGLG  311

Query  414  LDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNET  472
            L+ +G+Q + K GRI V +  +T VP IFAIGDVI    L   A + G      +     
Sbjct  312  LEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-  369

Query  473  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS  532
              ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+  +  +   A   
Sbjct  370  GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPMMANSRARTIAEAD  424

Query  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
              VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+      HPT +E F
Sbjct  425  GLVKVLADKKTDK-LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  482

>PHALS_09942
Length=496

 Score = 131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 125/438 (29%), Positives = 195/438 (45%), Gaps = 36/438 (8%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINF  230
            LGGTC+NVGCIP K +  S+ +  T   +   +G    E   ++ QM+K+ +  +K++  
Sbjct  64   LGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGIDAPEVTANFPQMMKAKDKAVKTLTS  123

Query  231  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
              +   +  KV Y    G       + +  H  KG +TV  ++++IA G       P P+
Sbjct  124  GIESLFKKNKVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPV  183

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSIL---LR  341
                G++ + S      K  P   +V+GA  + LE     K +G   K+ V   L     
Sbjct  184  DNAAGKI-VDSTGALELKRIPDHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDDACT  240

Query  342  GFDQDMASKIGEFMEVESK--IEFIRGAVPQSITKLESGQLLVKWV---SSDGDICEEAF  396
            G D+     + +F+++  K  +EF  G     +T  E    +VK     S  GD      
Sbjct  241  GMDK---GSVKDFIKLLKKQGLEFKFGT---KVTASEINGDVVKLTTEPSQGGDAASIEC  294

Query  397  DTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPV  455
            DTVL ATGR    A L L+ +G+Q + K GRI V    +T VP IFAIGDVI    L   
Sbjct  295  DTVLVATGRRAFTAGLGLEQMGIQTD-KFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHK  353

Query  456  AIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQN  515
            A + G   A  +   +   ++Y  +   ++T  E+   G +EE       E K E    N
Sbjct  354  AEEEGIACA-EIIAGKHGHVNYGAIPGVIYTFPEFASVGKTEE-------ELKAEGIEYN  405

Query  516  FTPLEWSLSSDRQAAGSC--YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFT  573
                    +S  +  G     VKV+ D   +K ++G H +  NAGE+     + ++ G  
Sbjct  406  VGKFPMMANSRARTVGESDGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAA  464

Query  574  YDDMVNVVGIHPTTAEIF  591
             +D+      HPT +E F
Sbjct  465  SEDVARTSHAHPTLSEAF  482

>PYU1_G014259
Length=244

 Score = 125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 117/217 (54%), Gaps = 22/217 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKY-GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            +YD +VIG GSGG+A S+ AA Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  187  HQSSLIGETIHKDAAAFGWS------VGEQ-KFDWAQMLKSVNSYIKSINFKYKVELRDK  239
            + ++ +   +H+DA  +G+       +GE   F W ++ +  ++Y+  +N  Y+  L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  240  KVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIF  299
            KV       +F     +E+       K V  ++++IAVGG+P      G E  I SD  F
Sbjct  145  KVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFF  199

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVR  336
              +  P K  V+GA Y+A+E AG + G+G D  I  R
Sbjct  200  ELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PYAR_20075
Length=469

 Score = 130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 130/472 (28%), Positives = 211/472 (45%), Gaps = 54/472 (11%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+V+GGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  30   EYDLVVVGGGPGGYVAAIKAAQLGLKTACIE--------SRGSLGGTCLNVGCIPSKALL  81

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             S+ +  T   D   +G  V + + D+  M+KS    +K++    +   +  KV Y    
Sbjct  82   HSTHLFHTAQHDFKKYGIEVSDVQMDFGGMMKSKEKAVKTLTAGIESLFKKNKVTYIKGF  141

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGK  307
            G                 K V   +V +A+          G E  + S      K+AP  
Sbjct  142  G-----------------KIVAANEVAVALNDN------NGNETIVDSTGALALKKAPEH  178

Query  308  TLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASKIGEFMEVESKIEFIRG  366
             +VIG   + LE     K +G  V ++     +  G D ++     EF ++  K    +G
Sbjct  179  LVVIGGGVIGLELGSVYKRLGSKVTVVEYADRVCPGLDLELGK---EFAKLLKK----QG  231

Query  367  AVPQSITKLESGQL------LVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420
               Q  TK+ + Q+      L    ++ G+      DTVL ATGR P    L L+ +G+Q
Sbjct  232  LDLQFKTKVTASQVNGDKVTLTVEPAAGGEATTIEADTVLVATGRRPFTNGLGLEQMGIQ  291

Query  421  LNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDK  479
             + K GRI V    +T +P+I+AIGDVI  P L   A + G      +       ++Y+ 
Sbjct  292  TD-KMGRIQVDEHFRTQIPSIYAIGDVIAGPMLAHKAEEEGIACVENIAGLH-GHVNYNA  349

Query  480  VCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVIC  539
            +   ++T  E    G +E    E+  E+ +  Y+    P+  +  +     G  +VKV+ 
Sbjct  350  IPGVIYTHPEVASVGKTE----EQLKEEGIA-YNVGKFPMMANSRARAVGEGDGFVKVLA  404

Query  540  DTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            D T +K ++G H +  NAGE+     L ++ G   +D+      HPT +E F
Sbjct  405  DKTTDK-ILGIHIIASNAGEMISEGVLGIEYGAASEDIGRTCHAHPTLSEAF  455

>PHYCA_123621
Length=495

 Score = 130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 131/477 (27%), Positives = 215/477 (45%), Gaps = 32/477 (7%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            T DYD++VIGGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K 
Sbjct  26   TNDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKA  77

Query  186  MHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            +  S+ +  T   D  ++G    E K ++ QM+K+    + ++    +   +  KV Y  
Sbjct  78   LLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTGGIESLFKKNKVTYIK  137

Query  246  LLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIF  299
              G       + +  +  KG +TV  ++++IA G       P P+    G++ I S    
Sbjct  138  GFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGAL  196

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMASKIGEFMEVE  358
                 P   +V+GA  + LE     K +G  V ++        G D+    +  + ++ +
Sbjct  197  SLTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGMDKGAVKEFTKLLKKQ  256

Query  359  SKIEFIRGAVPQSITKLESGQLLVKWV---SSDGDICEEAFDTVLNATGRDPDVAKLNLD  415
              ++F        +T  E    +VK     S  GD      DTVL ATGR    A L L+
Sbjct  257  G-LDF---KFSTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVLVATGRRAFTAGLGLE  312

Query  416  SVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETAL  474
             +G+Q + K GRI V +  +T VP IFAIGDVI    L   A + G      +       
Sbjct  313  QMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GH  370

Query  475  MDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCY  534
            ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+  +  +   A     
Sbjct  371  VNYGAIPGVIYTFPEFASVGKTE----EELKAEGVE-YNVGKFPMMANSRARTVAEADGL  425

Query  535  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+      HPT +E F
Sbjct  426  VKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  481

>SPRG_09825
Length=492

 Score = 128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 133/484 (27%), Positives = 217/484 (45%), Gaps = 50/484 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            DYDL+V+GGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALL  76

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             ++        D    G  V   + D+A+++ S +  +K +    +   +  KV Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYIKGF  136

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFWRK  302
            G  V  + + +   + G KTV+T++++IA G       P P+  E G++ I S      K
Sbjct  137  GKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALSLK  195

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIE  362
              P   +VIG   + LE       +G  + ++           + A KI   M+ E+  E
Sbjct  196  RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETGRE  244

Query  363  FIRGAVPQSI----------TKLESGQL-LVKWVSSDGDICEEAFDTVLNATGRDPDVAK  411
            F +    Q +          +K+E  ++ L    ++ G+      DTVL ATGR P    
Sbjct  245  FQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFTKG  304

Query  412  LNLDSVGVQLNPKTGRIAV--TNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYN  469
            L L+ +G+Q + K GRI V  +N +T+V NIFAIGD I+   L   A + G      +  
Sbjct  305  LGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAG  363

Query  470  NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQA  529
                 ++Y+ +   V+T  E    G +EE       E K      N        +S  + 
Sbjct  364  GH-GHVNYNAIPGVVYTFPEVASVGKTEE-------ELKAANVAYNVGKFPMMANSRART  415

Query  530  AGSC--YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTT  587
             G    +VK++     +K ++G H +  NAGE+     L ++ G + +D+      HPT 
Sbjct  416  VGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTL  474

Query  588  AEIF  591
            +E F
Sbjct  475  SEAF  478

>SDRG_06945
Length=492

 Score = 127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 132/484 (27%), Positives = 216/484 (45%), Gaps = 50/484 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            DYDL+V+GGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLGLKTACVE--------SRGTLGGTCLNVGCIPSKALL  76

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             ++        D    G  V   + D+A+++ S +  +K +    +   +  K+ Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYIKGF  136

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFWRK  302
            G  V  + + +     G KTV+T++++IA G       P P+  E G++ I S      K
Sbjct  137  GKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALSLK  195

Query  303  EAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEFMEVESKIE  362
              P   +VIG   + LE       +G  + ++           + A KI   M+ E+  E
Sbjct  196  RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETGRE  244

Query  363  FIRGAVPQSI----------TKLESGQL-LVKWVSSDGDICEEAFDTVLNATGRDPDVAK  411
            F +    Q +          +K+E  ++ L    ++ G+      DTVL ATGR P    
Sbjct  245  FQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFTKG  304

Query  412  LNLDSVGVQLNPKTGRIAV--TNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYN  469
            L L+ +G+Q + K GRI V  +N +T+V NIFAIGD I+   L   A + G      +  
Sbjct  305  LGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAG  363

Query  470  NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQA  529
                 ++Y+ +   V+T  E    G +EE       E K      N        +S  + 
Sbjct  364  GH-GHVNYNAIPGVVYTFPEVASVGKTEE-------ELKAAGVAYNVGKFPMMANSRART  415

Query  530  AGSC--YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTT  587
             G    +VK++     +K ++G H +  NAGE+     L ++ G + +D+      HPT 
Sbjct  416  VGETDGFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTL  474

Query  588  AEIF  591
            +E F
Sbjct  475  SEAF  478

>PHYRA_72215
Length=499

 Score = 126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 114/432 (26%), Positives = 195/432 (45%), Gaps = 24/432 (6%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINF  230
            LGGTC+NVGCIP K +  S+ +  T   D  ++G        ++ QM+K+    + ++  
Sbjct  67   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVTANFPQMMKAKEKAVTTLTG  126

Query  231  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  127  GIESLFKKNKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  186

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  343
                G++ I S         P   +V+GA  + LE     K +G  V ++  +     G 
Sbjct  187  DNAAGKI-IDSTGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  245

Query  344  DQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSS---DGDICEEAFDTVL  400
            D++   +  + ++ +  ++F  G     +T  E    +VK  +     G+      DTVL
Sbjct  246  DKEAVKEFTKLLKKQG-LDFKFG---TKVTASEVNGDVVKLTTEAAKGGNAATIECDTVL  301

Query  401  NATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQA  459
             ATGR    A L L+ +G+Q + K GRI V +  +T VP IFAIGDVI    L   A + 
Sbjct  302  VATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  360

Query  460  GRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
            G      +       ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+
Sbjct  361  GIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  414

Query  520  EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
              +  +   A     VKV+ D   +K ++G H +  NAGE+     +A++ G + +D+  
Sbjct  415  MANSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGASSEDIAR  473

Query  580  VVGIHPTTAEIF  591
                HPT +E F
Sbjct  474  TCHAHPTLSEAF  485

>H257_16541
Length=494

 Score = 124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 128/444 (29%), Positives = 195/444 (44%), Gaps = 48/444 (11%)

Query  171  LGGTCVNVGCIPKK-LMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSIN  229
            LGGTC+NVGCIP K L+H + L     H +  + G  V     D+ Q++KS +  +K + 
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHSAQH-NFKSVGIKVDNVSIDFDQLMKSKDKTVKILT  120

Query  230  FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
               +   +  KV Y    G  V    + +     G +TV T++++IA G       P P+
Sbjct  121  GGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATGSEVTPLPPVPV  180

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFD  344
              EGG++ I S      K  P   +V+G   + LE       +G  + ++          
Sbjct  181  DNEGGKI-IDSTGALALKRVPKHLVVVGGGVIGLEMGSVYGRLGSKITVV----------  229

Query  345  QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAF--------  396
             + A KI   M+ E   EF +    Q +T  + GQ  V     DGD+             
Sbjct  230  -EYADKICPTMDHEVTKEFQKLLTKQGMT-FKLGQ-KVTASKVDGDVVTLTVEPAAGGEA  286

Query  397  -----DTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV--TNEQTSVPNIFAIGDVIDA  449
                 D VL ATGR P  A L L+ +G+Q + K GRI V  +N QT+V  IFAIGDVI+ 
Sbjct  287  TTIEADCVLVATGRRPFTAGLGLEEMGIQTD-KFGRIKVNLSNFQTNVDGIFAIGDVIEG  345

Query  450  PELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKL  509
              L   A + G  +   +       ++YD +   ++T  E    G +EE       E K 
Sbjct  346  AMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEE-------ELKT  397

Query  510  EIYHQNFTPLEWSLSSDRQAAGSC--YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLA  567
                 N        +S  +A G    +VKV+     +K ++G H +  NAGE+     L 
Sbjct  398  ANVAYNVGKFPMMANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLG  456

Query  568  MKLGFTYDDMVNVVGIHPTTAEIF  591
            ++ G + +D+      HPT +E F
Sbjct  457  IEYGASAEDIGRTCHAHPTLSEAF  480

>H310_02523
Length=494

 Score = 124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 124/442 (28%), Positives = 192/442 (43%), Gaps = 44/442 (10%)

Query  171  LGGTCVNVGCIPKK-LMHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSIN  229
            LGGTC+NVGCIP K L+H + L     H D  + G  V     D+ Q++KS    +K + 
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSVGIKVDNVSIDFNQLMKSKEKTVKILT  120

Query  230  FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPL  284
               +   +  KV Y    G  V    L +     G +T+ T++++IA G       P P+
Sbjct  121  GGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLPPVPV  180

Query  285  SCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFD  344
              EGG++ + S      K  P   +V+G   + LE       +G  + ++          
Sbjct  181  DNEGGKI-VDSTGALSLKRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV----------  229

Query  345  QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSD-----------GDICE  393
             + A KI   M+ E   EF +    Q +T     ++    V  D           GD   
Sbjct  230  -EYADKICPTMDHELTKEFQKLLTKQGMTFKLGQKVTASKVDGDTVTLTVEPAAGGDATT  288

Query  394  EAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV--TNEQTSVPNIFAIGDVIDAPE  451
               D VL ATGR P  A L L+ +G+Q + + GRI V  +N QT+V  I+AIGDVI+   
Sbjct  289  IEADCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYAIGDVIEGAM  347

Query  452  LTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEI  511
            L   A + G  +   +       ++YD +   ++T  E    G +EE       E K   
Sbjct  348  LAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEE-------ELKAAN  399

Query  512  YHQNFTPLEWSLSSDRQAAGSC--YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMK  569
               N        +S  +A G    +VKV+     +K ++G H +  NAGE+     L ++
Sbjct  400  VAYNVGKFPMMANSRARAVGETDGFVKVLAAKDDDK-ILGIHIIASNAGEMISEGVLGIE  458

Query  570  LGFTYDDMVNVVGIHPTTAEIF  591
             G + +D+      HPT +E F
Sbjct  459  YGASAEDIGRTCHAHPTLSEAF  480

>H310_00561
Length=497

 Score = 124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 132/486 (27%), Positives = 222/486 (46%), Gaps = 48/486 (10%)

Query  125  VTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKK  184
            V  +YDLIVIG G  GL C+ E+AK GK V ++D         +  +GG CV+ G IP K
Sbjct  26   VPKEYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSK  77

Query  185  LMHQS--SLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVK  242
               ++   L G   H     +G S   ++     +L  VN  + S     + +L+   V+
Sbjct  78   TFREAVLHLSGFNHH---GFYGKSYSRERITLRDILHRVNVVVSSEMDVIRAQLKAAHVQ  134

Query  243  YENLLGSFVDAHTLELWHPKKGTKTVTTR--DVVIAVGGRP--KPLSCEGGELAISSDDI  298
                   F +A+ + +     G++    R    +IA G  P   P+    GE+ + SD I
Sbjct  135  IIPGKARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDGI  194

Query  299  F--WRKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQDMASKIGEF  354
                + E P   +V+GA  + +E A  +  + G  V ++  R  +L   D ++ S +   
Sbjct  195  LDASKGELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALK--  252

Query  355  MEVESK-IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLN  413
            ME+  K   F+ G   QS+ ++  G + V + S      E     +L   GR  +   LN
Sbjct  253  MEMRHKGARFLLGETIQSVKRVRKG-VRVDFASGKSSFAE----ALLYCVGRQANTDTLN  307

Query  414  LDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE-  471
            L+ VG+  N K G ++V  + QT+ P+IFA GD I AP L   +++ GR+ A  ++ +E 
Sbjct  308  LEGVGLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHED  366

Query  472  --TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQA  529
              T+ +D       ++T  E    G +E+  + K G +   +    ++ L   + +  Q 
Sbjct  367  QPTSQLDSGNYPYGIYTIPEISMVGKTEQ-QLTKEGRN-YAVGVAKYSELAKGMMAGGQK  424

Query  530  AGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DDMVNVVGIHP  585
                 +K++ D   +  V+G H +G  A E+     + +AM    TY  D + N    +P
Sbjct  425  GA---LKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFN----YP  476

Query  586  TTAEIF  591
            T AE +
Sbjct  477  TLAEAY  482

>H257_01186
Length=496

 Score = 123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 131/483 (27%), Positives = 223/483 (46%), Gaps = 48/483 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDLIVIG G  GL C+ E+AK GK V ++D         +  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  188  QS--SLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            ++   L G   H     +G S   ++   + +L  VN  + S     + +L+   V+   
Sbjct  80   EAVLHLSGFNHH---GFYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIP  136

Query  246  LLGSFVDAHTLELWHPKKGTKTVTTR--DVVIAVGGRP--KPLSCEGGELAISSDDIF--  299
                F +A+ + + +     + +  R    +IA G  P   P+    GE+ + SD I   
Sbjct  137  GKARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGILEA  196

Query  300  WRKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEV  357
             + E P   +V+GA  + +E A  +  + G  V ++  R  +L   D ++ S +   ME+
Sbjct  197  SKGELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALK--MEM  254

Query  358  ESK-IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
              K   F+ G   QS+T++  G + V + S      E     +L   GR  +   LNL+ 
Sbjct  255  RHKGARFLLGETIQSVTRVAKG-VRVDFASGKSSFAE----ALLYCVGRQANTDALNLEG  309

Query  417  VGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE---T  472
            VG+  N K G + V  + QTS P+I+A GD I AP L   +++ GR+ A  ++++E   T
Sbjct  310  VGLAKN-KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQPT  368

Query  473  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGS  532
            + +D       ++T  E    G +E+  + K G +   +    ++ L   + +  Q    
Sbjct  369  SQLDSGNYPYGIYTIPEISMVGKTEQ-QLTKEGRN-YAVGMAKYSELAKGMMAGGQKGA-  425

Query  533  CYVKVICDTTRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DDMVNVVGIHPTTA  588
              +K++ D    + V+G H +G  A E+     + +AM    TY  D + N    +PT A
Sbjct  426  --LKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFN----YPTLA  478

Query  589  EIF  591
            E +
Sbjct  479  EAY  481

>PYU1_G001737
Length=133

 Score = 113 bits (283),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 2/99 (2%)

Query  8    GTKREAT--MATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVLYPDAVDCE  65
            G KR A+  MA+VN+++TLVR G   TYHIAGWRGC F++KA DV  AM+VLYPD +   
Sbjct  11   GRKRHASNLMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQFT  70

Query  66   IHEFPDREAFRAWLsasaadfaanfgadsKAATHTSSPF  104
            +HEF DR+AFRAWL  S  DFA +FGA S A THTSSPF
Sbjct  71   VHEFADRDAFRAWLDVSKDDFATHFGATSPALTHTSSPF  109

>CCA16670
Length=520

 Score = 120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 128/482 (27%), Positives = 223/482 (46%), Gaps = 40/482 (8%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDLIVIG G     C+ +AAK GK V ++D  K S       +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKS------SVGGVCVHTGTIPSKTFRE  81

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKS-INFKYKVELRDKKVKYENLL  247
            + ++  + ++    +G S   +      +L  VN  I+S ++F  + + +  ++ Y +  
Sbjct  82   A-VLHLSGYRHHGFYGKSYSMKHVTIDDILYRVNRVIQSEVDF-LRTQFKSARIDYISGH  139

Query  248  GSFVDAHTLELWHP-----KKGTKTVTTRDVVIAVGGRP--KPLSCEGGELAISSDDIF-  299
              F D H + +        +K TK +     ++A G RP   P     G++   SD I  
Sbjct  140  ARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILS  199

Query  300  WR-KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFME  356
            W  ++ P   +V+GA  + +E A  +  + G+ V ++  R  +L   D ++ S +   M 
Sbjct  200  WNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMR  259

Query  357  VESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDS  416
                  F+ G + +S+ K   G   V      G       D +L   GR  +   LNL++
Sbjct  260  NHGA-RFLLGEIIESVEKSSRG---VSVGLKSGKKVHG--DALLYVVGRQANTDGLNLEA  313

Query  417  VGVQLNPKTGRIAV-TNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALM  475
             G+  NP+ G ++V T  QT  P+IFA+GD I AP L   +++ GR+ +  ++N   A  
Sbjct  314  AGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEA--  370

Query  476  DYDKVCTAVFT-PIEYGCCGLSEEASIEKFGEDKLEIYHQNFT--PLEWSLSSDRQAAGS  532
            + D + + + T    YG   + E + + K  E +L     N+     ++S  +  Q +G+
Sbjct  371  NDDSIPSQLTTGNFPYGIYTIPEISMVGK-TEKELTSLKMNYEIGVAKYSELAKGQMSGA  429

Query  533  C---YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAE  589
                 +K++ D    K + G H +G  A E+     +A+ +G T     + V  +PT AE
Sbjct  430  SADGMLKILFDPISLK-LYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLAE  488

Query  590  IF  591
             +
Sbjct  489  AY  490

>CCI50816
Length=807

 Score = 121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 127/481 (26%), Positives = 221/481 (46%), Gaps = 38/481 (8%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDLIVIG G     C+ +AAK GK V ++D            +GG CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--------KKSSVGGVCVHTGTIPSKTFRE  81

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            + ++  + ++    +G S   +      +L  VN  I+S     +V+ +  +V Y +   
Sbjct  82   A-VLHLSGYRHHGFYGKSYSMKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVDYISGHA  140

Query  249  SFVDAHTLELWHP-----KKGTKTVTTRDVVIAVGGRP--KPLSCEGGELAISSDDIF-W  300
             F D H + +        +K TK +     ++A G RP   P     G++   SD I  W
Sbjct  141  RFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILSW  200

Query  301  R-KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEV  357
              ++ P   +V+GA  + +E A  +  + G+ V ++  R  +L   D ++ S +   M  
Sbjct  201  NIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMRN  260

Query  358  ESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSV  417
                 F+ G   +S+ K   G +LV   S      +   D +L   GR  +   LNL++ 
Sbjct  261  HGA-RFLLGETIESVDKSSRG-VLVGLKSGK----KVHGDALLYVVGRQANTDGLNLEAA  314

Query  418  GVQLNPKTGRIAV-TNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMD  476
            G+  NP+ G ++V T  QT  P+IFA+GD I AP L   +++ GR+ +  ++N + +  +
Sbjct  315  GLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDES--N  371

Query  477  YDKVCTAVFT-PIEYGCCGLSEEASIEKFGEDKLEIYHQNFT--PLEWSLSSDRQAAGSC  533
             D + + + T    YG   +  E S+    E +L     N+     ++S  +  Q +G+ 
Sbjct  372  DDSIPSQLKTGNFPYGIYTIP-EISMVGHTEKQLTSQQINYEIGVAKYSELAKGQMSGAS  430

Query  534  ---YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEI  590
                +K++ D    K + G H +G  A E+     +A+ +G T     + V  +PT AE 
Sbjct  431  ADGMLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLAEA  489

Query  591  F  591
            +
Sbjct  490  Y  490

>PHYRA_47253
Length=481

 Score = 117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 127/493 (26%), Positives = 215/493 (44%), Gaps = 55/493 (11%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+AK GK+V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     + +L+  +V       
Sbjct  53   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFA  111

Query  249  SFVDAHTLELWH-----PKKGTKTVTTRD---------VVIAVGGRP--KPLSCEGGELA  292
             F   H + +        KKG    +T D          +IA G RP   PL    G++ 
Sbjct  112  RFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPIDGQVV  171

Query  293  ISSDDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMA  348
            I SD I  R   + P   +V+GA  + +E A  +  + G+ V ++  R  +L   D+++ 
Sbjct  172  IDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREII  231

Query  349  SKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPD  408
            S +   M+  +   F+ G   ++I K+E+    VK     G +   + D +L   GR   
Sbjct  232  SNLTYEMQ-SNGARFLLG---ETIKKVETADNRVKVFFDSGKVL--SADALLYTVGRQAS  285

Query  409  VAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRL  467
               LNL++VG+  N + G I V  N QT  P+I+A GD I AP L   +++ GR+ +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  468  YNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGED--KLEIYHQNFTPLE  520
            +  +     T+ ++       ++T  E    G +E    ++  +D    EI    ++ L 
Sbjct  345  WKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIGVAKYSELA  400

Query  521  WSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTYDDMV  578
                    A G+  +    DT +   V G H +G  A E+     + +AM    TY    
Sbjct  401  KGQMMGAMAGGTLKILFDPDTLK---VFGVHAIGEGATEIIHIGQVAMAMDCSLTY--FR  455

Query  579  NVVGIHPTTAEIF  591
            + V  +PT AE +
Sbjct  456  DAVFNYPTLAEAY  468

>PYVX_20512
Length=528

 Score = 117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 124/492 (25%), Positives = 211/492 (43%), Gaps = 49/492 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            DYDL+VIG G     C+ E+AK GK+V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            ++ ++  + ++    +G S   +      +L  V   + S     K +L+  +V Y    
Sbjct  89   EA-VLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVIKAQLKAARVDYIAGT  147

Query  248  GSFVDAHTLELWHPKKGT----------------KTVTTRDVVIAVGGRP--KPLSCEGG  289
             SF   H L +      +                  +     +IA G RP   PL    G
Sbjct  148  ASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLVPVDG  207

Query  290  ELAISSDDIFWRK--EAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  345
            ++   SD I   +  + P   +V+GA  + +E A  +  + G+ V ++  R  +L   D 
Sbjct  208  KVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILSFCDT  267

Query  346  DMASKIGEFMEVESK-IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATG  404
            ++ S +    E+ SK   F+ G   +SI K E G   VK   + G +     D +L   G
Sbjct  268  EIISNL--MYEMRSKGARFLLGETIKSIEKSERG---VKVFFNSGKVATA--DALLYTVG  320

Query  405  RDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLA  464
            R      LNL++VG+  NP+       N QT   +I+A GD I AP L   +++ GR+ A
Sbjct  321  RQASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAA  380

Query  465  RRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
              +++++     T+ +D       ++T  E    G +E+  + K G +  E+    ++ L
Sbjct  381  CHMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQ-QLTKEGVN-YEVGIAKYSEL  438

Query  520  EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
                 +   A G   +    D+     + G H +G  A E+     +A+ +G +     N
Sbjct  439  AKGQMTGAIAGGMLKILFCPDSL---ELFGVHAIGEGATEIIHIGQVAIAMGCSLTYFRN  495

Query  580  VVGIHPTTAEIF  591
             V  +PT AE +
Sbjct  496  AVFNYPTLAEAY  507

>PYAR_16840
Length=536

 Score = 117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 123/504 (24%), Positives = 223/504 (44%), Gaps = 64/504 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+A++GK+V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     K +L+  ++ Y   L 
Sbjct  89   -AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARIDYLPGLA  147

Query  249  SFVDAHTLELW-------HPKKGTKTVTTRDVVIAVGGRP--KPLSCEGGELAISSDDIF  299
             F + H + +                V     +IA G RP   PL    G++ + SD I 
Sbjct  148  RFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDSDQIL  207

Query  300  --WRKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIM-----VRSILLRGFDQDMASK-  350
                +E P   +V+GA  + +E A  +  + G+ V ++     VR++L     +DM+ + 
Sbjct  208  SGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SRDMSLRP  264

Query  351  -----------------IGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICE  393
                             I   ++ E +++  R  + ++I K+E     VK   + G +  
Sbjct  265  QGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLTSGKVT-  323

Query  394  EAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPEL  452
             + D +L   GR      LNL++VG+  N K G + V    QT  P+I+A+GD I AP L
Sbjct  324  -SGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYAVGDCIGAPSL  381

Query  453  TPVAIQAGRMLARRLYNNE---TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKL  509
               +++ GR+ A  ++      T+ ++       ++T  E    G +E    ++   +K+
Sbjct  382  ASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTE----QQLTSEKV  437

Query  510  EIYHQNFTPLEWSLSSDRQAAGSCY--VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLA  567
              Y       ++S  +  Q +G  +  +K++ D    + V G H +G  A E+     +A
Sbjct  438  N-YEIGLA--KYSELAKGQMSGGAFGMLKILFDPDTLR-VHGVHAIGEGATEIIHIGQVA  493

Query  568  MKLGFTYDDMVNVVGIHPTTAEIF  591
            + +G +     + V  +PT AE +
Sbjct  494  IAMGCSLTYFRDAVFNYPTLAEAY  517

>PYU1_G011605
Length=524

 Score = 117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 128/489 (26%), Positives = 227/489 (46%), Gaps = 48/489 (10%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            DYDL+VIG G     C+ E+AK GK+V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            + +++  + ++    +G S   +      +L  V   + S     K +L+  +V+Y    
Sbjct  92   E-AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGF  150

Query  248  GSFVDAHTLELWH-PKKG--------TKTVT---TRDVVIAVGGRP--KPLSCEGGELAI  293
              F + H + +   P+ G        T TV+       +IA G RP   P     G++  
Sbjct  151  ARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIF  210

Query  294  SSDDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQDMAS  349
             SD I     ++ P   +V+GA  + +E A  +  + G+ V ++  R  +L   D ++ S
Sbjct  211  DSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIIS  270

Query  350  KIGEFMEVESK-IEFIRGAVPQSITKLE-SGQLLVKWVSSDGDICEEAFDTVLNATGRDP  407
             +    E+ SK   F+ G   ++I ++E +G  +  +++S G +   + D +L   GR  
Sbjct  271  NL--TYEMRSKGARFLLG---ETINRVEKTGNGVTVYLNS-GKVT--SADAMLYTVGRQA  322

Query  408  DVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARR  466
                LNL++V +  NP+ G + V    QT  P+I+A+GD I AP L   +++ GR+ A  
Sbjct  323  STDGLNLEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACH  381

Query  467  LYNNE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWS  522
            +++ E    T+ ++       ++T  E    G +E+  + K G +  EI    ++ L   
Sbjct  382  MWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEGVN-FEIGIAKYSELAKG  439

Query  523  LSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVG  582
              S   A G   +K++ D T  K + G H +G  A E+     +A+ +G +     + V 
Sbjct  440  QMSGSTAGG--MLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVF  496

Query  583  IHPTTAEIF  591
             +PT AE +
Sbjct  497  NYPTLAEAY  505

>PPTG_00938
Length=550

 Score = 117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 130/506 (26%), Positives = 227/506 (45%), Gaps = 62/506 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK+GK V ++D            LGG CV+ G +P K   +
Sbjct  48   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  99

Query  189  SSLIGETIHKDAAAFGWSVGEQKF---DWAQMLKSVNSYIKSIN----FKYKVELRDKKV  241
            ++L        A   G +   ++F   D  Q ++ V +    I      +  V+L +   
Sbjct  100  AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTA  159

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDV----------VIAVGGRP--KPLSCEGG  289
            ++     + V   + E +      K  ++ D+          ++ VG RP  +P     G
Sbjct  160  RFLPGSKNMVAVLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  219

Query  290  ELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  345
            E    SD++ W   K  P + +++GA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  220  ETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  279

Query  346  DMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGR  405
             ++  +   M  ++   F+ G   +S+ K   G++ V   S    +     D +L   GR
Sbjct  280  QVSEALCYSM-TQTGTRFLTGETIKSVEKSPKGEVFVHLESGKTVVG----DGLLYTVGR  334

Query  406  DPDVAKLNLDSVGVQLNP-KTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRML  463
              +V  LNL++VG  L+P K GRI V N  QT+VP+I+A GD+I  P L   +++ GR+ 
Sbjct  335  QGNVEGLNLEAVG--LSPDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLA  392

Query  464  ARRL----------YNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYH  513
            +  +           +++  + D D+V T + +  E    G+     I   G+++ ++  
Sbjct  393  SVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTK  451

Query  514  QNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIG  565
            +   P E  ++  +  A G        ++K+I C  T    + G H +G  A E+     
Sbjct  452  EQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK--IFGVHAIGEGATEIIHIGQ  508

Query  566  LAMKLGFTYDDMVNVVGIHPTTAEIF  591
            + M  G T +   N V  +PT AE +
Sbjct  509  VVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PHYRA_73883
Length=551

 Score = 117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 128/505 (25%), Positives = 225/505 (45%), Gaps = 60/505 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK+GK V ++D            LGG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTVPSKTFRE  97

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            ++L        A   G +   ++F    +L+ V     +     + +L    V+  N   
Sbjct  98   AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  249  SFVDAH-------TLELWHPKKGTKTVTTRDV----------VIAVGGRP--KPLSCEGG  289
             F+  +       + E +      K  T+ D+          ++ VG RP   P     G
Sbjct  158  RFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRPARHPDIPFDG  217

Query  290  ELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  345
            E    SD + W   K  P + +V+GA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADK  277

Query  346  DMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGR  405
            +++  +   M  ++   F+     +S+ K ++G++ V   S    +     D +L   GR
Sbjct  278  EVSEGLCYSM-AQTGTRFLTEETIKSVEKADNGEIFVHLESGKTVVG----DGLLYTVGR  332

Query  406  DPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRM--  462
              +V  LNL++VG+  + K GRI V N  QT+ P+I+A GD+I  P L   +++ GR+  
Sbjct  333  QGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  463  --------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQ  514
                    L  ++ +++  + D D+V T + +  E    G+     I   G+++ ++  +
Sbjct  392  VHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  515  NFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGL  566
              TP E  ++  +  A G        ++K+I C  T    ++G H +G  A E+     +
Sbjct  451  Q-TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK--ILGVHAIGEGATEIIHIGQV  507

Query  567  AMKLGFTYDDMVNVVGIHPTTAEIF  591
             M  G   +   N V  +PT AE +
Sbjct  508  VMSTGGNLEYFRNAVFNYPTLAEAY  532

>PITG_18935
Length=480

 Score = 115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 129/478 (27%), Positives = 209/478 (44%), Gaps = 50/478 (10%)

Query  126  TYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL  185
            + DYD++VIGGG GG   + +AA+ G K   ++        +   LGGTC+NVGCIP K 
Sbjct  27   SSDYDVVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGKLGGTCLNVGCIPSKA  78

Query  186  MHQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYEN  245
            +  S+ +  T   D  ++G    E K ++ QM+KS    +K++    ++  +  KV Y  
Sbjct  79   LLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTGGIELLFKKNKVTYIK  138

Query  246  LLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIF  299
              G       + +  +  KG +TV  ++++IA G       P P+    G++ I S    
Sbjct  139  GHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPVDNAAGKI-IDSTGAL  197

Query  300  WRKEAP-----GKTLVIGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMASKIGEF  354
              K  P         V    ++   C G  K     VK   + +  +G D    +K+   
Sbjct  198  ELKRVPEHLVVVGAGVTVVEFLDAACPGSDK---EAVKEFTKLLKKQGLDFQFNTKV---  251

Query  355  MEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNL  414
                     + G V +  T+   G          GD      DTVL ATGR    + L L
Sbjct  252  -----TASEVNGDVVKLTTEPSKG----------GDASSIECDTVLVATGRRAFTSGLGL  296

Query  415  DSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETA  473
            + +G+Q + K GRI V +  +T VP IFAIGDVI    L   A + G      +      
Sbjct  297  EQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-G  354

Query  474  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC  533
             ++Y  +   ++T  E+   G +E    E+   + +E Y+    P+  +  +   A    
Sbjct  355  HVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPMMANSRARTIAEADG  409

Query  534  YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+      HPT +E F
Sbjct  410  LVKVLADKKTDK-LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  466

>PYIW_19795
Length=519

 Score = 115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 125/485 (26%), Positives = 214/485 (44%), Gaps = 43/485 (9%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+AK GK+V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            + ++  + ++    +G S   +      +L  V   + S     K +L+  +V+Y   L 
Sbjct  89   A-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGLA  147

Query  249  SFVDAHTLELWHPKKGTKT-----------VTTRDVVIAVGGRP--KPLSCEGGELAISS  295
             F   H + +       +            +     +IA G RP   PL    G++   S
Sbjct  148  RFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKVIFDS  207

Query  296  DDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKI  351
            D I     +E P   +V+GA  + +E A  +  + G+ V ++  R  +L   D ++ S +
Sbjct  208  DQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEIISNL  267

Query  352  GEFMEVESK-IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVA  410
                E+ SK   F+ G   + + K E G + V + S          D +L   GR     
Sbjct  268  --TYEMRSKGARFLLGETIKQVEKTEDG-VTVHFNSGK----TATADALLYTVGRQASTD  320

Query  411  KLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN  470
             LNL++V +  NP+      T+ QT+  +I+A GD I AP L   +++ GR+ A  +++ 
Sbjct  321  GLNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQ  380

Query  471  E----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD  526
            E    T+ ++       ++T  E    G +E+  + K G +  EI    ++ L     S 
Sbjct  381  EEQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEGAN-YEIGIAKYSELAKGQMSG  438

Query  527  RQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPT  586
              A G   +K++ D T  K ++G H +G  A E+     +AM +G +     + V  +PT
Sbjct  439  STAGG--MLKILFDPTTLK-LLGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPT  495

Query  587  TAEIF  591
             AE +
Sbjct  496  LAEAY  500

>PYIW_25190
Length=206

 Score = 108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 100/185 (54%), Gaps = 4/185 (2%)

Query  412  LNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGD-VIDAPELTPVAIQAGRMLARRLYNN  470
            L L++VGV+LN     +    E TSV  I+AIGD  I   ELTPVAI AGR LA RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  471  ET-ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQA  529
            E  AL+ Y ++ T VF+    G  G +E  +IEKFG   ++ Y   F  L  +++ D   
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMA-DPDH  120

Query  530  AGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAE  589
             G   +K++        VVG H  G  A E+ Q  G+AMK+  T  D  N+V IHPT +E
Sbjct  121  KGKTAMKLVTVGEDEV-VVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  590  IFTTL  594
               T+
Sbjct  180  ELVTM  184

>SDRG_05060
Length=559

 Score = 113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 230/516 (45%), Gaps = 80/516 (16%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DL+VIG G  G  C+ ++AK+GKKV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  189  SSLIGETIHKDAAAFGWSVGE---------------QKFDWAQMLKSVNSYIKS----IN  229
            + ++  T H+    +G +                  QK + A+M  + N  +++    IN
Sbjct  102  A-VLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLIN  160

Query  230  FKYKVELRDKKVKYENLLG--SFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  284
               +  L D   K   +L   S+ +A   +        K V T D  +I+VG RP   P 
Sbjct  161  GTARF-LPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  219

Query  285  SCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILL  340
                GEL   SD + W      P + +V+GA  + +E A  +  + G  V ++  R  +L
Sbjct  220  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  279

Query  341  RGFDQDMASKI-------GEFMEVESKIEFIRGAVPQS--ITKLESGQLLVKWVSSDGDI  391
               D++++  +       G     E  I+F+   + +   +  L+SG+++V         
Sbjct  280  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  331

Query  392  CEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAP  450
                 D +L   GR  +V  L+L++VG++ N + G + V N  QTSVP+I+A GD I  P
Sbjct  332  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  385

Query  451  ELTPVAIQAGRMLARRLYNNETA---LMDYDKVCTAVF-TPIEYGCC---GLSEEASIEK  503
             L  V+++ GR+ +  +  +E       D D   T+ F T +  G     G+     I  
Sbjct  386  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  445

Query  504  FGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGP  555
             G+ + ++  +N  P E  ++  +  A G        ++K+I C +T    ++G H +G 
Sbjct  446  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  502

Query  556  NAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             A E+     + M  G T +   N V  +PT AE +
Sbjct  503  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_12054
Length=558

 Score = 113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 230/516 (45%), Gaps = 80/516 (16%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DL+VIG G  G  C+ ++AK+GKKV ++D             GG CV+ G IP K   +
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  100

Query  189  SSLIGETIHKDAAAFGWSVGE---------------QKFDWAQMLKSVNSYIKS----IN  229
            + ++  T H+    +G +                  QK + A+M  + N  +++    IN
Sbjct  101  A-VLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLIN  159

Query  230  FKYKVELRDKKVKYENLLG--SFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  284
               +  L D   K   +L   S+ +A   +        K V T D  +I+VG RP   P 
Sbjct  160  GTARF-LPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  218

Query  285  SCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILL  340
                GEL   SD + W      P + +V+GA  + +E A  +  + G  V ++  R  +L
Sbjct  219  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  278

Query  341  RGFDQDMASKI-------GEFMEVESKIEFIRGAVPQS--ITKLESGQLLVKWVSSDGDI  391
               D++++  +       G     E  I+F+   + +   +  L+SG+++V         
Sbjct  279  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  330

Query  392  CEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAP  450
                 D +L   GR  +V  L+L++VG++ N + G + V N  QTSVP+I+A GD I  P
Sbjct  331  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  384

Query  451  ELTPVAIQAGRMLARRLYNNETA---LMDYDKVCTAVF-TPIEYGCC---GLSEEASIEK  503
             L  V+++ GR+ +  +  +E       D D   T+ F T +  G     G+     I  
Sbjct  385  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  444

Query  504  FGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGP  555
             G+ + ++  +N  P E  ++  +  A G        ++K+I C +T    ++G H +G 
Sbjct  445  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  501

Query  556  NAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             A E+     + M  G T +   N V  +PT AE +
Sbjct  502  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>PHALS_12028
Length=579

 Score = 113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 130/505 (26%), Positives = 221/505 (44%), Gaps = 60/505 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK+GK V ++D            LGG CV+ G IP K   +
Sbjct  36   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTIPSKTFRE  87

Query  189  SSLIGETIHKDAAAFGWSVGEQKF---DWAQMLKSVNSYIKSIN----FKYKVELRDKKV  241
            ++L        A   G     ++F   D  Q +K V S    I      +  V+L +   
Sbjct  88   AALHLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDITRHQLLRNGVQLINGTA  147

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEG------------G  289
            ++       +   + E +      +  ++ D+   V    K L C G            G
Sbjct  148  RFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRADIPFDG  207

Query  290  ELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQ  345
            E    SD + W   K  P + +V+GA  + +E A  M  + G DV ++  R  +L   D 
Sbjct  208  ETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEILNMADN  267

Query  346  DMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGR  405
            +++  +  F   ++   F+ G V +S+ K   G++ V   S    +     D +L   GR
Sbjct  268  EVSEALC-FSMAQTGTRFLTGEVIKSVEKSAMGEVFVHLESGKTVVG----DGLLYTVGR  322

Query  406  DPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRM--  462
              +V  LNL++VG+ +  K G+I V N  QT+VP+I+A GD+I  P L   +++ GR+  
Sbjct  323  QGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  381

Query  463  --------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQ  514
                    L  +  +++  + D D+V T + +  E    G+     I   G+++ ++  +
Sbjct  382  VHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  440

Query  515  NFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGL  566
               P E  ++  +  A G        ++K+I C  T    V+G H +G  A E+     +
Sbjct  441  G-VPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK--VLGVHAIGEGATEIIHIGQV  497

Query  567  AMKLGFTYDDMVNVVGIHPTTAEIF  591
             M    T +   N V  +PT AE +
Sbjct  498  LMSTDGTLEYFRNAVFNYPTLAEAY  522

>PPTG_09121
Length=520

 Score = 112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 132/529 (25%), Positives = 229/529 (43%), Gaps = 68/529 (13%)

Query  96   AATHTSSPFFGKDESPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVC  155
            AAT ++    G+  S     VAA          YDL+VIG G     C+ E+AK GK+V 
Sbjct  9    AATRSAPLLRGRLFSTIKPQVAA----------YDLVVIGSGPSATQCALESAKQGKRVA  58

Query  156  VLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKFDWA  215
            ++D            LGG CV+ G IP K   + +++  + ++    +G S   +     
Sbjct  59   IVD--------KKTRLGGVCVHTGTIPSKTFRE-AVLHLSGYRHHGFYGKSYSMKTVTIE  109

Query  216  QMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLEL------WHPKKGTKTVT  269
             +L  V   + S     + +L+  +V        F + H + +         K G  + +
Sbjct  110  DILYRVQRVVSSEEDVVRAQLKAARVDVVPGFARFENEHEISIVRDDNDQKKKNGAVSGS  169

Query  270  TRDV-----------VIAVGGRP--KPLSCEGGELAISSDDIFWR--KEAPGKTLVIGAS  314
            + ++           +IA G RP   PL    G++ I SD I  R   + P   +V+GA 
Sbjct  170  SSNLDSLSRIRADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAG  229

Query  315  YVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSI  372
             + +E A  +  + G+ V ++  R  +L   D ++ S +   M+  +   F+ G   +++
Sbjct  230  VIGMEYASMVNVVPGHTVTVVDGRPDILSFCDSEIISNLTYEMQ-SNGARFLLG---ETV  285

Query  373  TKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-  431
             K+E+    VK   + G +   + D +L   GR      LNL++VG+  N + G I V  
Sbjct  286  KKVETTDKRVKVFFNSGKVL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNK  342

Query  432  NEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE-----TALMDYDKVCTAVFT  486
            N QT  P+I+A GD I AP L   +++ GR+ +  ++N +     T+ ++       ++T
Sbjct  343  NYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYT  402

Query  487  PIEYGCCGLSEEASIEKFGED--KLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRN  544
              E    G +E    ++  +D    EI    ++ L         A G+  +    DT + 
Sbjct  403  IPEISMVGQTE----QQLTKDCVNYEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK-  457

Query  545  KHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
              V G H +G  A E+     + +AM    TY    + V  +PT AE +
Sbjct  458  --VFGVHAIGEGATEIIHIGQVAMAMDCSLTY--FRDAVFNYPTLAEAY  502

>PHYCA_504445
Length=548

 Score = 112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 125/505 (25%), Positives = 221/505 (44%), Gaps = 60/505 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK GK V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIIDKRDM--------MGGVCVHTGTVPSKTFRE  97

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            ++L        A   G     ++F    +L+ V     +     + +L    V+  N   
Sbjct  98   AALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  249  SFV--DAHTLELWHPKK---------------GTKTVTTRDVVIAVGGRP--KPLSCEGG  289
             F+  + H + +   +                  + +T    ++ VG RP  +P     G
Sbjct  158  RFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  217

Query  290  ELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  345
            E    SD + W   K  P + +++GA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  277

Query  346  DMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGR  405
            +++  +   M  ++   F+ G   +S+ K   G++ V   S    +     D +L   GR
Sbjct  278  EVSEALCYSM-AQTGTRFLTGETIKSVEKTAKGEVFVHLESGKTVVG----DGLLYTVGR  332

Query  406  DPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLA  464
              +V  LNL++VG++ + K GRI V N  QT+VP+I+A GD+I  P L   +++ GR+ +
Sbjct  333  QGNVEGLNLEAVGLEPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  465  RRLYNNET----------ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQ  514
              +  ++T           + D D+V T + +  E    G+     I   G+++ ++  +
Sbjct  392  VHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  515  NFTPLE-----WSLSSDRQAAGSC--YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGL  566
               P E     +   +  Q  G    ++K+I C  T    ++G H +G  A E+     +
Sbjct  451  Q-VPYEVGKARYEELARGQMLGGVPGFLKIIFCPETLK--ILGVHAIGEGATEIIHIGQV  507

Query  567  AMKLGFTYDDMVNVVGIHPTTAEIF  591
             M  G   +   N V  +PT AE +
Sbjct  508  VMSTGGDLEYFRNAVFNYPTLAEAY  532

>PYIR_14132
Length=513

 Score = 108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 126/505 (25%), Positives = 221/505 (44%), Gaps = 60/505 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ + AK+GK V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVIDKRDM--------LGGVCIHTGTVPSKTFRE  62

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            ++L        +   G S   ++F    +L+ V     +     + +L    ++  N   
Sbjct  63   ATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELINGTA  122

Query  249  SFV-------------DAHTLELWHPKKGT-----KTVTTRDVVIAVGGRP--KPLSCEG  288
             F+             D++T      +  +     + +T    +IAVG RP  +P     
Sbjct  123  RFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPDIPFD  182

Query  289  GELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  344
            G+    SD + W   K  P + +V+GA  + +E A  M  + G +V I+  R  +L   D
Sbjct  183  GQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  242

Query  345  QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATG  404
            ++++  +   M       F+   + +S+ K ++G+++V   S    +     D +L   G
Sbjct  243  REVSEALCYSMRQTGARFFVEETI-KSVEKADNGEVIVHLNSGKTLVG----DGLLYTLG  297

Query  405  RDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRML  463
            R  +   LNL +VG++ + K G I V ++ QT VP+I+A GD I  P L   +++ GR+ 
Sbjct  298  RQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLA  356

Query  464  ARRLYN---------NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQ  514
            +  +           +ET   D   + T + +  E    G+     I   G+++ ++  Q
Sbjct  357  SVHMRTSKPTNKKGESETESTDPQYMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQ  415

Query  515  NFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGL  566
            N  P E  ++  +  A G        ++K+I C  T    V+G H +G  A E+     +
Sbjct  416  NI-PYEVGVARYEELAKGQMLGGVPGFLKIIFCPKTL--QVLGVHAIGEGATEIIHIGQV  472

Query  567  AMKLGFTYDDMVNVVGIHPTTAEIF  591
             M  G T +   N V  +PT AE +
Sbjct  473  VMSTGGTIEYFRNAVFNYPTLAEAY  497

>SDRG_14446
Length=495

 Score = 108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 120/476 (25%), Positives = 220/476 (46%), Gaps = 40/476 (8%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+VIG G   + C+ E+ K GK V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            + S++  +  +    +G S          +L  VN+ +       + +L+  +V     L
Sbjct  80   E-SVLHLSGFRHQGFYGKSYARDNITLNDILGRVNTVVSKEMDVIQAQLKAARVDLVPGL  138

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRP--KPLSCEGGELAISSDDIFWR--KE  303
              F + + + +         +  +  ++A G RP   PL    G++ + SD I      +
Sbjct  139  ARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILNHGTTK  198

Query  304  APGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVESK-  360
             P   +V+GA  + +E A  +  + G +V ++  R+ +L   D ++ S +   ME+  K 
Sbjct  199  LPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLK--MEMRHKG  256

Query  361  IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQ  420
              F+ G   +S+   ++G + V++ S      E     +L   GR  +   LNL++VG+ 
Sbjct  257  ARFLLGESIKSVEHFKNG-VKVEFNSGKAMFAE----ALLYCVGRQANTDGLNLEAVGLS  311

Query  421  LNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE---TALMD  476
             N + G I V  + QTS P+I+A GD I AP L   +++ GR+ A  +++++   T+ ++
Sbjct  312  KNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLE  370

Query  477  YDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL-EWSLSSDRQAAGSCYV  535
                   ++T  E    G +E+  + K G +   +    F+ L +  +S D +      +
Sbjct  371  SGNYPYGIYTIPEISMVGKTEQ-QLTKEGAN-YAVGLAKFSELAKGQMSGDIEG----IL  424

Query  536  KVICDTTRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTYDDMVNVVGIHPTTAE  589
            K++ D   +  ++G H +G  A E+     + +AM    TY    + V  +PT AE
Sbjct  425  KLLFDPV-SLQLLGVHAIGHGATEIIHIGQVAMAMNCKLTY--FRDAVFNYPTLAE  477

>PHALS_10055
Length=516

 Score = 107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 217/492 (44%), Gaps = 52/492 (11%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+VIG G     C+ E+AK GK+V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            + +++  + ++    +G S   +      +L  V   + S     + +L+  +V      
Sbjct  83   E-AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGF  141

Query  248  GSFVDAHTLELWHPKKGTKTVTTRDV----------------VIAVGGRP--KPLSCEGG  289
              F + H + +    +   T T +++                +IA G RP   PL    G
Sbjct  142  ARFENEHEISIL---RDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPIDG  198

Query  290  ELAISSDDIFWRKE--APGKTLVIGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQ  345
            ++ I SD I  R     P   +V+GA  + +E A  +  + G+ V ++  R  +L   D 
Sbjct  199  KVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCDL  258

Query  346  DMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGR  405
            ++ S +   M+  +   F+ G   +++ K+E+ +  VK   + G +   + D +L   GR
Sbjct  259  EIISNLTYEMQ-SNGARFLLG---ETVKKVETTKNQVKVFFNSGKVL--SADALLYTVGR  312

Query  406  DPDVAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLA  464
                  LNL++VG+  N + G I V  N QT  P+I+A GD I AP L   +++ GR+ +
Sbjct  313  QAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLAS  371

Query  465  RRLYN-NE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPL  519
              ++  NE    T+ ++       ++T  E    G +E+   +       EI    ++ L
Sbjct  372  CHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKNC--INYEIGIAKYSEL  429

Query  520  EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVN  579
                     A G+  +K++ D      ++G H +G  A E      +AM +G +     +
Sbjct  430  AKGQMMGAMAGGT--LKILFD-PETLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYFRD  486

Query  580  VVGIHPTTAEIF  591
             V  +PT AE +
Sbjct  487  AVFNYPTLAEAY  498

>PHYKE_9807
Length=557

 Score = 107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 128/509 (25%), Positives = 223/509 (44%), Gaps = 69/509 (14%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKL-MH  187
            +DLIVIG G  G  C+ ++AK+GK V ++D            LGG CV+ G   ++  MH
Sbjct  56   FDLIVIGSGPAGQKCAIDSAKHGKSVAIVDKRDM--------LGGVCVHTGTTFREAAMH  107

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
             +       +         +G +  D  Q +K V +    I    + +L+   V+  +  
Sbjct  108  LTGYRHRAFYNGHGGISKRIGVE--DILQRVKKVEAAETDIT---RHQLQRNGVQLISGT  162

Query  248  GSFV--DAHTLELWH---------PKKGT------KTVTTRDVVIAVGGRP--KPLSCEG  288
              F+  D+H L +            K+ T      + +T    ++ VG RP   P     
Sbjct  163  ARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPARHPDIPFD  222

Query  289  GELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  344
            GE    SD + W   K  P + +++G   V +E A  M  + G DV ++  R  +L   D
Sbjct  223  GETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEILNMAD  282

Query  345  QDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATG  404
            ++++  +   M  ++   F+ G   + + K   G++LV+  S    +     D +L   G
Sbjct  283  KEVSEALCYSM-AQTGTRFLVGETIKKVEKNSKGEVLVRLDSGKTVVG----DGLLYTVG  337

Query  405  RDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRML  463
            R  +V  L+L+SVG+  + K GRI V N  QT VP+I+A GD+I  P L   +++ GR+ 
Sbjct  338  RQGNVEGLHLESVGIHPD-KRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSMEQGRLA  396

Query  464  ARRLYN-------------NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLE  510
            +  +               ++  + D D++ T + +  E    G+     I   G+++ +
Sbjct  397  SVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQ  455

Query  511  IYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQ  562
            +  Q   P E  ++  +  A G        ++K+I C  T    ++G H +G  A E+  
Sbjct  456  LT-QEQVPYEVGMARYEELARGQMLGGVPGFLKIIFCPNT--LQILGVHAIGEGATEIIH  512

Query  563  AIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
               + M  G T +   N V  +PT AE +
Sbjct  513  IGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>PYIW_20257
Length=503

 Score = 106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 124/491 (25%), Positives = 212/491 (43%), Gaps = 81/491 (16%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ + AK+GK V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVIDKRDM--------LGGVCIHTGTVPSKTFRE  101

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            ++L        +   G S   ++F    +L+ V                           
Sbjct  102  ATLHLTAYRHRSFYEGQSTPAKRFGIEDILQRVKK-------------------------  136

Query  249  SFVDAHTLELWHPKKGTKTVTTRD----VVIAVGGRP--KPLSCEGGELAISSDDIFW--  300
                       H + G +T   R      +IAVG RP  +P     GE    SD + W  
Sbjct  137  ----------LHDRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQLLWGG  186

Query  301  RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVE  358
             K  P + +V+GA  + +E A  M  + G +V I+  R  +L   D++++  +   M   
Sbjct  187  VKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADREVSEALCYSMRQT  246

Query  359  SKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVG  418
                F+   + +S+ K ++G+++V   S    +     D +L   GR  +   LNL+++G
Sbjct  247  GARFFVEETI-KSVEKADNGEVIVHLNSGKTLVG----DGLLYTLGRQGNTEGLNLEAIG  301

Query  419  VQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLY---------  468
            ++ + K G I V ++ QT+VP+I+A GD I  P L   +++ GR+ +  +          
Sbjct  302  LKAD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAKPTNKKG  360

Query  469  NNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSS-DR  527
            ++ET   D   + T + +  E    G+     I   G+++ ++  Q   P E  ++  + 
Sbjct  361  DSETESTDPAFMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQCI-PYEVGVARYEE  418

Query  528  QAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNV  580
             A G        ++K+I C TT    V+G H +G  A E+     + M  G T +   N 
Sbjct  419  LAKGQMLGGVPGFLKIIFCPTTLQ--VLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNA  476

Query  581  VGIHPTTAEIF  591
            V  +PT AE +
Sbjct  477  VFNYPTLAEAY  487

>PYAP_19280
Length=512

 Score = 107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 120/488 (25%), Positives = 219/488 (45%), Gaps = 49/488 (10%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+A++GK+V V+D  K S       +GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD--KGSS------VGGVCVHTGTIPSKTFRE  81

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     K +L+  +V Y     
Sbjct  82   -AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYIPGFA  140

Query  249  SFVDAHTLELWHPKKGTKT-------VTTR----DVVIAVGGRP--KPLSCEGGELAISS  295
             F + H + +      T         + TR      +IA G RP   PL    G++   S
Sbjct  141  RFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKVVFDS  200

Query  296  DDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKI  351
            D I     +E P   +V+GA  + +E A  +  + G+ V ++  R  +L   D ++ S  
Sbjct  201  DQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCDNEVVS--  258

Query  352  GEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAK  411
               ++ E +++  R  + +SI K+E     VK + + G +   + D +L   GR  +   
Sbjct  259  --MLQHEMRVKGARFLLGESIQKVEKTAKGVKVLLNSGKVT--SADALLYTVGRQANTDG  314

Query  412  LNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN  470
            LN+++VG+  N + G + V    QT   +I+A+GD I AP L   +++ GR+ A  +++ 
Sbjct  315  LNIEAVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDG  373

Query  471  E----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSD  526
                 T+ ++       ++T  E    G +E+       +   E  +      ++S  + 
Sbjct  374  NCDIATSQLENGNYPYGIYTIPEISMVGKTEQ-------QLTAEKVNYEIGIAKYSELAK  426

Query  527  RQAAGSCY---VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGI  583
             Q  G  +   +K++ D    K + G H +G  A E+     +A+ +G +     + V  
Sbjct  427  GQMGGGSHNGILKILFDPDTLK-LHGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVFN  485

Query  584  HPTTAEIF  591
            +PT AE +
Sbjct  486  YPTLAEAY  493

>PYU1_G005699
Length=550

 Score = 107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 131/509 (26%), Positives = 220/509 (43%), Gaps = 71/509 (14%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK+GK V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  189  SSLIGETIHKDAAAFGWSVGEQKF---DWAQMLKSVNSYIKSIN----FKYKVELRDKKV  241
            ++L        +   G S   ++F   D  Q +K V      I      +  VEL +   
Sbjct  102  ATLHLTAYRHRSFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELINGTA  161

Query  242  KY-----ENLLGSFV-DAHTLELWHPKKGT-----KTVTTRDVVIAVGGRP--KPLSCEG  288
            ++     +N++     D++T      +  +     + +T    +IAVG RP  +P     
Sbjct  162  RFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIPFD  221

Query  289  GELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  344
            G+    SD + W   K  P + +V+GA  + +E A  M  + G +V I+  R  +L   D
Sbjct  222  GQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  281

Query  345  QDMASKI-------GEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFD  397
            ++++  +       G    VE  I+ +     + I  L SG+ LV              D
Sbjct  282  REVSEALCYSMRQTGARFFVEETIKSVEKVNGEVIVHLNSGKTLVG-------------D  328

Query  398  TVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAV-TNEQTSVPNIFAIGDVIDAPELTPVA  456
             +L   GR  +   LNL +VG++ + K G I V  N QT+VP+I+A GD I  P L   +
Sbjct  329  GLLYTLGRQGNTDGLNLPAVGLEAD-KRGLIQVDENFQTAVPHIYAAGDCIGFPALASTS  387

Query  457  IQAGRMLARRLYNNETALMDYDKVCTA---VFTPIEYGCC---GLSEEASIEKFGEDKLE  510
            ++ GR+ +  +   +      D   T    + T +  G     G+     I   G+++ +
Sbjct  388  MEQGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKNEQQ  447

Query  511  IYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQ  562
            +  +N  P E  L+  +  A G        ++K+I C  T    ++G H +G  A E+  
Sbjct  448  LTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPKTL--QLLGVHAIGEGATEIIH  504

Query  563  AIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
               + M  G T +   N V  +PT AE +
Sbjct  505  IGQVVMSTGGTIEYFRNAVFNYPTLAEAY  533

>PHYCA_555180
Length=521

 Score = 104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 123/497 (25%), Positives = 209/497 (42%), Gaps = 58/497 (12%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+AK GK+V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     + +L+  +V       
Sbjct  83   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  141

Query  249  SFVDAHTLELWHPKKGTKT--------------------VTTRDVVIAVGGRP--KPLSC  286
             F + H + +       K                     V     +IA G RP   PL  
Sbjct  142  RFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAHNPLVP  201

Query  287  EGGELAISSDDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRG  342
              G++ I SD I  R   + P   +V+GA  + +E A  +  + G+ V ++  R  +L  
Sbjct  202  IDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  261

Query  343  FDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNA  402
             D+++ S +   M+  +   F+ G   +++ K+E     VK     G +     D +L  
Sbjct  262  CDREIISNLTYEMQ-SNGARFLLG---ETVKKVEVTD-RVKVFFDSGKVLSA--DALLYT  314

Query  403  TGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAPELTPVAIQAGR  461
             GR      LNL++VG+  N + G I V  N QT  P+I+A GD I AP L   +++ GR
Sbjct  315  VGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  373

Query  462  MLARRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNF  516
            + +  ++N +     T+ ++       ++T  E    G +E+   +       EI    +
Sbjct  374  LASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKAC--INYEIGVAKY  431

Query  517  TPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  574
            + L         A G+  +    DT +   V G H +G  A E+     + +AM    TY
Sbjct  432  SELAKGQMMGAMAGGTLKILFDPDTLK---VFGVHAIGEGATEIIHIGQVAMAMDCSLTY  488

Query  575  DDMVNVVGIHPTTAEIF  591
                + V  +PT AE +
Sbjct  489  --FRDAVFNYPTLAEAY  503

>CCI39993
Length=550

 Score = 102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 131/540 (24%), Positives = 221/540 (41%), Gaps = 94/540 (17%)

Query  110  SPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTW  169
            SP  T +   + D   +  YDLIVIG G  G  C+ ++AK+GK V ++D  +        
Sbjct  26   SPKTTALTDMLRDLKASEHYDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKNEMH------  79

Query  170  GLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAF-GWSVGEQKFDWAQMLKSVNSYIKSI  228
              GG CV+ G +P K   ++ ++  T H+    + G S  +++F    +L  V     + 
Sbjct  80   --GGVCVHTGTVPSKTFREA-ILHLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAE  136

Query  229  NFKYKVELRDKKVKYENLLGSFVDAHT-----LELWHPKK-------------GTKTVTT  270
                + +L    V+  N    F+   +      ++ H K+               K +T 
Sbjct  137  TDITRHQLVRNNVELINGTARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTA  196

Query  271  RDVVIAVGGRPKPLS--CEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKG  326
               +IAVG RP         G++   SD I W   K  P + +V+GA  + +E A  M  
Sbjct  197  DKFLIAVGTRPARRDDIVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSI  256

Query  327  M-GYDVKIMV-RSILLRGFDQDMASKI-------GEFMEVESKIEFIR-GAVPQSITKLE  376
            + G  V ++  R  +L   D+++   +       G    +E  I+ +      + I  L 
Sbjct  257  IPGAQVTVIDGRKEILEMADREVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVIIHLN  316

Query  377  SGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQT  435
            SG+ +V              D +L   GR  +   L+L ++G+Q + K G I V  N QT
Sbjct  317  SGKTIVG-------------DGLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQT  362

Query  436  SVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-----------------ETALMDYD  478
            SVP+I+A GD    P L   +++ GR+ +  +  +                  T +   D
Sbjct  363  SVPHIYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGD  422

Query  479  KVCTAVFTPIEYGCCG-----LSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAG-S  532
                 ++T  E    G     L++E    + G  + E            L+  +   G  
Sbjct  423  FFPFGIYTVPEISMVGKNEYQLTKEGIAYEVGVARYE-----------ELAKGQMLGGVP  471

Query  533  CYVKVI-CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             ++K+I C TT N  ++G H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  472  GFLKIIFCPTTLN--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>H310_07641
Length=548

 Score = 101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 132/510 (26%), Positives = 220/510 (43%), Gaps = 68/510 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DL+VIG G  G  C+ ++AK+GKKV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  189  SSLIGETIHKDAAAFGWS---------------------VGEQKFDWAQMLKSVNSYIKS  227
            + ++  T H+    +G +                     V E + D  +   + N  I  
Sbjct  93   A-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGIILI  151

Query  228  INFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  284
                  ++  DKK        S+ +    +  +     K V T D V+IAVG RP   P 
Sbjct  152  NGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARHPD  211

Query  285  SCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILL  340
                G L   SD + W      P + +V+GA  + +E A  +  + G  V ++  R  +L
Sbjct  212  LEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEIL  271

Query  341  RGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLES---GQLLVKWVSSDGDICEEAFD  397
               D++++  +  +M         R    +SI K+E+    +++V   S  G +     D
Sbjct  272  DMADKEVSDALCYYMRQRGS----RFLTEESILKVETKDDSEVVVHLTS--GKVI--MGD  323

Query  398  TVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVA  456
             +L   GR  +VA L+L++VG+  N K G + V N  QT+VP+I+A GD I  P L   +
Sbjct  324  ALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALASTS  382

Query  457  IQAGRMLARRLYNNE-TALMDYDKVCTAVFTPI------EYGCCGLSEEASIEKFGEDKL  509
            ++ GR+ +  +  +E T  +  D        P       E    G+     I   G+ + 
Sbjct  383  MEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSEQ  442

Query  510  EIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLGPNAGEVT  561
            ++  +N  P E  ++  +  A G        ++K+I C TT    ++G H +G  A E+ 
Sbjct  443  QLSKENI-PYEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLK--LLGVHAIGEGATEII  499

Query  562  QAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
                + M  G T +   N V  +PT AE +
Sbjct  500  HIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PYIR_21896
Length=518

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 128/494 (26%), Positives = 217/494 (44%), Gaps = 61/494 (12%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            +YDL+VIG G     C+ E+AK GK+V V+D         T+ +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD-------KKTF-VGGVCVHTGTIPSKTFR  88

Query  188  QSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            ++ ++  + ++    +G S   +      +L  V   + S     +V++   +   +   
Sbjct  89   EA-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS-----EVDISIVRDTPDAAG  142

Query  248  GSFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPLSCEGGELAISSDDIFWR--K  302
            G   D+      H    T +    D  +IA G RP   PL    G++   SD I     +
Sbjct  143  GDAGDSD-----HDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQILSGDIR  197

Query  303  EAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVESK  360
            E P   +V+GA  + +E A  M  + G+ V ++  RS +L   D ++ S +    E+ SK
Sbjct  198  ELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNL--TYEMRSK  255

Query  361  -IEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419
               F+ G   + + K ESG   V    + G I   + D +L   GR      LNL++V +
Sbjct  256  GARFLLGETIKHVEKTESG---VTVHFNSGKIT--SADALLYTVGRQAATDGLNLEAVDL  310

Query  420  QLNPKTGRIAVTNEQTSVPNI------------------FAIGDVIDAPELTPVAIQAGR  461
              NP+       + QT+ P++                  +A GD I AP L   +++ GR
Sbjct  311  SRNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLASTSMEQGR  370

Query  462  MLARRLYNNE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFT  517
            + A  +++ E    T+ ++       ++T  E    G +E+  + K G +  EI    ++
Sbjct  371  LAACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEGLN-FEIGIAKYS  428

Query  518  PLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDM  577
             L     S   A G   +K++ D T  K + G H +G  A E+     +AM +G +    
Sbjct  429  ELAKGQMSGSTAGG--MLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAMAMGCSITYF  485

Query  578  VNVVGIHPTTAEIF  591
             + V  +PT AE +
Sbjct  486  RDAVFNYPTLAEAY  499

>PYIW_24688
Length=259

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/266 (32%), Positives = 134/266 (50%), Gaps = 41/266 (15%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YD I IGGGSGG+A ++ AA +G KV V++  +   G    GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLVVERGRKYGGA---GLGGTCVHYGCVPKKIMFN  63

Query  189  SSLIGETIHKDA-------AAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKV  241
            ++   E +++ A        A  +  G+  FDWA M    ++YI  +N  Y+  L + +V
Sbjct  64   AATHVEHLNRAADYSITTNGAHKYQFGD--FDWANMKTKRDAYILRLNGIYERNLGNAQV  121

Query  242  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGELAISSDDIFWR  301
                 +   V  + +E+          T + +++AVGG+P               D F++
Sbjct  122  DLVEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DGFFK  161

Query  302  KEA-PGKTLVIGASYVALECAGFMKGMGYDVKIMVR-SILLRGFD---QDMASKIGEFME  356
             EA P K  V+GA Y+A+E AG    +  D  +  R   +LR FD   +D+ ++ GE   
Sbjct  162  LEAQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE---  218

Query  357  VESKIEFIRGAVPQSITKLESGQLLV  382
             ++ I F+R +  + I K   G L +
Sbjct  219  -KAGINFVRNSRIERIEKQADGSLTI  243

>PPTG_13000
Length=387

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 101/386 (26%), Positives = 169/386 (44%), Gaps = 24/386 (6%)

Query  217  MLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVI  275
            M+K+    +K++    +   +  KV Y    G       + +  +  KG +TV  ++++I
Sbjct  1    MMKAKEKAVKTLTGGIESLFKKNKVTYIKGHGKISAQGEVSVALNDNKGNETVKAKNIII  60

Query  276  AVGGR-----PKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYD  330
            A G       P P+    G++ I S      K  P   +V+GA  + LE     K +G  
Sbjct  61   ATGSEVTPLPPVPVDNAAGKI-IDSTGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAK  119

Query  331  VKIM-VRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWV---S  386
            V ++        G D++   +  + ++ +  ++F  G     +T  E    +VK     S
Sbjct  120  VTVVEFLDAACPGMDKEAVKEFTKLLKKQG-LDFKFGT---KVTSSEVNGDVVKLTTEPS  175

Query  387  SDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGD  445
              GD      DTVL ATGR    A L L+ +G+Q + K GRI V +  +T VP IFAIGD
Sbjct  176  KGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGD  234

Query  446  VIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFG  505
            VI    L   A + G      +       ++Y  V   ++T  E+   G +EE    +  
Sbjct  235  VIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAVPGVIYTFPEFASVGKTEE----ELK  289

Query  506  EDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIG  565
             + +E Y+    P+  +  +   A     VKV+ D   +K ++G H +  NAGE+     
Sbjct  290  AEGIE-YNVGKFPMMANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGV  347

Query  566  LAMKLGFTYDDMVNVVGIHPTTAEIF  591
            + ++ G   +D+      HPT +E F
Sbjct  348  IGIEYGAASEDLARTCHAHPTLSEAF  373

>PHYKE_2864
Length=486

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 115/491 (23%), Positives = 196/491 (40%), Gaps = 84/491 (17%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ E+AK GK+V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     + +L+  +V       
Sbjct  86   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFA  144

Query  249  SFVDAHTLELWHPK---------------KGTKTVTTRDVVIAVGGRP--KPLSCEGGEL  291
             F + H + +   +                    V     +IA G RP   PL    G++
Sbjct  145  RFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPIDGKV  204

Query  292  AISSDDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMVRSILLRGFDQDMA  348
             I SD I  R   + P   +V+GA  + +E A  +  + G+ V +      + G      
Sbjct  205  IIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTV------VDGRPDTTD  258

Query  349  SKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPD  408
             ++  F                      SG++L             + D +L   GR   
Sbjct  259  KRVKVF--------------------FNSGKVL-------------SADALLYTVGRQAS  285

Query  409  VAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAPELTPVAIQAGRMLARRL  467
               LNL++VG+  N + G I V  N QT  P+I+A GD I AP L   +++ GR+ +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  468  YNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGED--KLEIYHQNFTPLE  520
            +N +     T+ ++       ++T  E    G +E    ++  +D    EI    ++ L 
Sbjct  345  WNPDEELAATSQLESGNYPYGIYTIPEISMVGQTE----QQLTKDCVNYEIGIAKYSELA  400

Query  521  WSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNV  580
                    A G+  +    DT +   V G H +G  A E+     +AM +G +     + 
Sbjct  401  KGQMMGAMAGGTLKILFDPDTLK---VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDA  457

Query  581  VGIHPTTAEIF  591
            V  +PT AE +
Sbjct  458  VFNYPTLAEAY  468

>HYAP_04149
Length=564

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 127/517 (25%), Positives = 223/517 (43%), Gaps = 75/517 (15%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ ++AK+G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFRE  104

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
            ++L        A   G +   ++     +L+ VN   K+     + +L    V+      
Sbjct  105  AALHLTGYRHRAFYNGQAGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLITGTA  164

Query  249  SFV--DAHTLELW-------------HPKKGT--KTVTTRDVVIAVGGRPK-----PLSC  286
             F+  ++H + +              H       + +T  + ++ VG RP      P   
Sbjct  165  RFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIPFD-  223

Query  287  EGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRG  342
              GE    SD + W   K  P + +V+GA  V +E A  M  + G DV ++  R  +L  
Sbjct  224  --GETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEM  281

Query  343  FDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNA  402
             D++++  +   M  ++   F+   V +S+ K   G++ V   S    +     D +L  
Sbjct  282  ADKEVSEALCYSM-AQTGTRFLVDEVIKSVEKSAKGEVGVHLESGKTVVG----DGLLYT  336

Query  403  TGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFA---------IGDVIDAPEL  452
             GR  +V  LNL++VG+  + K GRI V N  QT+VP+++A          GD+I  P L
Sbjct  337  VGRQGNVEGLNLEAVGLAPD-KRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPAL  395

Query  453  TPVAIQAGRM------LARRLYNNETA----LMDYDKVCTAVFTPIEYGCCGLSEEASIE  502
               +++ GR+       ++  Y  E +    + D D+V T + +  E    G+     I 
Sbjct  396  ASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEIS  454

Query  503  KFGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVVGFHYLG  554
              G+++ ++  +   P E  ++  +  A G        ++K+I C  T    ++G H +G
Sbjct  455  MVGKNEQQLTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKTLK--LLGVHAIG  511

Query  555  PNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
              A E+     + M    T +   N V  +PT AE +
Sbjct  512  EGATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>PYAP_19148
Length=535

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 121/520 (23%), Positives = 222/520 (43%), Gaps = 80/520 (15%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIVIG G  G  C+ + AK+GK V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  189  SSLIGETIHKDAAAF-GWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  247
            + ++  T H+  + + G S  +++F    +L+ V     +     + +L    ++  N  
Sbjct  63   A-ILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIELINGT  121

Query  248  GSFVDAHTLEL--------WHPKKGTKTVTTRDV---------------------VIAVG  278
              F+   + ++        +     TK  T+ D+                     ++AVG
Sbjct  122  ARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKFLVAVG  181

Query  279  GRPK-----PLSCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYD  330
             RP      P     G+    SD I W      P + +V+GA  + +E A  M  + G +
Sbjct  182  TRPARRADIPFD---GKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSE  238

Query  331  VKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDG  389
            V ++  R  +L   D+++A  +   M  ++   F       ++ K  +G+++VK  S   
Sbjct  239  VTVIDGRKEILDMADKEVAEALKYAMR-QTGTRFYTDETINTVEKAANGEVIVKLNSGKT  297

Query  390  DICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVID  448
             +     D +L   GR  +   LNL +VG++ + K G + V  N +TSVP+I+A GD I 
Sbjct  298  IVG----DGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCIG  352

Query  449  APELTPVAIQAGRM----------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEE  498
             P L   +++ GR+          + ++  +NE +   Y +          +G   + E 
Sbjct  353  YPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE-  411

Query  499  ASIEKFGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVICDTTRNKHVVGFH  551
              I   G+ + ++  +N  P E  ++  +  A G        ++K++    ++  V+G H
Sbjct  412  --ISMVGKSEQQLTRENI-PYEVGVARYEELAKGQMLGGVPGFLKIVF-CPKSLQVLGVH  467

Query  552  YLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  468  AIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>CCA14030
Length=560

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 126/535 (24%), Positives = 220/535 (41%), Gaps = 84/535 (16%)

Query  110  SPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTW  169
            SP   ++   + D   +  YDLIV+G G  G  C+ ++AK+GK V ++D  +        
Sbjct  36   SPKTAVLTDMLRDLKASEHYDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKNEMH------  89

Query  170  GLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAF-GWSVGEQKFDWAQMLKSVNSYIKSI  228
              GG CV+ G +P K   ++ ++  T H+    + G S  +++F    +L  V     + 
Sbjct  90   --GGVCVHTGTVPSKTFREA-ILHLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAE  146

Query  229  NFKYKVELRDKKVKYENLLGSFVDAHTLEL------------------WHPKKGTKTVTT  270
                + +L    V+  N    F+   +  +                  +      + +T 
Sbjct  147  TDITRHQLVRNNVELINGTARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTA  206

Query  271  RDVVIAVGGRP--KPLSCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKG  326
               +IAVG RP  +      G++   SD I W   K  P + +V+GA  + +E A  M  
Sbjct  207  DKFLIAVGTRPARRDDVVFDGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSI  266

Query  327  M-GYDVKIMV-RSILLRGFDQDMASKI-------GEFMEVESKIEFIR-GAVPQSITKLE  376
            + G  V ++  R  +L   D+++   +       G    +E  I+ +      + IT L 
Sbjct  267  IPGAQVTVIDGRKEILEMADREVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVITHLN  326

Query  377  SGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQT  435
            SG+ +V              D +L   GR  +   L+L ++G++ + K G I V  N QT
Sbjct  327  SGKTVVG-------------DGLLYTVGRQGNTEGLDLSAIGLETD-KRGLIKVNENFQT  372

Query  436  SVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNN-----------------ETALMDYD  478
            SVP+I+A GD    P L   +++ GR+ +  +  +                  T +   D
Sbjct  373  SVPHIYAAGDCTGFPALASTSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGD  432

Query  479  KVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAG-SCYVKV  537
                 ++T  E    G +E   + K G     I ++        L+  +   G   ++K+
Sbjct  433  FFPFGIYTVPEISMVGKNEH-QLTKEG-----IAYEVGVARYEELAKGQMLGGVPGFLKI  486

Query  538  I-CDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            I C TT N  ++G H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  487  IFCPTTLN--ILGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PYVX_23499
Length=519

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 122/509 (24%), Positives = 217/509 (43%), Gaps = 66/509 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DLIV+G G  G  C+ ++AK+GK V ++D            LGG CV+ G +P K   +
Sbjct  15   FDLIVVGSGPAGQKCAIDSAKHGKSVAIIDKRDM--------LGGVCVHTGTVPSKTFRE  66

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNS-------YIKSINFKYKVELRDKKV  241
            ++L        A     SV  ++ +   +L+ V+          +    +  VEL     
Sbjct  67   ATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELIHGTA  126

Query  242  KY-----ENLLGSFVDAHTLELWHPKKGT------KTVTTRDVVIAVGGRPK-----PLS  285
            ++      N++    +A        K+ T      + +T    +I VG RP      P  
Sbjct  127  RFLPDEKRNMVAVLSNAKYDTPTDAKRHTSADICKRVLTADKFLICVGTRPARREDIPFD  186

Query  286  CEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLR  341
               G+    SD + W   K AP + +V+GA  + +E A  M  + G +V ++  R  +L 
Sbjct  187  ---GKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEILD  243

Query  342  GFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLN  401
              D++++  +   M  ++   F      + + K E+G+++    S  G +     D +L 
Sbjct  244  MADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLNS--GKVI--VGDGLLY  298

Query  402  ATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVAIQAG  460
              GR  +   LNL +VG++ + K G + V ++ QT VP+I+A GD I  P L   +++ G
Sbjct  299  TLGRQGNTDGLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSMEQG  357

Query  461  RMLARRLYNN-------ETALMDYDKVCTAVFTPIEYGCC---GLSEEASIEKFGEDKLE  510
            R+ +  +          E A  +       +   +  G     G+     I   G+++ +
Sbjct  358  RLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVGKNEQQ  417

Query  511  IYHQNFTPLEWSLSSDRQAAGSC-------YVKVI-CDTTRNKHVVGFHYLGPNAGEVTQ  562
            +  +N  P E  L+   + A          ++K+I C  T    V+G H +G  A E+  
Sbjct  418  LTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDTLK--VLGVHAIGEGATEIIH  474

Query  563  AIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
               + M  G T +   N V  +PT AE +
Sbjct  475  IGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>PHYSO_489418
Length=471

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 116/463 (25%), Positives = 203/463 (44%), Gaps = 52/463 (11%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKF---DWAQMLKSVNSYIKS  227
            +GG CV+ G +P K   +++L        A   G +   ++F   D  Q +K V      
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  228  IN----FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDV----------  273
            I      +  V+L +   ++       V   + E +      K  T+ D+          
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  274  VIAVGGRP--KPLSCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-G  328
            ++ VG RP  +P     GE    SD + W   K  P + +V+GA  V +E A  M  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPG  181

Query  329  YDVKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSS  387
             DV ++  R  +L   D++++  +   M  ++   F+ G   +S+ K   G++ V   S 
Sbjct  182  TDVTVIDGRQEILNMADKEVSEALCYSM-AQTGTRFLVGETIKSVEKTPKGEVFVHLESG  240

Query  388  DGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDV  446
               +     D +L   GR  +V  LNL++VG+ +  K GRI V N  QT+VP+I+A GD+
Sbjct  241  KTVVG----DGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIYAAGDI  295

Query  447  IDAPELTPVAIQAGRM----------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLS  496
            I  P L   +++ GR+          L  +  +++  + D D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  497  EEASIEKFGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVV  548
                I   G+++ ++  +   P E  ++  +  A G        ++K+I C  T    ++
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFCPETLK--IL  411

Query  549  GFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            G H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  412  GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>H257_07450
Length=567

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 99/375 (26%), Positives = 168/375 (45%), Gaps = 50/375 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +DL+VIG G  G  C+ ++AK+GKKV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  189  SSLIGETIHKDAAAFG----WSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYE  244
            + ++  T H+    +G     S   ++    ++L  V     +     + +L    +   
Sbjct  91   A-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNGIILI  149

Query  245  NLLGSFV---DAHTLELWHPKKGT---------------KTVTTRDVVIAVGGRP--KPL  284
            N    F+   D  T+ +      T               + +T   V+IAVG RP  +P 
Sbjct  150  NGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRPD  209

Query  285  SCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILL  340
                G L   SD + W      P + +V+GA  + +E A  +  + G  V ++  R  +L
Sbjct  210  LDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEIL  269

Query  341  RGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLES---GQLLVKWVSSDGDICEEAFD  397
               D++++  +  +M         R    +SI K+E+    ++LV   S  G +     D
Sbjct  270  DMADKEVSDALCYYMRKRGS----RFLTEESIVKVETKDNSEVLVYLTS--GKVI--VGD  321

Query  398  TVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDVIDAPELTPVA  456
             +L   GR  +VA L+L++VG+  N K G + V N  QT VP+I+A GD I  P L   +
Sbjct  322  ALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTS  380

Query  457  IQAGRMLARRLYNNE  471
            ++ GR+ +  +  +E
Sbjct  381  MEQGRLASVHMRTSE  395

>PITG_01778
Length=470

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 113/463 (24%), Positives = 201/463 (43%), Gaps = 52/463 (11%)

Query  171  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQKF---DWAQMLKSVNSYIKS  227
            LGG CV+ G +P K   +++L        A   G +   ++F   D  Q ++ V      
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  228  IN----FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDV----------  273
            I      +  V+L +   ++     + V   + E +      K  T+ D+          
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  274  VIAVGGRP--KPLSCEGGELAISSDDIFW--RKEAPGKTLVIGASYVALECAGFMKGM-G  328
            ++ VG RP  +P     GE    SD + W   K  P + +++GA  V +E A  M  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIPG  181

Query  329  YDVKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSS  387
             DV ++  R  +L   D+ ++  +   M  ++   F+ G   +S+ K   G++     S 
Sbjct  182  TDVTVIDGRQEILNMADKQVSEALCYSM-AQTGTRFLTGETIKSVEKSPKGEVFAHLESG  240

Query  388  DGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFAIGDV  446
               +     D +L   GR  +V  LNL++VG+  + K GRI V N  QT+VP+I+A GD+
Sbjct  241  KTVVG----DGLLYTVGRQGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAVPHIYAAGDI  295

Query  447  IDAPELTPVAIQAGRMLARRL----------YNNETALMDYDKVCTAVFTPIEYGCCGLS  496
            I  P L   +++ GR+ +  +           +++  + D D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  497  EEASIEKFGEDKLEIYHQNFTPLEWSLSS-DRQAAGSC------YVKVI-CDTTRNKHVV  548
                I   G+++ ++  +   P E  ++  +  A G        ++K+I C  T    + 
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK--IF  411

Query  549  GFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            G H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  412  GVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PYAR_16664
Length=577

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 179/409 (44%), Gaps = 72/409 (18%)

Query  108  DESPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGT  167
            D + T   ++  + D   +  +DLIVIG G  G  C+ + AK+GK V ++D         
Sbjct  43   DSAATRKPLSELLQDLKASEHFDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------K  94

Query  168  TWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAF-GWSVGEQKF---DWAQMLKSVNS  223
               +GG C++ G +P K   ++ ++  T H+  + + G S  +++F   D  Q ++ V S
Sbjct  95   RDMVGGVCIHTGTVPSKTFREA-ILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVES  153

Query  224  YIKSIN----FKYKVELRDKKVKYE------------------NLLGSFVDAHTLEL---  258
                I      +  +EL +   ++                   N    F+   ++++   
Sbjct  154  AETDITRHQLLRNGIELINGTARFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAV  213

Query  259  -----WHPKKGTKTVTTRDV----------VIAVGGRPK-----PLSCEGGELAISSDDI  298
                 +     TK  T+ D+          +IAVG RP      P     G+    SD I
Sbjct  214  LSNDSYDTPTDTKRHTSADICKRVLTADKFLIAVGTRPARREDIPFD---GKTIFDSDQI  270

Query  299  FW--RKEAPGKTLVIGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEF  354
             W      P + +V+GA  + +E A  M  + G +V ++  R  +L   D+++A  +   
Sbjct  271  LWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEALKYA  330

Query  355  MEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNL  414
            M  +S   F      +S+ K  +G+++VK  S    I     D +L   GR      LNL
Sbjct  331  MR-QSGTRFYTDETIKSVEKAANGEVIVKLNSGKTIIG----DGLLYTVGRQGSTDGLNL  385

Query  415  DSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDVIDAPELTPVAIQAGRM  462
             +VG++ + K G + V  N +TSVP+I+A GD I  P L   +++ GR+
Sbjct  386  AAVGLETD-KRGLLQVDDNFRTSVPHIYAAGDCIGYPALASTSMEQGRL  433

>HYAP_08069
Length=255

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 100/214 (47%), Gaps = 17/214 (8%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYG-KKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLM  186
            DYDL+VIGGG GG   + +AA+ G K  CV    K         LGGTC+NVGCIP K +
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVESRGK---------LGGTCLNVGCIPSKAL  84

Query  187  HQSSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENL  246
              S+ +  T   +  ++G        ++ QM+K+    ++++    +      KV Y   
Sbjct  85   LHSTHLLHTAQHEFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKG  144

Query  247  LGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGELAISSDDIFW  300
            +G       + +    ++G  T+T +++++A G       P P+  + G++ + S     
Sbjct  145  VGKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGALA  203

Query  301  RKEAPGKTLVIGASYVALECAGFMKGMGYDVKIM  334
                P   +V+GA  + LE     K +G  V ++
Sbjct  204  LTRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PHYSO_562795
Length=415

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 154/332 (46%), Gaps = 28/332 (8%)

Query  274  VIAVGGRP--KPLSCEGGELAISSDDIFWR--KEAPGKTLVIGASYVALECAGFMKGM-G  328
            +IA G RP   PL    G++ I SD I  R   + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  329  YDVKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSS  387
            + V ++  R  +L   D+++ S +   M+  +   F+ G   +++ K+E+ +  VK    
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFLLG---ETVKKVETTENRVKVFFD  195

Query  388  DGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQTSVPNIFAIGDV  446
             G +   + D +L   GR      LNL++VG+  N + G I V  N QT  P+I+A GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  447  IDAPELTPVAIQAGRMLARRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASI  501
            I AP L   +++ GR+ +  ++N +     T+ +D       ++T  E    G +E    
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTE----  308

Query  502  EKFGED--KLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGE  559
            ++  +D    E+    ++ L         A G+  +    DT +   + G H +G  A E
Sbjct  309  QQLTKDCVNYEVGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK---LFGVHAIGEGATE  365

Query  560  VTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            +     +AM +G +     + V  +PT AE +
Sbjct  366  IIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>PITG_19065
Length=416

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 101/404 (25%), Positives = 175/404 (43%), Gaps = 43/404 (11%)

Query  217  MLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHP---KKGTKTVTTRDV  273
            +L  V   + S     + +L+  +V        F + H + +      KK   +VT R  
Sbjct  9    ILYRVQRVVSSEEDVVRAQLKAARVDVVPGFARFENEHEISIVRDEDDKKKNSSVTGRSN  68

Query  274  V------------IAVGGRP--KPLSCEGGELAISSDDIFWR--KEAPGKTLVIGASYVA  317
            V            IA G RP   PL    G++ I SD I  R   + P   +V+GA  + 
Sbjct  69   VDSLSRIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIVLGAGVIG  128

Query  318  LECAGFMKGM-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKL  375
            +E A  +  + G+ V ++  R  +L   D+++ S +   M+  +   F+ G   +++ K+
Sbjct  129  MEYASMVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQ-SNGARFLLG---ETVKKV  184

Query  376  ESGQLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVT-NEQ  434
            E+    VK   + G     + D +L   GR      LNL++VG+  N + G I V  N Q
Sbjct  185  ETTDKRVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQ  241

Query  435  TSVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNE-----TALMDYDKVCTAVFTPIE  489
            T  P+I+A GD I AP L   +++ GR+ +  ++N +     T+ ++       ++T  E
Sbjct  242  TDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPYGIYTIPE  301

Query  490  YGCCGLSEEASIEKFGED--KLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHV  547
                G +E    ++  +D    EI    ++ L         A G+  +    DT +   V
Sbjct  302  ISMVGQTE----QQLTKDCVNYEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTLK---V  354

Query  548  VGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             G H +G  A E+     +AM +G +     + V  +PT AE +
Sbjct  355  FGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>SPRG_04114
Length=376

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 86/333 (26%), Positives = 160/333 (48%), Gaps = 31/333 (9%)

Query  271  RDVVIAVGGRP--KPLSCEGGELAISSDDIFWRK--EAPGKTLVIGASYVALECAGFMKG  326
            +  ++A G RP   PL    G++ + SD I      + P   +V+GA  + +E A  +  
Sbjct  43   KKFLVACGTRPAHSPLVPCDGKIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNV  102

Query  327  M-GYDVKIMV-RSILLRGFDQDMASKIGEFMEVESK-IEFIRGAVPQSITKLESGQLLVK  383
            + G +V ++  R+ +L   D ++ S +   ME+  K   F+ G   +S+   ++G + V+
Sbjct  103  LPGINVTVVDGRAEILSFCDDEIVSSLK--MEMRHKGARFLLGESIKSVEHFKNG-VKVE  159

Query  384  WVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNE-QTSVPNIFA  442
            + S      E     +L   GR  +   LNL++VG+  N + G I V  + QTS P+I+A
Sbjct  160  FNSGKAMFAE----ALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYA  214

Query  443  IGDVIDAPELTPVAIQAGRMLARRLYNNE---TALMDYDKVCTAVFTPIEYGCCGLSEEA  499
             GD I AP L   +++ GR+ A  +++++   T+ ++       ++T  E    G +E+ 
Sbjct  215  AGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQ-  273

Query  500  SIEKFGEDKLEIYHQNFTPL-EWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAG  558
             + K G +   +    F+ L +  +S D +      +K++ D   +  ++G H +G  A 
Sbjct  274  QLTKEGAN-YAVGLAKFSELAKGQMSGDIEG----ILKLLFDPV-SLQLLGVHAIGHGAT  327

Query  559  EVTQ--AIGLAMKLGFTYDDMVNVVGIHPTTAE  589
            E+     + +AM    TY    + V  +PT AE
Sbjct  328  EIIHIGQVAMAMNCKITY--FRDAVFNYPTLAE  358

>HYAP_13613
Length=423

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 91/216 (42%), Gaps = 28/216 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            YDL+VIG G     C+ ++AK GK+V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  189  SSLIGETIHKDAAAFGWSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  248
             +++  + ++    +G S   +      +L  V   + S     + +L+  +V       
Sbjct  85   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  143

Query  249  SFVDAHTLELWH---PKKGTKT------------VTTRDVVIAVGGRP--KPLSCEGGEL  291
             F  AH + +      K   +T            V     ++A G RP   PL    G++
Sbjct  144  RFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKI  203

Query  292  AISSDDIFWR--KEAPGKTLVIGASYVALECAGFMK  325
             I SD I  R  ++ P   +V+GA  + +E A  + 
Sbjct  204  VIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMIN  239

>PPTG_24712
Length=67

 Score = 52.8 bits (125),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 47/67 (70%), Gaps = 5/67 (7%)

Query  124  NVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            +V YDY  +VIGGGSGG+A ++ AA +G KV V++  +   G    GLGGTCVN GC+PK
Sbjct  4    DVVYDY--MVIGGGSGGMASARRAATFGAKVLVVERGREFDG---MGLGGTCVNFGCVPK  58

Query  184  KLMHQSS  190
            K+M  ++
Sbjct  59   KVMFNTA  65

>PITG_19802
Length=185

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 70/156 (45%), Gaps = 7/156 (4%)

Query  436  SVPNIFAIGDVIDAPELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGL  495
            SVP IFAIGDVI    L   A + G      +       ++Y  +   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGK  81

Query  496  SEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGP  555
            +EE    +   + +E Y+    P+  +  +   A     VKV+ D   +K ++G H +  
Sbjct  82   TEE----ELKAEGIE-YNVGKFPMMANSRARTIAEADGLVKVLADKKTDK-LLGVHIIAG  135

Query  556  NAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            NAGE+     + ++ G   +D+      HPT +E F
Sbjct  136  NAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>SPRG_04231
Length=90

 Score = 45.8 bits (107),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 0/52 (0%)

Query  543  RNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIFTTL  594
            ++K VVG H  G  A E+ Q  G+A+K+G    D  N+V IHPT +E   T+
Sbjct  9    KDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>PYIW_27568
Length=128

 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 10/119 (8%)

Query  475  MDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC-  533
            ++Y+ +   ++T  E    G +EE       + K E    N        +S  +A G   
Sbjct  4    VNYNAIPGVIYTFPEVASVGKTEE-------QLKEEGVAYNVGKFPMMANSRARAVGEAD  56

Query  534  -YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
              VKVI D   +K ++G H +  NAGE+     L M+ G   +D+      HPT +E F
Sbjct  57   GLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>SPRG_18643
Length=85

 Score = 38.9 bits (89),  Expect = 0.008, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +DL+VIG G  G  C+ ++AK+GKKV ++D
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>SDRG_05159
Length=551

 Score = 39.3 bits (90),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query  115  MVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGT  174
            M A   V  ++T  +D +++GGG  GL  +   AK GK VCVL+            LGG 
Sbjct  1    MQATHAVRQHLTRQWDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGA  52

Query  175  CVNVGCIPKKLMHQSSLI  192
             V    IP     ++S +
Sbjct  53   AVTEEIIPDFHFSRASYV  70

>CCI40989
Length=552

 Score = 38.1 bits (87),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query  121  VDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGC  180
            +D  +   +D ++IGGG  GL  +   AK GK+VCVL+            +GG  V    
Sbjct  6    IDHIIRKKWDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEI  57

Query  181  IPKKLMHQSSLIGETIHKD  199
             P  L  ++S +      D
Sbjct  58   FPGFLFSRASYVFSLFRPD  76

>PYAP_15943
Length=139

 Score = 35.8 bits (81),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D +V+GGG  GL  +   AK GK+VCVL+
Sbjct  14   WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>HYAP_08068
Length=100

 Score = 35.0 bits (79),  Expect = 0.24, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 1/57 (2%)

Query  535  VKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
            VKV+ D   +K ++G H +  NAGE+     + ++ G   +D+      HPT +E F
Sbjct  16   VKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  71

>PITG_02760
Length=165

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D IV+GGG  GL  +   AK GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>SPRG_08354
Length=550

 Score = 37.0 bits (84),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 35/78 (45%), Gaps = 8/78 (10%)

Query  115  MVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGT  174
            M A  V   ++   +D +++GGG  GL  +   AK GK VCVL+            LGG 
Sbjct  1    MQATHVAAQHLARKWDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGA  52

Query  175  CVNVGCIPKKLMHQSSLI  192
             V    IP     ++S +
Sbjct  53   AVTEEIIPNFHFSRASYV  70

>PYU1_G004385
Length=562

 Score = 36.6 bits (83),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D IV+GGG  GL  +   AK GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PYVX_18330
Length=558

 Score = 36.2 bits (82),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D IV+GGG  GL  +   AK GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PHYKE_5677
Length=211

 Score = 35.4 bits (80),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D IV+GGG  GL  +   AK GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>H310_07705
Length=546

 Score = 36.2 bits (82),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (47%), Gaps = 8/64 (13%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQ  188
            +D IV+GGG  GL  +   AK GK VCVL+            LGG  V    +P     +
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  189  SSLI  192
            +S +
Sbjct  64   ASYV  67

>H310_06296
Length=590

 Score = 35.8 bits (81),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGT-TWGLGGTCVNVG  179
            D D+IVIG G GGL  +   AK GK+V VL+    + G T T+  GG   + G
Sbjct  62   DLDVIVIGSGMGGLTVAAALAKEGKRVLVLEQHDVAGGNTHTFEEGGYEFDTG  114

>PPTG_05518
Length=554

 Score = 35.4 bits (80),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D IV+GGG  GL  +   AK GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>SPRG_04526
Length=334

 Score = 34.7 bits (78),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 43/102 (42%), Gaps = 13/102 (13%)

Query  95   KAATHTSSPFFGKDESPTPTMVAAPVVDDNVT------YDY---DLIVIGGGSGGLACSK  145
            KA    S+PF G   +P      A V  +  T      YDY   D+I+ G GS GL  + 
Sbjct  39   KANNARSTPFDGYTFAPVKE---AEVSREMTTRYMKDMYDYADSDVIIAGAGSAGLCAAY  95

Query  146  EAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            E +KY      +     +PGG  W LGG   +   + K   H
Sbjct  96   ELSKYPNVRVAIIEQSVAPGGGAW-LGGQLFSSMIVRKPAHH  136

>SPRG_17626
Length=148

 Score = 33.5 bits (75),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (43%), Gaps = 10/119 (8%)

Query  475  MDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLEIYHQNFTPLEWSLSSDRQAAGSC-  533
            ++Y+ +   V+T  E    G +EE       E K      N        +S  +  G   
Sbjct  24   VNYNAIPGVVYTFPEVASVGKTEE-------ELKAANVAYNVGKFPMMANSRARTVGETD  76

Query  534  -YVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDDMVNVVGIHPTTAEIF  591
             +VK++     +K ++G H +  NAGE+     L ++ G + +D+      HPT +E F
Sbjct  77   GFVKILAAKDDDK-ILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>PHYRA_48183
Length=532

 Score = 34.7 bits (78),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  130  DLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            D IV+GGG  GL  +   AK GK VCVL+
Sbjct  1    DAIVVGGGHNGLVAAAYLAKAGKSVCVLE  29

>PYIW_14781
Length=339

 Score = 34.3 bits (77),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGG  173
            D D+I+ G GS GL  + E +KY      L     +PGG  W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>PYIR_13610
Length=339

 Score = 34.3 bits (77),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGG  173
            D D+I+ G GS GL  + E +KY      L     +PGG  W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>PYU1_G009988
Length=284

 Score = 33.9 bits (76),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGG  173
            D D+I+ G GS GL  + E +KY      L     +PGG  W LGG
Sbjct  28   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  72

>PPTG_16294
Length=406

 Score = 33.9 bits (76),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  125  VTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            VT  YD++++G G  G A +  AAK GK+V VL+
Sbjct  2    VTAVYDVVIVGAGLMGSAAAYYAAKQGKRVLVLE  35

>SDRG_11906
Length=334

 Score = 33.5 bits (75),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (47%), Gaps = 1/60 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMH  187
            D D+I+ G GS GL  + E +KY      +     +PGG  W LGG   +   + K   H
Sbjct  78   DSDVIIAGAGSAGLCAAYELSKYPNIRVAIIEQSVAPGGGAW-LGGQLFSSMIVRKPAHH  136

>SDRG_06501
Length=623

 Score = 33.9 bits (76),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query  111  PTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            PTP        + N   D D+I+IGGG+ G A +   AK GKKV V +
Sbjct  109  PTPKYTNDKYTEAN--RDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>PHYSO_261176
Length=541

 Score = 33.5 bits (75),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            ++ IV+GGG  GL  +   AK GK VCVL+
Sbjct  12   WNAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>SPRG_11641
Length=623

 Score = 33.9 bits (76),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query  111  PTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            PTP        + N   D D+I+IGGG+ G A +   AK GKKV V +
Sbjct  109  PTPKYTNDKYTEAN--RDADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

>H257_04036
Length=1049

 Score = 33.1 bits (74),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query  130  DLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQS  189
            D+++ GGG+G  +C  +  + G     ++++   P GTT  + G  + VG  P+ L H  
Sbjct  442  DVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGLPLTVGAAPRPLAHGD  496

Query  190  SL  191
            +L
Sbjct  497  TL  498

>SPRG_08717
Length=387

 Score = 32.7 bits (73),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 26/59 (44%), Gaps = 4/59 (7%)

Query  447  IDAPELTPVAIQAGRMLA----RRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASI  501
            + A EL    I+ G MLA      LY+  T   DY K+  +   P +Y  CG    A I
Sbjct  149  LPAIELMAWTIKQGHMLAAHSDSHLYDRSTGYCDYVKMGESTIVPPQYASCGRDATADI  207

>SDRG_07672
Length=361

 Score = 32.7 bits (73),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query  205  WSVGEQKFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  264
            + +  Q+FDWA + +S+ S    IN++    + +     EN  G F+ A   ++ H    
Sbjct  201  YQICNQQFDWASIFQSLVSVHPKINYQILTSVSN-----ENRFGFFLKAGDADIHHRGVK  255

Query  265  TKTVTTRD  272
              T T R+
Sbjct  256  VGTWTIRN  263

>PHYCA_565409
Length=551

 Score = 33.1 bits (74),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)

Query  129  YDLIVIGGGSGGLACSKEAAKYGKKVCVLD  158
            +D I++G G  GL  +   AK GK VCVL+
Sbjct  12   WDAIIVGAGHNGLVAAAYLAKAGKSVCVLE  41

>PYAR_13908
Length=634

 Score = 33.1 bits (74),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGG  173
            D D+I+ G GS GL  + E +K+      L     +PGG  W LGG
Sbjct  80   DSDVIIAGAGSAGLVAAYELSKHPNVSVALIEQSVAPGGGAW-LGG  124

>H257_10576
Length=882

 Score = 33.1 bits (74),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 35/73 (48%), Gaps = 5/73 (7%)

Query  101  SSPFFGKDESPTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYV  160
            S PF  +  S TPT    P   D++    D++VIGGGS G +      + G    +L+  
Sbjct  20   SIPFDTRSLSSTPT----PSPRDDLPSSADVVVIGGGSIGASTLYHLGRLGVNAILLEKD  75

Query  161  KPSPGGTTWGLGG  173
            + +  GTTW   G
Sbjct  76   RMT-AGTTWHSAG  87

>PYAP_16450
Length=338

 Score = 32.7 bits (73),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 27/56 (48%), Gaps = 1/56 (2%)

Query  128  DYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPK  183
            D D+I+ G GS GL  + E +K+      L     +PGG  W LGG   +   + K
Sbjct  100  DSDVIIAGAGSAGLVAAYELSKHPNVRVALIEQSVAPGGGAW-LGGQLFSSMIVRK  154

>SDRG_08159
Length=537

 Score = 32.3 bits (72),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 9/85 (11%)

Query  363  FIRGAVPQSITKLESG---QLLVKWVSSDGDICEEAFDTVLNATGRDPDVAKLNLDSVGV  419
             I GA+PQ +++  +    +L +K      D+C EAF T L  T R+    K+ + S G+
Sbjct  416  IIFGALPQWLSRRGTACEIRLAIK-----SDVCAEAFATALAQT-RNSHTVKITIASAGL  469

Query  420  QLNPKTGRIAVTNEQTSVPNIFAIG  444
             L  K   +A     + +  +F+ G
Sbjct  470  SLAAKQQLVAALALTSRMTLVFSSG  494

>SDRG_08246
Length=817

 Score = 32.3 bits (72),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query  110  SPTPTMVAAPVVDDN-----VTYDYDLIVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSP  164
            +P PT +  PV+ D      V    D IV+G G GGL  +   A+ G +V VL+    + 
Sbjct  231  TPRPTRM--PVIQDRYLKSKVPSTLDAIVVGSGIGGLGVAAILARMGWRVLVLEQHDRAG  288

Query  165  GGT  167
            G T
Sbjct  289  GAT  291

Lambda      K        H        a         alpha
   0.318    0.135    0.407    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 47036504913

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40