Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_199711475634834815100.0
PYIR_134511475635936212033e-165
PYU1_G0017351475634235510763e-146
PYAP_17762147563483468646e-114
PHYRA_81100147563493518046e-105
PHYCA_556162147563513518038e-105
PHYSO_471523147563483517985e-104
PPTG_17127147563513567924e-103
PITG_18456147563513537909e-103
PHALS_06478147563453517481e-96
PYVX_18171147562943437199e-93
PYAR_13570147563223156888e-88
PHYKE_8393147563263436853e-87
CCA18899147563433386621e-83
CCI45123147563012895331e-64
SPRG_06336147563353224096e-46
SDRG_01781147563353224001e-44
H310_09223147563333213521e-37
H257_06294147563583503349e-35
CCI451271609872022042695e-27
PYVX_204381612813461221226e-06
PHYRA_849161612815411231191e-05
H310_0023012510912481231182e-05
SDRG_1276312510913171081172e-05
PHYSO_3617471612815231241162e-05
HYAP_086451612815141241145e-05
SPRG_0605912510913121281136e-05
H257_0672112510912381291137e-05
PYIR_215891612815681141111e-04
PYAR_2328616128607851101e-04
PYIW_17381161289521141101e-04
PITG_205621612815591021102e-04
PPTG_188981612815591021102e-04
PHYKE_19901612814991201083e-04
H310_00231161281495311073e-04
PYU1_G0063471612810951151055e-04
PYIR_183821526711541211047e-04
SDRG_127621612813921101030.001
PYU1_G008848152677651191020.001
PYAP_186361526710091101010.002
PHYRA_78815169192161010.002
PYAP_16997161281018841010.002
H257_06722161281482311010.002
PHYRA_825431526711991131000.002
SPRG_06058161281258103990.003
PYVX_2334914313924129980.004
PHYSO_55616414313765104970.005
PYAR_15463152671091110970.006
CCI4475216128152637970.006
PYIW_1698715267821111960.006
PITG_1789314313747104960.007
PYVX_18338241774637950.008
PPTG_0455314313904104950.008
PHYRA_7353514313875104950.008
H310_0484315267968114950.008
SPRG_0089015267883135950.010
CCA1887516128151425950.011
PPTG_19371152671195113940.012
SDRG_0140715267815135930.013
PHALS_0669914313884104930.013
PHYRA_73534696861210104930.014
PYIR_1745395112619122930.016
PITG_11303931829328910.016
PHYSO_544598152671163134930.017
H257_0309315267975110920.019
CCI10489158709777145920.019
PYIR_2458885060909123920.019
PPTG_1665916916207910.024
PITG_19213152671201113910.032
SPRG_1702213189210791830.034
PYIW_2110895112593132890.052
PYIW_2190185060913135890.052
SPRG_083462417797139880.055
PYAR_1929185060711120880.056
SDRG_051502417787139880.056
SDRG_0560811092121112820.059
PITG_0002016927154880.066
PYU1_G0010631445978353880.068
HYAP_1368818501036138870.075
SPRG_0250211092121112820.076
SDRG_14487123428964106870.089
PYAP_2347885060897124860.096
CCI46235152671155113860.10
PITG_02109185352249860.10
SPRG_00889122518994130860.11
H310_140199204683104850.12
PYAP_172901445983526850.13
PHYRA_778341445993649850.13
CCA18023152671138107850.13
PYAP_162979511246696850.15
PPTG_14630185339849840.15
CCA223673199885110850.16
PYAP_226462417815143840.18
PYIW_184802417755132840.20
SPRG_060218195983113840.21
PHYKE_24791445917123800.21
PHALS_03645241783032830.22
H257_03361123428699113830.23
PHYKE_666215267765110830.23
PHYRA_79281241780947830.24
PHYSO_344112241781329830.24
PHYKE_5678241780929830.24
PHYCA_506137241781029830.24
PPTG_05519241781029830.24
PITG_02762241781029830.25
HYAP_08026241779827830.25
SDRG_01408122518916129830.25
PHALS_065331445993023830.25
PYU1_G00322916810114830.26
PPTG_1462618501055121830.26
PPTG_1461222900331102820.27
SPRG_02752123428831106830.28
CCI412251445998126820.29
CCA21715241778227820.30
CCA2186015507878227820.30
CCI40991241780127820.31
CCA164871445997526820.31
PHYSO_3436291445997723820.32
PYIR_153091445993726820.32
PYIW_131721445993926820.32
PYU1_G01285918501183117820.32
PPTG_134011445992723820.33
PYAR_199141445978827820.34
PYVX_135741445995023820.34
PITG_180671445992423820.34
PYU1_G00742385060928117820.35
H257_007291109212188760.42
PYIR_144941681946810.42
PYVX_13312152671016105810.42
PYIW_20891185329149800.45
PHYCA_504801185339849800.46
SDRG_055678195980113800.51
CCA190971856688107800.51
SPRG_091281431362039800.53
PYU1_G004386241783732800.54
H310_010941109212188750.55
PHYCA_50311215292621423780.60
SDRG_0215412656882250790.67
PYIR_13120241781429790.68
CCI4208831991007101790.70
PYAP_14828920460492790.75
PYAR_19883241783326790.79
CCI434561109212696740.81
PYAP_13695185334849780.86
CCI4245715292690627790.87
CCA1710215292688430780.87
PYU1_G00411549814465750.90
H257_0982314313654118780.97
SDRG_142861431367039781.1
PYU1_G012870185335249771.1
SPRG_1631213132226147761.1
PHALS_0354016904123771.2
PYAR_186909511245576771.3
HYAP_04457152671203110771.3
H257_0818216859111771.5
H310_077012417811111761.5
CCA1911811092125107721.6
PHALS_06568185338849751.7
SPRG_0883412656882550761.8
H310_063781445983723761.9
PHYSO_48454116911124761.9
H257_075142417810111752.0
PHALS_0409815267118326762.1
H257_135671445983623752.2
H257_140254927243155742.2
PYIR_2225949814464712.4
HYAP_137571151726225732.5
H257_06469219447619682.5
PYIR_13555185335549742.6
PYAP_1956011517337189742.6
SPRG_0293995112161109742.9
PHYSO_4851205725912226702.9
PHYSO_478611185352249742.9
PYAR_2511590331289732.9
PYU1_G01126161471328144742.9
SDRG_14486185330867733.0
PYU1_G0092499511258053743.1
PYVX_145276030126949743.1
PYIW_185912451387135743.2
SPRG_02753185330967733.2
PHYKE_55881675146743.3
H310_14473749061348733.5
HYAP_08248749078426733.6
CCI44571498140107703.7
PITG_033182885134344733.7
HYAP_06101288598444733.8
PHYRA_732975725911924693.9
PYIR_226673199749117733.9
H310_0091295112182111734.1
PPTG_160442885137844734.2
HYAP_09304134791144164734.3
PPTG_16047288164575724.4
PHYSO_2484812885128344734.6
SDRG_0008012454429847714.7
PYU1_G0070133199750107724.9
CCI448572111070143725.0
PHYKE_7856288534644715.1
PHYSO_556902919645424716.0
PHYCA_989485725912421686.0
H310_09363140947195452726.0
PHYRA_73430185339549716.4
SPRG_188075920776189716.5
H257_03521920468559717.0
SDRG_03175640393426717.5
CCI393672885204620717.5
SDRG_021352194430626707.5
PHYCA_5093851255455795707.8
PYVX_14593185096448717.8
SPRG_01654640392326717.9
PHALS_125031151734032708.3
PITG_141971151734933708.4
PPTG_078005725915422678.5
PYIW_202213199584117708.7
CCA2551013479113920708.8
SPRG_0491212454426147699.3
PYAP_188908244912460669.3
PITG_0210618501015125709.5
SPRG_13968129675773127709.9
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_19971

Length=348
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_19971                                                            586        0.0   
PYIR_13451                                                            468        3e-165
PYU1_G001735                                                          419        3e-146
PYAP_17762                                                            337        6e-114
PHYRA_81100                                                           314        6e-105
PHYCA_556162                                                          313        8e-105
PHYSO_471523                                                          311        5e-104
PPTG_17127                                                            309        4e-103
PITG_18456                                                            308        9e-103
PHALS_06478                                                           292        1e-96 
PYVX_18171                                                            281        9e-93 
PYAR_13570                                                            269        8e-88 
PHYKE_8393                                                            268        3e-87 
CCA18899                                                              259        1e-83 
CCI45123                                                              209        1e-64 
SPRG_06336                                                            162        6e-46 
SDRG_01781                                                            158        1e-44 
H310_09223                                                            140        1e-37 
H257_06294                                                            133        9e-35 
CCI45127                                                              108        5e-27 
PYVX_20438                                                            51.6       6e-06 
PHYRA_84916                                                           50.4       1e-05 
H310_00230                                                            50.1       2e-05 
SDRG_12763                                                            49.7       2e-05 
PHYSO_361747                                                          49.3       2e-05 
HYAP_08645                                                            48.5       5e-05 
SPRG_06059                                                            48.1       6e-05 
H257_06721                                                            48.1       7e-05 
PYIR_21589                                                            47.4       1e-04 
PYAR_23286                                                            47.0       1e-04 
PYIW_17381                                                            47.0       1e-04 
PITG_20562                                                            47.0       2e-04 
PPTG_18898                                                            47.0       2e-04 
PHYKE_1990                                                            46.2       3e-04 
H310_00231                                                            45.8       3e-04 
PYU1_G006347                                                          45.1       5e-04 
PYIR_18382                                                            44.7       7e-04 
SDRG_12762                                                            44.3       0.001 
PYU1_G008848                                                          43.9       0.001 
PYAP_18636                                                            43.5       0.002 
PHYRA_78815                                                           43.5       0.002 
PYAP_16997                                                            43.5       0.002 
H257_06722                                                            43.5       0.002 
PHYRA_82543                                                           43.1       0.002 
SPRG_06058                                                            42.7       0.003 
PYVX_23349                                                            42.4       0.004 
PHYSO_556164                                                          42.0       0.005 
PYAR_15463                                                            42.0       0.006 
CCI44752                                                              42.0       0.006 
PYIW_16987                                                            41.6       0.006 
PITG_17893                                                            41.6       0.007 
PYVX_18338                                                            41.2       0.008 
PPTG_04553                                                            41.2       0.008 
PHYRA_73535                                                           41.2       0.008 
H310_04843                                                            41.2       0.008 
SPRG_00890                                                            41.2       0.010 
CCA18875                                                              41.2       0.011 
PPTG_19371                                                            40.8       0.012 
SDRG_01407                                                            40.4       0.013 
PHALS_06699                                                           40.4       0.013 
PHYRA_73534                                                           40.4       0.014 
PYIR_17453                                                            40.4       0.016 
PITG_11303                                                            39.7       0.016 
PHYSO_544598                                                          40.4       0.017 
H257_03093                                                            40.0       0.019 
CCI10489                                                              40.0       0.019 
PYIR_24588                                                            40.0       0.019 
PPTG_16659                                                            39.7       0.024 
PITG_19213                                                            39.7       0.032 
SPRG_17022                                                            36.6       0.034 
PYIW_21108                                                            38.9       0.052 
PYIW_21901                                                            38.9       0.052 
SPRG_08346                                                            38.5       0.055 
PYAR_19291                                                            38.5       0.056 
SDRG_05150                                                            38.5       0.056 
SDRG_05608                                                            36.2       0.059 
PITG_00020                                                            38.5       0.066 
PYU1_G001063                                                          38.5       0.068 
HYAP_13688                                                            38.1       0.075 
SPRG_02502                                                            36.2       0.076 
SDRG_14487                                                            38.1       0.089 
PYAP_23478                                                            37.7       0.096 
CCI46235                                                              37.7       0.10  
PITG_02109                                                            37.7       0.10  
SPRG_00889                                                            37.7       0.11  
H310_14019                                                            37.4       0.12  
PYAP_17290                                                            37.4       0.13  
PHYRA_77834                                                           37.4       0.13  
CCA18023                                                              37.4       0.13  
PYAP_16297                                                            37.4       0.15  
PPTG_14630                                                            37.0       0.15  
CCA22367                                                              37.4       0.16  
PYAP_22646                                                            37.0       0.18  
PYIW_18480                                                            37.0       0.20  
SPRG_06021                                                            37.0       0.21  
PHYKE_2479                                                            35.4       0.21  
PHALS_03645                                                           36.6       0.22  
H257_03361                                                            36.6       0.23  
PHYKE_6662                                                            36.6       0.23  
PHYRA_79281                                                           36.6       0.24  
PHYSO_344112                                                          36.6       0.24  
PHYKE_5678                                                            36.6       0.24  
PHYCA_506137                                                          36.6       0.24  
PPTG_05519                                                            36.6       0.24  
PITG_02762                                                            36.6       0.25  
HYAP_08026                                                            36.6       0.25  
SDRG_01408                                                            36.6       0.25  
PHALS_06533                                                           36.6       0.25  
PYU1_G003229                                                          36.6       0.26  
PPTG_14626                                                            36.6       0.26  
PPTG_14612                                                            36.2       0.27  
SPRG_02752                                                            36.6       0.28  
CCI41225                                                              36.2       0.29  
CCA21715                                                              36.2       0.30  
CCA21860                                                              36.2       0.30  
CCI40991                                                              36.2       0.31  
CCA16487                                                              36.2       0.31  
PHYSO_343629                                                          36.2       0.32  
PYIR_15309                                                            36.2       0.32  
PYIW_13172                                                            36.2       0.32  
PYU1_G012859                                                          36.2       0.32  
PPTG_13401                                                            36.2       0.33  
PYAR_19914                                                            36.2       0.34  
PYVX_13574                                                            36.2       0.34  
PITG_18067                                                            36.2       0.34  
PYU1_G007423                                                          36.2       0.35  
H257_00729                                                            33.9       0.42  
PYIR_14494                                                            35.8       0.42  
PYVX_13312                                                            35.8       0.42  
PYIW_20891                                                            35.4       0.45  
PHYCA_504801                                                          35.4       0.46  
SDRG_05567                                                            35.4       0.51  
CCA19097                                                              35.4       0.51  
SPRG_09128                                                            35.4       0.53  
PYU1_G004386                                                          35.4       0.54  
H310_01094                                                            33.5       0.55  
PHYCA_503112                                                          34.7       0.60  
SDRG_02154                                                            35.0       0.67  
PYIR_13120                                                            35.0       0.68  
CCI42088                                                              35.0       0.70  
PYAP_14828                                                            35.0       0.75  
PYAR_19883                                                            35.0       0.79  
CCI43456                                                              33.1       0.81  
PYAP_13695                                                            34.7       0.86  
CCI42457                                                              35.0       0.87  
CCA17102                                                              34.7       0.87  
PYU1_G004115                                                          33.5       0.90  
H257_09823                                                            34.7       0.97  
SDRG_14286                                                            34.7       1.1   
PYU1_G012870                                                          34.3       1.1   
SPRG_16312                                                            33.9       1.1   
PHALS_03540                                                           34.3       1.2   
PYAR_18690                                                            34.3       1.3   
HYAP_04457                                                            34.3       1.3   
H257_08182                                                            34.3       1.5   
H310_07701                                                            33.9       1.5   
CCA19118                                                              32.3       1.6   
PHALS_06568                                                           33.5       1.7   
SPRG_08834                                                            33.9       1.8   
H310_06378                                                            33.9       1.9   
PHYSO_484541                                                          33.9       1.9   
H257_07514                                                            33.5       2.0   
PHALS_04098                                                           33.9       2.1   
H257_13567                                                            33.5       2.2   
H257_14025                                                            33.1       2.2   
PYIR_22259                                                            32.0       2.4   
HYAP_13757                                                            32.7       2.5   
H257_06469                                                            30.8       2.5   
PYIR_13555                                                            33.1       2.6   
PYAP_19560                                                            33.1       2.6   
SPRG_02939                                                            33.1       2.9   
PHYSO_485120                                                          31.6       2.9   
PHYSO_478611                                                          33.1       2.9   
PYAR_25115                                                            32.7       2.9   
PYU1_G011261                                                          33.1       2.9   
SDRG_14486                                                            32.7       3.0   
PYU1_G009249                                                          33.1       3.1   
PYVX_14527                                                            33.1       3.1   
PYIW_18591                                                            33.1       3.2   
SPRG_02753                                                            32.7       3.2   
PHYKE_5588                                                            33.1       3.3   
H310_14473                                                            32.7       3.5   
HYAP_08248                                                            32.7       3.6   
CCI44571                                                              31.6       3.7   
PITG_03318                                                            32.7       3.7   
HYAP_06101                                                            32.7       3.8   
PHYRA_73297                                                           31.2       3.9   
PYIR_22667                                                            32.7       3.9   
H310_00912                                                            32.7       4.1   
PPTG_16044                                                            32.7       4.2   
HYAP_09304                                                            32.7       4.3   
PPTG_16047                                                            32.3       4.4   
PHYSO_248481                                                          32.7       4.6   
SDRG_00080                                                            32.0       4.7   
PYU1_G007013                                                          32.3       4.9   
CCI44857                                                              32.3       5.0   
PHYKE_7856                                                            32.0       5.1   
PHYSO_556902                                                          32.0       6.0   
PHYCA_98948                                                           30.8       6.0   
H310_09363                                                            32.3       6.0   
PHYRA_73430                                                           32.0       6.4   
SPRG_18807                                                            32.0       6.5   
H257_03521                                                            32.0       7.0   
SDRG_03175                                                            32.0       7.5   
CCI39367                                                              32.0       7.5   
SDRG_02135                                                            31.6       7.5   
PHYCA_509385                                                          31.6       7.8   
PYVX_14593                                                            32.0       7.8   
SPRG_01654                                                            32.0       7.9   
PHALS_12503                                                           31.6       8.3   
PITG_14197                                                            31.6       8.4   
PPTG_07800                                                            30.4       8.5   
PYIW_20221                                                            31.6       8.7   
CCA25510                                                              31.6       8.8   
SPRG_04912                                                            31.2       9.3   
PYAP_18890                                                            30.0       9.3   
PITG_02106                                                            31.6       9.5   
SPRG_13968                                                            31.6       9.9   

>PYIW_19971
Length=348

 Score = 586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/348 (100%), Positives = 348/348 (100%), Gaps = 0/348 (0%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG
Sbjct  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGGGG  60

Query  61   aSPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK  120
            ASPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK
Sbjct  61   ASPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK  120

Query  121  WVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALRE  180
            WVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALRE
Sbjct  121  WVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALRE  180

Query  181  IEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRS  240
            IEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRS
Sbjct  181  IEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRS  240

Query  241  KPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELE  300
            KPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELE
Sbjct  241  KPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVMSDLERLVLALGELE  300

Query  301  EQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQtkkatatmkaGNLF  348
            EQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNLF
Sbjct  301  EQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGNLF  348

>PYIR_13451
Length=359

 Score = 468 bits (1203),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 261/362 (72%), Positives = 280/362 (77%), Gaps = 17/362 (5%)

Query  1    MNILRVPDMKLATS--HGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagg  58
            MNILRVPD KLATS  +G  GDKFK TSCEGYVTKRGHFRKSWRVRYLVFNGA+LQ A  
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  59   ggaSPA------------TPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  106
                 +             PKGSF+VSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  107  ELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKL  166
            ELDIFVE+LGDLNKWVEVVQNALDAAKK +RT G  D+STTK MFGFSA+ SPQLQVKKL
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180

Query  167  AATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHM  226
            AATKE+LLRDALREIEGAKLIGREAV++I  QG KL+M+E DLGKVE DLDH  KLL HM
Sbjct  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240

Query  227  KRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVM  286
            KRPMLHLFS D R K + H  G+         G  P +            H Q+ D   +
Sbjct  241  KRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQI-HGQRNDA--L  297

Query  287  SDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQtkkatatmkaGN  346
            SDLE+L LALGELEEQA  MNAEAVKSTEQIARVEQRLTAVNDRVQ QTKKA ATMKAGN
Sbjct  298  SDLEKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGN  357

Query  347  LF  348
            LF
Sbjct  358  LF  359

>PYU1_G001735
Length=342

 Score = 419 bits (1076),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 239/355 (67%), Positives = 272/355 (77%), Gaps = 20/355 (6%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaag---  57
            MNILRVPD KLA S   G +  K TSCEGYVTKRGHFRKSWRVRYLVFNGADLQ +    
Sbjct  1    MNILRVPDAKLAIS---GAEVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYFES  57

Query  58   -gggaSPAT-PKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETL  115
                 +P T PKGSF+VSSVEKHEYW+GVMGG+EKPFGFKLVGHAP KGYIELDIFVE+L
Sbjct  58   RDAAHAPGTVPKGSFYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYIELDIFVESL  117

Query  116  GDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLR  175
             D+NKW+EVVQNALDAAKK TR  G  DS  TK+MFGF A++SPQLQVKKLAATKEELLR
Sbjct  118  PDVNKWLEVVQNALDAAKKLTRK-GMTDS--TKSMFGFGASISPQLQVKKLAATKEELLR  174

Query  176  DALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFS  235
            +ALREIEGAKLIGREAV++I  QG KL+ +E+DLG VE DLDH  KLL H+K P+LH+FS
Sbjct  175  EALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHLKSPVLHVFS  234

Query  236  NDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQ--QDTSVMSDLERLV  293
            NDNR K         +      S +  +S  +S  + T  Q H +       ++DLE L 
Sbjct  235  NDNRQKKG-------APTAATASASGGASATTSPVSGTEGQLHAKITGGGGTLNDLEMLA  287

Query  294  LALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQtkkatatmkaGNLF  348
            LAL ELEEQA  MNAEA +STEQIAR+E+RLT+VNDRVQ QTKKATATMKAGNLF
Sbjct  288  LALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGNLF  342

>PYAP_17762
Length=348

 Score = 337 bits (864),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 232/346 (67%), Gaps = 21/346 (6%)

Query  1    MNILRVPDMKLATSH-------GSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            MNILR+P    ATSH        S     K TSCEGYVTKRGHFRKSWRVR+LV NGADL
Sbjct  1    MNILRLPLG--ATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADL  58

Query  54   -----QaaggggaSPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIEL  108
                  +      + A PKGSF++SSVEKHEY+VGV+G +EKPFGFK+VGHAP+KGY+EL
Sbjct  59   LVSYYDSKEVARTAGAVPKGSFYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRKGYVEL  118

Query  109  DIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAA  168
            DIFVETLGDLNKW+EV QNALDAAKK TRT G  ++   K++FGFS   SPQ Q+KK+ A
Sbjct  119  DIFVETLGDLNKWLEVCQNALDAAKKLTRT-GQPEALAPKSLFGFSPATSPQQQMKKMTA  177

Query  169  TKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKR  228
            TKE++L+ A+ EIE AKLIGR A  +I  QG +L+ I  +L  VE DLD+  KLL HMK 
Sbjct  178  TKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLLRHMKN  237

Query  229  PMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVMSD  288
            P LH+FS+D R +        ++      S   PS+       A  +  H     + +SD
Sbjct  238  PGLHMFSSDARDR------AKNTGRTKPSSRDTPSAVSEETRAAILSDSHDAVGGAPLSD  291

Query  289  LERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            +ERL   LGELE+QAT +N EA+K T Q+ RV ++L  VN+RV+AQ
Sbjct  292  IERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQ  337

>PHYRA_81100
Length=349

 Score = 314 bits (804),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 175/351 (50%), Positives = 221/351 (63%), Gaps = 34/351 (10%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILRVP++    S    GDK + TSCEGYVTKRGHFRKSWRVR+LV  G++LQ +    
Sbjct  1    MNILRVPEIGATAS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYYES  56

Query  61   aS--------PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112
             +        P+ PKGSF++SS+E HEY VGVMG   KPFGFK++GHAPKKGY+ELD+FV
Sbjct  57   RAACHPPAAEPSAPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYVELDVFV  116

Query  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQL------QV  163
            ET GD NKW+EV +NAL A ++ TR   A D   SS  KN+FGF  ++SPQ       Q+
Sbjct  117  ETQGDRNKWLEVARNALSAKRQLTRQ--AIDQSVSSNKKNLFGFGVSLSPQPLMTPQKQM  174

Query  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223
            + L   K+ELL  ALR+IE AKL+GREA ++I  QG KL+ IE DLG ++ DLD G KLL
Sbjct  175  QTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFGDKLL  234

Query  224  NHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDT  283
              +K P LHLFS+D+R K  A    S    +                           + 
Sbjct  235  RRLKSPTLHLFSDDSRPKSTASKGHSPQRSQQSGGSPSRLPPAMETI-----------ND  283

Query  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            + +SDLERL  ALGELE QA  +N EA +ST+QI RVE +L+ V  RV+ Q
Sbjct  284  AGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQ  334

>PHYCA_556162
Length=351

 Score = 313 bits (803),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 223/351 (64%), Gaps = 32/351 (9%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILRVP++  ATS    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ      
Sbjct  1    MNILRVPEVGAATS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYYES  56

Query  61   aS---PAT-----PKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112
             +   P T     PKGSF++SS+E HEY VGVMG   KPFGFK+VGHAPKKGY+ELD+FV
Sbjct  57   RAACHPTTGEASPPKGSFYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYVELDVFV  116

Query  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------QV  163
            ET+GD NKW+EV +NAL A ++ TR   A D S +   KN+FGFS ++SPQ       Q+
Sbjct  117  ETVGDRNKWLEVARNALSAKRQLTRQ--AIDQSVSPNKKNLFGFSVSLSPQPALSPQKQM  174

Query  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223
            + L   K++LL DALR+IE AK IGREA ++I  QG KL+ IE DL  ++ DLD G KLL
Sbjct  175  QTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFGDKLL  234

Query  224  NHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDT  283
              +K P LH+FSND+R K         S      +    S     +     AQ  + +  
Sbjct  235  RRLKSPTLHMFSNDSRPK---------STSSSKANSPQRSQQSGGSSPTRLAQAAESRID  285

Query  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
               SDLERL  ALGELE QA  +N EA  ST+QI  +E  L+ V  RV+ Q
Sbjct  286  PGASDLERLAQALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQ  336

>PHYSO_471523
Length=348

 Score = 311 bits (798),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/351 (49%), Positives = 225/351 (64%), Gaps = 35/351 (10%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILRVP++    S    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++L  +    
Sbjct  1    MNILRVPEVGATAS----GDKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYYES  56

Query  61   aS--------PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112
             +        P+ PKGSF++SS+E HEY VGVMG  EKPFGFK+VGHAP+KGY+ELD+FV
Sbjct  57   RAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYVELDVFV  116

Query  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------QV  163
            ETL D NKW+EV +NAL A ++ TR   A D S +   KN+FGF+ ++SPQ       Q+
Sbjct  117  ETLNDRNKWLEVARNALSAKRQLTRQ--AIDQSVSPNRKNLFGFNISLSPQPNMSPQKQM  174

Query  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223
            + L  +++ELL DALR+IE AK +GREA ++I  QG KL+ IE DL  ++ DLD G KLL
Sbjct  175  QTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFGDKLL  234

Query  224  NHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDT  283
              +K P LHLFS+D+R K +A  + S    +             S             + 
Sbjct  235  RRLKSPTLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSI------------ND  282

Query  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            + +SDLERL  ALGELE QA  +N EA + T+QI R+E +L+ V  RV+ Q
Sbjct  283  AGVSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQ  333

>PPTG_17127
Length=351

 Score = 309 bits (792),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 226/356 (63%), Gaps = 42/356 (12%)

Query  1    MNILRVPDMKLATSHGS--GGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagg  58
            MNILRVP+      HG+   GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ +  
Sbjct  1    MNILRVPE------HGTTASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54

Query  59   ggaS--------PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110
               +        P+ PKGSF++SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+ELD+
Sbjct  55   ESRAACHPPTGEPSAPKGSFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114

Query  111  FVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKN---MFGFSATVSPQL------  161
            FV+TL D NKW+EV +NAL   ++ TR   A D S + N   +FGFS  +SPQ       
Sbjct  115  FVDTLADRNKWLEVARNALSVKRQLTRQ--AIDQSVSPNKKTLFGFSVALSPQPAMSPQK  172

Query  162  QVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGK  221
            Q++ LA +K+ELL +ALRE+E AKL+GREA ++I  QG KL+ IE DL  ++ DLD G K
Sbjct  173  QMQTLAKSKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFGDK  232

Query  222  LLNHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQ  281
            LL  +K P LHLFS+D+R K      GS         G+ PS    +             
Sbjct  233  LLRRLKSPTLHLFSDDSRPKSTGGSKGSSPQRFHQSGGSSPSRLPPAF------------  280

Query  282  DTSV---MSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            DTS     SDLERL  ALGELE QA  +N EA  S++QI R+E  LT V  RV+ Q
Sbjct  281  DTSSDAGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQ  336

>PITG_18456
Length=351

 Score = 308 bits (790),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 178/353 (50%), Positives = 230/353 (65%), Gaps = 36/353 (10%)

Query  1    MNILRVPDMKLATSHGS--GGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagg  58
            MNILRVP+      HG+   GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ +  
Sbjct  1    MNILRVPE------HGATASGDKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54

Query  59   ggaS--------PATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110
               +        P+ PKG F++SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+ELD+
Sbjct  55   ESRAACHPPIGQPSAPKGIFYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYVELDV  114

Query  111  FVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTT---KNMFGFSATVSPQL------  161
            FV+TL D NKW+EV +NAL A ++ TR   A D S +   KN+FGFS ++SPQ       
Sbjct  115  FVDTLADRNKWLEVARNALGAKRQLTRQ--AIDQSVSPGKKNLFGFSVSLSPQPAMSPQK  172

Query  162  QVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGK  221
            Q++ L+ +K+ELL  ALRE+E AKL+GREA ++I  QG KL+ IE DL  ++ DLD G K
Sbjct  173  QIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFGDK  232

Query  222  LLNHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQ  281
            LL  +K P LHLFS+D+R K      GS         G+ P+    + E ++        
Sbjct  233  LLRRLKSPTLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPTRLPPALEISS--------  284

Query  282  DTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            D  V SDLERL  ALGELE QA  +N EA +S++QI R+E  LT V  RV+ Q
Sbjct  285  DAGV-SDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVEKQ  336

>PHALS_06478
Length=345

 Score = 292 bits (748),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 217/351 (62%), Gaps = 38/351 (11%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILR+P+     S    GDK + TSCEGYVTKRGHFRKSWRVR+LV +G++LQ A    
Sbjct  1    MNILRLPEPGATAS----GDKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYYES  56

Query  61   aSPA--------TPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFV  112
             +           PKGSF++S++E HEY +GVMG  ++PFGFK+VGHAP+KG++ELD+FV
Sbjct  57   RAACHPPNGESTMPKGSFYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFVELDVFV  116

Query  113  ETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKN---MFGFSA------TVSPQLQV  163
            ET  D NKW+EV  NAL A ++ TR   A D S + N   +FGFS        +SPQ Q+
Sbjct  117  ETQTDRNKWLEVACNALKAKRQLTRQ--AIDQSVSPNKKKLFGFSVPSSTQPVMSPQKQM  174

Query  164  KKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223
            + LA +KE LL +ALREIE AKL+GREA ++I  QG KL++IE DL  ++ DLD G KLL
Sbjct  175  QTLATSKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFGDKLL  234

Query  224  NHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDT  283
            + +K P LH FS+D R K        HS                             +D 
Sbjct  235  HRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPSRLIPAIEIT--------------RDA  280

Query  284  SVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
             V SDL+RL  ALGELE QA  +N+E+  S++QI R+E  L+ V +RV+ Q
Sbjct  281  GV-SDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQ  330

>PYVX_18171
Length=294

 Score = 281 bits (719),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 210/343 (61%), Gaps = 61/343 (18%)

Query  16   GSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP----ATPKGSFF  71
            G+G +  + TSCEGYVTKRGHFRKSWRVRYLV +GADL+ A     +     A  KG F+
Sbjct  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGEFY  62

Query  72   VSSVEKHEYWVGVMGG---REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNA  128
            +SS++KH Y  G MG    +EKPFGFK+VGHAPKKGY ELDIFVETL DL KW+EV  NA
Sbjct  63   LSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTKWLEVAHNA  122

Query  129  LDAAKKHTRTPGA--ADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALREIEGAKL  186
            L++A   +R        S+TTK++FGFS T SPQ Q+K ++ +K+ELL+DALRE+EGAKL
Sbjct  123  LESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDALRELEGAKL  182

Query  187  IGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahh  246
            IGREA +++  QG KL+ IE +LG +ESDLD+G KLL  +K P+LHL + D R  P+   
Sbjct  183  IGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDLRRPPS---  239

Query  247  sgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAM  306
                                                T  +S+      AL +L  Q    
Sbjct  240  -----------------------------------PTKTLSNAGDGRAALEQLSTQ----  260

Query  307  NAEAVKSTEQIARVEQRLTAVNDRVQAQtkkata-tmkaGNLF  348
                     QIAR+E+RLT VNDRVQ QTK+AT+   + GN+F
Sbjct  261  ---------QIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 269 bits (688),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 211/315 (67%), Gaps = 29/315 (9%)

Query  40   SWRVRYLVFNGADLQaa----ggggaSP-ATPKGSFFVSSVEKHEYWVGVMGGREKPFGF  94
            SWRVRYLV NGADL  +         +P A+PKGSF++SSVEKHEY VGV+G ++KPFGF
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGSFYLSSVEKHEYVVGVLGAQKKPFGF  67

Query  95   KLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFS  154
            K+VGHAP+KGY+ELDIFVE+ GDL KW+EV Q+AL AAKK TR+ G +D+++TK++FGFS
Sbjct  68   KMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS-GLSDAASTKSLFGFS  126

Query  155  ATVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQG---------------  199
               SPQ Q++KL+A+KEELL+ A+ EIE AKL+GREA  +I  QG               
Sbjct  127  PATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLTSGFSLHA  186

Query  200  GKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsg  259
             KL+ IE +L +V++DLD+G KLL+H+K P+L+LFS+D R K +A  + S    K     
Sbjct  187  EKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNSASPAHSPVKSKQSALS  246

Query  260  ahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIAR  319
            +   +               ++ +  MSD+ERL L LGELE QAT +N EAV+ T Q+ R
Sbjct  247  SAARADALGQGV--------ERASGEMSDMERLALLLGELEAQATLLNEEAVRGTTQVER  298

Query  320  VEQRLTAVNDRVQAQ  334
            V   L  +N+RVQ Q
Sbjct  299  VGDALAHINERVQNQ  313

>PHYKE_8393
Length=326

 Score = 268 bits (685),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 213/343 (62%), Gaps = 41/343 (12%)

Query  1    MNILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            MNILRVP++    S    GDK + TSCEGYVTKRGHF                      G
Sbjct  1    MNILRVPEVGATAS----GDKARPTSCEGYVTKRGHF----------------PCHPPHG  40

Query  61   aSPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK  120
             +PA  KGSF++S++  HEY VGVMG  +KPFGFK+VGHAP+KGY+ELD+FVETL D NK
Sbjct  41   ETPAH-KGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYVELDVFVETLSDRNK  99

Query  121  WVEVVQNALDAAKKHTRTPGAAD---SSTTKNMFGFSATVSPQL------QVKKLAATKE  171
            W+EV +NAL A ++  R   A D   S T K MFGF  ++SPQ       Q++ L   KE
Sbjct  100  WLEVARNALGAKRQIMRQ--AIDQSVSPTKKGMFGFGLSLSPQPLVPPQKQIQALTHNKE  157

Query  172  ELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPML  231
            ELL +ALRE+E AK++GREA ++I  QG KL+ +E DL  ++ DLD G KLL  +K P L
Sbjct  158  ELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFGDKLLRRLKNPTL  217

Query  232  HLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLER  291
            HLFS+D R K +A+ + S        +G++P     S  +A         + +  SDLER
Sbjct  218  HLFSDDTRPKSHANSNESSPQRTHQSAGSNPIHLPFSMGSA---------NDADASDLER  268

Query  292  LVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
            L  ALGELE QA  +N EA +ST+QIAR+EQ+L+ V  RV+ Q
Sbjct  269  LAHALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQ  311

>CCA18899
Length=343

 Score = 259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 208/338 (62%), Gaps = 16/338 (5%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-----ATPKGSFFVSSV  75
            ++  TSCEGYVTKRGHFRKSWRVRYLV +G ++Q +            ATPKGSF + S 
Sbjct  12   RYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGSFILQSA  71

Query  76   EKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
            EKHEYW+  M     +EKPFGFK+VGHAPK+GYIELD+FV++  D+++W++V+ N L A+
Sbjct  72   EKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVINNGLKAS  131

Query  133  KKHTRTPGAADSSTTKNMFGFS--ATVSPQLQVKKLAATKEELLRDALREIEGAKLIGRE  190
            K   R    A+  TTK++ GFS   T S Q Q++ L + K + + +AL++IE AK  G  
Sbjct  132  KCMAREAFMAEMDTTKSVLGFSYIGTTSKQ-QIQVLKSKKCDYIHEALQQIEMAKSAGNA  190

Query  191  AVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahhsgsh  250
            A  +I  QG +L  +E +L  +++DL+H  KL+  ++ P+ + FS   RS+P+     + 
Sbjct  191  ACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS---RSRPH--DRATI  245

Query  251  sdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEA  310
            S     H   H        +      H  ++     +D+E+L +AL +LE QA  +N+EA
Sbjct  246  SKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMALKDLEVQAQLINSEA  305

Query  311  VKSTEQIARVEQRLTAVNDRVQAQtkkatatmkaGNLF  348
            VKS EQIAR+E +L+ +NDR+QAQT +   +    NLF
Sbjct  306  VKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343

>CCI45123
Length=301

 Score = 209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 180/289 (62%), Gaps = 8/289 (3%)

Query  64   ATPKGSFFVSSVEKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK  120
            ATPKGSF + +VEKHEYW+  M     +E+PFGFK+VGHAPK+GY+ELD+FV++L ++++
Sbjct  17   ATPKGSFILQNVEKHEYWISRMVTGSVKERPFGFKMVGHAPKQGYVELDVFVDSLSNMDQ  76

Query  121  WVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFS-ATVSPQLQVKKLAATKEELLRDALR  179
            W++V+ N L A K+  R    A+  TTK + GFS A  + + QVK+L + K + + +AL+
Sbjct  77   WLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQ  136

Query  180  EIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNR  239
            +IE AK  G  A  +I  QG +L  +E +L  +ESDL+H  KL+  ++ P+ + FS  + 
Sbjct  137  QIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHH  196

Query  240  SKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGEL  299
             + +        ++ +  S  H +      +     +H  ++     +DLE+L +AL EL
Sbjct  197  HEKD----AMSKNNTNHRSHHHQTGILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKEL  252

Query  300  EEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQtkkatatmkaGNLF  348
            E QA  +N+EAVKS +QI R+E +L+ +NDR+Q+QT +  A+    NLF
Sbjct  253  EVQAQLINSEAVKSNDQITRIEGQLSGINDRIQSQTTQVVASSGKKNLF  301

>SPRG_06336
Length=335

 Score = 162 bits (409),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 159/322 (49%), Gaps = 16/322 (5%)

Query  22   FKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaS-----PATPKGSFFVSSVE  76
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+ +     +         KGSF ++ +E
Sbjct  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSKTIYKSDKPKEKGSFILAEIE  67

Query  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            KH+Y     GG  KP+GFKLVGHAP  GY E  ++VET  D  +W+EV  NAL       
Sbjct  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALGK----N  121

Query  137  RTPGAADSSTTKNMFGFSAT----VSPQLQVKKLAATKEELLRDALREIEGAKLIGREAV  192
             TP A+       + G  A      S  +Q++ +  TKEELLR A+  +E A+ +G   V
Sbjct  122  VTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181

Query  193  SDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahhsgshsd  252
            S++      L++ E ++  VE++LD G  ++  M  P  + FS+    K       S S 
Sbjct  182  SEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTGSPKSKSA  241

Query  253  hkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVK  312
                      S     +            D     +L++L   L  LE  A  ++ E  +
Sbjct  242  RSHQPQTPMNSPTHKKSSGPASKAGGATTDAG-DDELDQLSKILASLEVHANTISTEVER  300

Query  313  STEQIARVEQRLTAVNDRVQAQ  334
            +TEQI R+++++   ++R+  Q
Sbjct  301  TTEQIDRIQKKMVEADERIVEQ  322

>SDRG_01781
Length=335

 Score = 158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 161/322 (50%), Gaps = 16/322 (5%)

Query  22   FKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaS-----PATPKGSFFVSSVE  76
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+ +     +         KGSF ++ +E
Sbjct  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSKTIYKSDKPKEKGSFILAEIE  67

Query  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            KH+Y     GG  KP+GFKLVGHAP  GY E  ++VET  D  +W+EV  NAL    K+ 
Sbjct  68   KHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNALG---KNV  122

Query  137  RTPGAADSSTTKNMFGFSAT----VSPQLQVKKLAATKEELLRDALREIEGAKLIGREAV  192
                +AD   T  + G  A      S  +Q++ +  TKEELLR A+  +E A+ +G   V
Sbjct  123  APQASADQRATA-LLGHRAASGFLTSAPVQLRNVNKTKEELLRKAIVTLEHARTVGDNTV  181

Query  193  SDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahhsgshsd  252
            S++      L++ E ++  V ++LD G  ++  M  P  + FS+    K  A    S S 
Sbjct  182  SEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAGSPKSKSA  241

Query  253  hkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVK  312
                      S         T        D     +L++L   L  LE  A  ++ E  +
Sbjct  242  RSHLPQTPMNSPTNKKPSGPTSKTGGPTTDAG-DDELDQLSKILASLEVHANTISTEVER  300

Query  313  STEQIARVEQRLTAVNDRVQAQ  334
            +TEQI R+++++   ++RV  Q
Sbjct  301  TTEQIDRIQKKMVEADERVVEQ  322

>H310_09223
Length=333

 Score = 140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 152/321 (47%), Gaps = 20/321 (6%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL----QaaggggaSPATPKGSFFVSSVE  76
            K   TSCEGYVTKRGH  K+W+ RY+V +G  L      +     S   PKGSF +S  E
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEIYKSNGPPKGSFVLSECE  66

Query  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            K +  +   GG  KPFGFK +GH P +GY E  +FVET  D  KW+ V  NAL    K T
Sbjct  67   KQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNALG---KTT  121

Query  137  RTPGAADSSTTKNMFGFSA--TVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSD  194
              P  +  S        SA   +S + Q+K +  T  ELL+ A+ + + A  IG   V +
Sbjct  122  YIPSPSMESHGGAGHKESAGLMISLEAQIKNVKKTSHELLQQAINDAKEADRIGDATVDE  181

Query  195  IKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKRPML----HLFSNDNRSKPNahhsgsh  250
            +  Q   LN  E+ +  +   +D    L   +K P+L    H+FS     +     S   
Sbjct  182  MAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKSKRGKRGASSKK  241

Query  251  sdhkdghsgahpssggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEA  310
                     +    G          Q  Q++D      L+ L   L +L + A  ++   
Sbjct  242  RGGGKSTRSSRVPRGVQVKLHPPQPQPKQEED-----QLDELSKILAKLGQTADTISDIT  296

Query  311  VKSTEQIARVEQRLTAVNDRV  331
             ++TEQ+ R++Q++T+V++RV
Sbjct  297  TRTTEQVDRIDQKVTSVDERV  317

>H257_06294
Length=358

 Score = 133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 156/350 (45%), Gaps = 47/350 (13%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL----QaaggggaSPATPKGSFFVSSVE  76
            K   TSCEGYVTKRGH  KSW+ RY+V NG  L      +     S   PKGSF +S  E
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEIYTSKGHPKGSFVLSECE  66

Query  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            K +  +   G   KPFGFK +GH P +GY E  ++VE+  D  KW+ V  NAL       
Sbjct  67   KQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNALGK----N  120

Query  137  RTPGAADSSTTKNMFG-FSATVSPQL---------------------------QVKKLAA  168
             +P  + S   + + G      S QL                           Q+K +  
Sbjct  121  SSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMKNVKK  180

Query  169  TKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHMKR  228
            T +ELL+ A+ + + A  IG   V+++  Q   LN  E  +  +   +DH   L   +K 
Sbjct  181  TSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGRSLKH  240

Query  229  PML----HLFSNDNRSKPNahhsgshsdhkdghsgahpssggssaetatgaQHHQQQDTS  284
            P+L    HLF+   R K            K G   +  S            QH   Q   
Sbjct  241  PILYKLTHLFT---RKKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAAAQPED  297

Query  285  VMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQ  334
                L++L   L +L + A  ++    ++TEQ+ R++Q++T+V+DRV+ +
Sbjct  298  --DQLDQLSKILAKLGQTADTISDITARTTEQVDRIDQKVTSVDDRVKKE  345

>CCI45127
Length=202

 Score = 108 bits (269),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 71/204 (35%), Positives = 117/204 (57%), Gaps = 5/204 (2%)

Query  146  TTKNMFGFS-ATVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNM  204
            TTK + GFS A  + + QVK+L + K + + +AL++IE AK  G  A  +I  QG +L  
Sbjct  3    TTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGK  62

Query  205  IEDDLGKVESDLDHGGKLLNHMKRPMLHLFSNDNRSKPNahhsgshsdhkdghsgahpss  264
            +E +L  +ESDL+H  KL+  ++ P+ + FS  +  + +        ++ +  S  H + 
Sbjct  63   VEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKD----AMSKNNTNHRSHHHQTG  118

Query  265  ggssaetatgaQHHQQQDTSVMSDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRL  324
                 +     +H  ++     +DLE+L +AL ELE QA  +N+EAVKS +QI R+E +L
Sbjct  119  ILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQL  178

Query  325  TAVNDRVQAQtkkatatmkaGNLF  348
            + +NDR+Q+QT +  A+    NLF
Sbjct  179  SGINDRIQSQTTQVVASSGKKNLF  202

>PYVX_20438
Length=1346

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (46%), Gaps = 12/122 (10%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSF  70
            LAT   S  +  +  +C GY+TK+GH RKSW+ RY +  G  +        + +    + 
Sbjct  303  LATVKKSTANLPEPVACAGYLTKQGHKRKSWKKRYFILRGTSISYFADFEMANSAKGKAL  362

Query  71   FVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQ--NA  128
               +VE  + W G      +PFGF  +       Y    ++ +   + NKW+  ++  NA
Sbjct  363  AEVTVEDVQRWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLNA  412

Query  129  LD  130
            +D
Sbjct  413  VD  414

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEGY+TKRGH   +W+ RY    G  L+
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE  150

 Score = 38.1 bits (87),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V  G  L+
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLR  246

>PHYRA_84916
Length=1541

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 55/123 (45%), Gaps = 20/123 (16%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT---PK  67
            LAT   S  +  +  SC GY+TK+GH RKSW+ RY +  G  +        +  T   P 
Sbjct  389  LATVKKSTANVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNTISYYSDYDMANNTKGKPL  448

Query  68   GSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQN  127
                V  V+K   W G      +PFGF  + +     Y    ++ +   + NKW+    N
Sbjct  449  AEVLVEDVQK---WDG------EPFGFMFMTNEQVPYY----VYADNDRERNKWM----N  491

Query  128  ALD  130
            AL+
Sbjct  492  ALN  494

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 15/100 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+       S       +   +VEK   W G   
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS-----KKYGAVTVEKVAPWSGEAH  264

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQ  126
            G    F F      P        ++  + G+ ++W+  ++
Sbjct  265  G----FMFYTTKQIP------YYVYASSEGERSRWLRALK  294

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  332

>H310_00230
Length=1248

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 13/123 (11%)

Query  19   GDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKH  78
            G   +  +C GY+TK+GH RKSW+ RY V  GA L          +  K       +E  
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALLSYYTDYE---SANKQCLAEVGIEDV  274

Query  79   EYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
            + W G M G    F F           +   ++ +T  +  KW+  ++  LDA      T
Sbjct  275  QVWDGEMHG----FMFTTTEQ------VMYYVYADTERERQKWLVALKALLDAQSNRAPT  324

Query  139  PGA  141
            P A
Sbjct  325  PLA  327

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 16/22 (73%), Gaps = 0/22 (0%)

Query  27  CEGYVTKRGHFRKSWRVRYLVF  48
           C GY+TKRGH   +W++R+ V 
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVL  33

>SDRG_12763
Length=1317

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 47/108 (44%), Gaps = 13/108 (12%)

Query  22   FKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYW  81
             K  SC GY+TK+GH RKSW+ RY V  GA L          +  K S     VE    W
Sbjct  219  IKPISCAGYLTKQGHRRKSWKRRYFVLRGATLSYYSDYD---SMNKQSLAEVGVEDVALW  275

Query  82   VGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
             G      + FGF+ +       Y    +F E+  +  KW+  +Q  +
Sbjct  276  DG------EQFGFQFITTEQVPYY----VFAESDRERQKWMVALQTLI  313

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 51/144 (35%), Gaps = 14/144 (10%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            C GY+TKRGH   +W+ R+ V     +        S     G   +  V   EY+    G
Sbjct  10   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADDSMVKKLGQVHLVKVAPWEYFSATTG  68

Query  87   GR---------EKPFGFKLVGHAPKKGYIELDIFVET---LGDLNKWVEVVQNALDAAKK  134
                       E  FGF          Y+  ++  E    L  L     V  NA D    
Sbjct  69   NSVLKSARGSDEMKFGFMFFTTKRVAYYVYANVNAERQRWLLALQDLYVVTSNATDCEGY  128

Query  135  HT-RTPGAADSSTTKNMFGFSATV  157
             T RTPG +  S+    +  + T+
Sbjct  129  LTKRTPGFSFLSSRPKYYVLTGTL  152

>PHYSO_361747
Length=1523

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 53/124 (43%), Gaps = 17/124 (14%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaag---gggaSPATPK  67
            LAT   S     +  SC GY+TK+GH RKSW+ RY +  G  +           S   P 
Sbjct  398  LATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNAISYYSDYDMANNSKGKPL  457

Query  68   GSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQN  127
                V  V+K   W G      +PFGF  +       Y    ++ +   + NKW+  + N
Sbjct  458  AEVLVEDVQK---WDG------EPFGFMFMTTEQVPYY----VYADNDRERNKWMNAL-N  503

Query  128  ALDA  131
             L+A
Sbjct  504  KLNA  507

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 42/103 (41%), Gaps = 15/103 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+       S       +   +VEK   W G   
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS-----KKYGAVTVEKVATWSGEAH  273

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            G    F F      P        ++  +  + ++W+ V++  +
Sbjct  274  G----FMFYTTKQIP------YYVYASSESERSRWLRVLKEYM  306

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>HYAP_08645
Length=1514

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 11/124 (9%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSF  70
            LAT   S     +  SC GY+TK+GH RKSW+ RY +  G  +        +  T     
Sbjct  292  LATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNLISYYSDYDMANNTKGRPL  351

Query  71   FVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
                VE  + W G      +PFGF  + +     Y    ++ +   + NKW+  + N L+
Sbjct  352  AEVLVEDVQSWDG------EPFGFMFMTNEQVPYY----VYADNDRERNKWMNAL-NKLN  400

Query  131  AAKK  134
            A ++
Sbjct  401  AVEE  404

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  235

 Score = 40.8 bits (94),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 43/103 (42%), Gaps = 15/103 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+   G   S       +   +VEK   W G   
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSGEEKS-----KKYGAVTVEKVATWSGEAH  167

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            G    F F      P        ++  +  + ++W+  +++ +
Sbjct  168  G----FMFYTTKQIP------YYVYASSESERSRWLRALKDFM  200

>SPRG_06059
Length=1312

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 50/128 (39%), Gaps = 13/128 (10%)

Query  22   FKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYW  81
             K  SC GY+TK+GH RKSW+ RY V  G  L          +  K S     VE    W
Sbjct  221  IKPISCAGYLTKQGHRRKSWKRRYFVLRGGTLAYYADYD---SMNKQSLAEVGVEDVALW  277

Query  82   VGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGA  141
             G      + FGF+ +       Y    +F E+  +  KW+  +Q  +         P  
Sbjct  278  DG------EQFGFQFITTEQVPYY----VFAESDRERQKWMVALQTLVRTHSAPLHIPNV  327

Query  142  ADSSTTKN  149
                ++ N
Sbjct  328  LAPPSSSN  335

 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 51/144 (35%), Gaps = 14/144 (10%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM-  85
            C GY+TKRGH   +W+ R+ V     +        S A   G   +  V   EY      
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYYADESMAKKLGQVHLVKVAPWEYVSATTA  70

Query  86   --------GGREKPFGFKLVGHAPKKGYIELDIFVET---LGDLNKWVEVVQNALDAAKK  134
                    G  E  FGF          Y+  ++  E    L  L     V  NA D    
Sbjct  71   NSILKSTRGSDEMKFGFMFFTTKRVAYYVYANVNAERQKWLLALQDLYVVTSNATDCEGY  130

Query  135  HT-RTPGAADSSTTKNMFGFSATV  157
             T RTPG +  S+    +  + T+
Sbjct  131  LTKRTPGFSFLSSRPKYYVLTGTL  154

>H257_06721
Length=1238

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 56/129 (43%), Gaps = 15/129 (12%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSF  70
            +A +    G   +  +C GY+TK+GH RKSW+ RY V  G+ L          +T K   
Sbjct  216  MAATQEKVGSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLLSYYTDYD---STNKQCL  272

Query  71   FVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
                +E  + W G M G    F F           +   ++ E+  +  KW+  ++  LD
Sbjct  273  AEVGIEDVQVWDGEMHG----FMFTTSEQ------VVYYVYAESERERQKWLVSLKALLD  322

Query  131  AAKKHTRTP  139
            A  + TR P
Sbjct  323  A--QSTRAP  329

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 45/141 (32%), Gaps = 18/141 (13%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFN-------------GADLQaaggggaSPATPKGSFFVS  73
            C GY+TKRGH   +W++RY V                  L        +P    GS    
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLRPHASLSYYEDESMAKKLGQVHLAKVAPWEYNGS-LAK  72

Query  74   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAK  133
            SV K E      G  E  +GF          Y    I+  +  +  KW   V +      
Sbjct  73   SVSKRESRGSSSGAEESRYGFMFFTTKRVVYY----IYTTSAIEHQKWFHAVADYYVHTS  128

Query  134  KHTRTPGAADSSTTKNMFGFS  154
                  G     T   +F FS
Sbjct  129  NVADCEGYMTKKTPGTLFSFS  149

>PYIR_21589
Length=1568

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 51/114 (45%), Gaps = 10/114 (9%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            +  SC GY+TK+GH RKSW+ RY +  G  +        + +    +    +VE  + W 
Sbjct  402  EPVSCAGYLTKQGHKRKSWKKRYFILRGNLIAYYPDYDLANSAKGRALAEVTVEDVQKWD  461

Query  83   GVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            G      +PFGF  +       Y    ++ +   + NKW+  ++     A++ T
Sbjct  462  G------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEPT  505

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+T+RGH   S R+ Y V NG  L+
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

 Score = 40.0 bits (92),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEG++TKRGH   +W+ RY V  G  L+
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  238

>PYAR_23286
Length=607

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSV-EKHEYWVGV  84
            +C GY+TK+GH RKSW+ RY V  G+ +        +  +PKG      V E  + W G 
Sbjct  388  ACSGYLTKQGHKRKSWKKRYFVLRGSSVSYYTDYDTA-NSPKGKPLAEVVIEDVQRWDG-  445

Query  85   MGGREKPFGFKLVGHAPKKGYIELD  109
                 +PFGF  +       Y+  D
Sbjct  446  -----EPFGFMFMTSEQIPYYVYAD  465

 Score = 39.3 bits (90),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEG++TKRGH   +W++RY V  G  L+
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE  221

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            +CEGY+T+RGH   S R  Y V NG  L+
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLR  316

>PYIW_17381
Length=952

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (44%), Gaps = 16/114 (14%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNG---ADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            SC GY+TK+GH RKSW+ RY +  G   A         ++   P     V  V+K   W 
Sbjct  405  SCAGYLTKQGHKRKSWKKRYFILRGNLIAYFTDYDIANSAKGKPLAEVTVEDVQK---WD  461

Query  83   GVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
            G      +PFGF  +       Y    ++ +   + NKW+  ++     A++ T
Sbjct  462  G------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTTVAEEPT  505

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEG++TKRGH   +W+ RY V  G  L+
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE  238

 Score = 39.3 bits (90),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEGY+T+RGH   S R+ Y V NG  L+
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLR  333

>PITG_20562
Length=1559

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 43/102 (42%), Gaps = 12/102 (12%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaag---gggaSPATPK  67
            LAT   S     +  SC GY+TK+GH RKSW+ RY +  G  +           +   P 
Sbjct  393  LATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNTISYYSDYDMANNAKGKPL  452

Query  68   GSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELD  109
                V  V+K   W G      +PFGF  + +     Y+  D
Sbjct  453  AEVLVEDVQK---WDG------EPFGFMFMTNEQVPYYVYAD  485

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  336

 Score = 41.2 bits (95),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 42/103 (41%), Gaps = 15/103 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+       S       +   +VEK   W G   
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLEYYSSEEKS-----KKYGAVTVEKVAPWSGEAH  268

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            G    F F      P        ++  +  + ++W+  +++ +
Sbjct  269  G----FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  301

>PPTG_18898
Length=1559

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 43/102 (42%), Gaps = 12/102 (12%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaag---gggaSPATPK  67
            LAT   S     +  SC GY+TK+GH RKSW+ RY +  G  +           +   P 
Sbjct  392  LATVKKSTASVPEPVSCAGYLTKQGHKRKSWKKRYFILRGNTISYYSDYDMANNAKGKPL  451

Query  68   GSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELD  109
                V  V+K   W G      +PFGF  + +     Y+  D
Sbjct  452  AEVLVEDVQK---WDG------EPFGFMFMTNEQVPYYVYAD  484

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NG  L+
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  335

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 42/103 (41%), Gaps = 15/103 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+       S       +   +VEK   W G   
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLEYYSSEEKS-----KKYGAVTVEKVAPWSGEAH  267

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            G    F F      P        ++  +  + ++W+  +++ +
Sbjct  268  G----FMFYTTKQIP------YYVYASSEAERSRWLRALKDFM  300

>PHYKE_1990
Length=1499

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 54/120 (45%), Gaps = 14/120 (12%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSF  70
            L+T   S  +  +  +C GY+TK+GH RKSW+ RY +  G+ +        +  +   + 
Sbjct  390  LSTVKKSTTNIPEPVACAGYLTKQGHKRKSWKKRYFILRGSTISYYSDYDMANNSKGKAL  449

Query  71   FVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
                VE  + W G      +PFGF  +       Y    ++ +   + NKW+    NAL+
Sbjct  450  AEVLVEDVQRWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  495

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+TKRGH   S R+ Y V NGA L+
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLR  333

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 39/100 (39%), Gaps = 15/100 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEGY+TKRGH   +W+ RY    G  L+       S       +    VEK   W G   
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLEYYSSEEKS-----KKYGAVMVEKVATWSGEAH  265

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQ  126
            G    F F      P        ++  +  + +KW+  ++
Sbjct  266  G----FMFYTTKQIPYY------VYASSEAERSKWLRALK  295

>H310_00231
Length=1495

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            A  CEGY+TKRGH   S+R+RY V +GA ++
Sbjct  248  AVDCEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 30/116 (26%), Positives = 50/116 (43%), Gaps = 22/116 (19%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            +  +C G++TK+GH RKSW+ RY V  G  L                 F +S  +H   +
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTLAYYTD------------FDASNMRHSRPL  395

Query  83   GVMGGRE------KPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
            G +  RE      +P GF  V +     Y    +F +   D  KW+  ++   +++
Sbjct  396  GEVTVREVSTWDGEPGGFMFVTNDNVPYY----VFADNERDQAKWLTALRKLFESS  447

>PYU1_G006347
Length=1095

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 48/115 (42%), Gaps = 10/115 (9%)

Query  11   LATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSF  70
            L T   S     +  SC GY+TK+GH RKSW+ RY +  G  +        + +      
Sbjct  379  LQTVKRSNATAPEPVSCAGYLTKQGHKRKSWKKRYFILRGNLISYYSDYDLANSAKGKPL  438

Query  71   FVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVV  125
               +VE  + W G      +PFGF  +       Y    ++ +   + NKW+  +
Sbjct  439  AEVAVEDVQKWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNAL  483

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            SCEGY+T+RGH   S R+ Y V NGA L+
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLR  322

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEG++TKRGH   +W+ RY V  G  L+
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE  227

>PYIR_18382
Length=1154

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 50/121 (41%), Gaps = 14/121 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaagg--ggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +S V    Y     
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAALTYYNTKEEARSARNLRGRMIISKVRPENY-----  183

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSS  145
                K  GF +      KG+    +   T  + + WVE++Q A+D   KH+    + D  
Sbjct  184  ---GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSLNGSSVDPE  236

Query  146  T  146
            T
Sbjct  237  T  237

>SDRG_12762
Length=1392

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 49/110 (45%), Gaps = 15/110 (14%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHE--YWVGV  84
            CEGY+TKRGH   S+R+RY V  G+ ++         A   G+  ++ +E      W G 
Sbjct  258  CEGYLTKRGHLVPSYRLRYFVMCGSVVKYYSDET---AYRTGASALAEIEVKSGGRWDGE  314

Query  85   MGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKK  134
              G      FK   ++       + +  E + DL KW+E +    + A K
Sbjct  315  STG----LFFKTATNS------TMFVCAENVADLQKWIEALGRIFNEAPK  354

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 54/136 (40%), Gaps = 10/136 (7%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEY  80
            K    +C G++TK+GH RKSW+ RY V  G  L       A+      +    SV+    
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVLSYFADFEAANTRLGKALSEVSVKDVAP  413

Query  81   WVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPG  140
            W G + G    F F  + + P        +F +   D  KW+  ++ A+        TP 
Sbjct  414  WDGEVCG----FMFVTLENVPYY------VFADNERDQAKWMTALKKAVGLDAPTLETPD  463

Query  141  AADSSTTKNMFGFSAT  156
              +    +  +  + T
Sbjct  464  EPEKKCPRCEYVLTGT  479

>PYU1_G008848
Length=765

 Score = 43.9 bits (102),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 50/119 (42%), Gaps = 14/119 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQa--aggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +S V    Y     
Sbjct  134  EGYVRKKGDWLPRWEERYLVLDGAALTYYNTKEEARSARNLRGRMIISKVRPENY-----  188

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADS  144
                K  GF +      KG+    +   T  + + WVE++Q A+D   KH+    + DS
Sbjct  189  ---GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVKHSVNGNSMDS  240

>PYAP_18636
Length=1009

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 47/110 (43%), Gaps = 14/110 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +S V    Y     
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATLTYYNTKEEARSGRNLRGRMIISKVRPENY-----  157

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
             G+   F  + +GH     +  L    E   D+  WVE++Q A+D   KH
Sbjct  158  -GKAHGFLLETMGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVKH  200

>PHYRA_78815
Length=919

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 80/216 (37%), Gaps = 59/216 (27%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEG++ KRG     W+ RY    G  LQ   G G S   PKG+  V              
Sbjct  275  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQDGPGES--VPKGAGTV--------------  318

Query  87   GREKPFGFKLVGHAPKKGYIELD------IFVETLGDLNKWVEVVQNALDAAKKH-----  135
                  G KL        Y++LD      +  ++ G ++KWV+ + + LD   K      
Sbjct  319  -----VGLKLGETGSNCVYVQLDSGRVLCVSADSQGQVDKWVQAICSLLDKDPKTVEKEA  373

Query  136  -TRTPGAADSSTTKNMF-------GFSATVSPQLQVKKLAATKEELLRDALREIEGAKLI  187
             T  P     S++ N+        G +A V P L             R ++    G +  
Sbjct  374  PTAAPAVTKGSSSSNLLTRALSRAGSNAFVPPVLTPSA---------RSSVSGASGTR--  422

Query  188  GREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLL  223
                 S + G GG L   +D     ESD ++ G LL
Sbjct  423  -----SSLSGAGGYLEGYDD---TTESDNNNDGPLL  450

>PYAP_16997
Length=1018

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 37/84 (44%), Gaps = 6/84 (7%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            +C GY+TK+GH RKSW+ RY V  G  +        + +    +     VE  + W G  
Sbjct  401  ACSGYLTKQGHKRKSWKKRYFVLRGNSITYFTDFDTANSNKGKALAEVIVEDVQRWDG--  458

Query  86   GGREKPFGFKLVGHAPKKGYIELD  109
                +PFGF  +       Y+  D
Sbjct  459  ----EPFGFMFMTSEQVPYYVYAD  478

 Score = 40.0 bits (92),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            +CEG++TKRGH   +W++RY V  G  L+
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE  234

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            +CEG++T+RGH   S R  Y V NG  L+
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLR  329

>H257_06722
Length=1482

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            A  CEGY+TKRGH   S+R+RY V  G+ ++
Sbjct  248  AVDCEGYLTKRGHLVPSYRMRYFVLCGSTIK  278

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 16/113 (14%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP---ATPKGSFFVSSVEKHE  79
            +  +C G++TK+GH RKSW+ RY V  G  L       AS      P G   V  V    
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGNTLAYYTDFDASNLRHGKPLGEVTVREVSA--  405

Query  80   YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
             W G      +P GF  + +     Y    +F +   D  KW+  ++   ++A
Sbjct  406  -WDG------EPSGFMFITNDSVPYY----VFADNDRDQAKWLAALRKLFESA  447

>PHYRA_82543
Length=1199

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 14/113 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQa--aggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +GA L    +     S    +G   +S V    Y     
Sbjct  61   EGYVRKKGDWLPRWEERYLILDGATLTYYNSKEEARSARNLRGRMIISKVRPENY-----  115

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
             G+   F  +  GH     +  L    E   D+  WVE++Q A++   +HT++
Sbjct  116  -GKAHGFLLETQGH----KHFHLCCATELEKDM--WVEMMQAAIEEGVRHTQS  161

>SPRG_06058
Length=1258

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 46/103 (45%), Gaps = 11/103 (11%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            +   CEGY+TKRGH   S+R+RY V  G+ ++         A   G+  ++ +E      
Sbjct  43   RPVDCEGYLTKRGHLVPSYRLRYFVMCGSVVKYYSDET---AYRTGASALAEIEVKS--G  97

Query  83   GVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVV  125
            G   G      FK   ++       + +  E + DL KW+E +
Sbjct  98   GRWDGESTGLFFKTATNS------TMFVCAENVADLQKWIEAL  134

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 48/111 (43%), Gaps = 10/111 (9%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEY  80
            K    +C G++TK+GH RKSW+ RY V  G  L       A  A  +    +S V   + 
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVLSYYADFEA--ANTRAGKALSDVSLKD-  199

Query  81   WVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDA  131
             VG   G    F F  + + P        +F +   D  KW+  ++ A+ A
Sbjct  200  -VGPWDGEACGFMFTTLENVPYY------VFADNERDQAKWMSALKKAVGA  243

>PYVX_23349
Length=924

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 6/129 (5%)

Query  14   SHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVS  73
            S+ S  D     S  G++ K GH RK+W+ RY V   + L+       S    +   F  
Sbjct  432  SNKSAFDDSFLDSMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESRSRLKGEVLLFHP  491

Query  74   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAK  133
            +   H   + + GGR+  F  + VG      Y  L +  E L D   W+  +++AL    
Sbjct  492  ATRVHYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENWMYCIEDALLCRD  545

Query  134  KHTRTPGAA  142
             +   P  A
Sbjct  546  SYYHDPELA  554

>PHYSO_556164
Length=765

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 44/104 (42%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH RK+W+ RY V   + L+       S    +   F      H   V V 
Sbjct  220  SMSGWLRKRGHVRKNWKARYFVLEKSVLRYYTDSSCSKLKGEVLLFHPQTRVHYVDVHVA  279

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  ++    P      L +    L D   W+  +++AL
Sbjct  280  GGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDAL  317

>PYAR_15463
Length=1091

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 46/110 (42%), Gaps = 14/110 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +S V    Y     
Sbjct  78   EGYVRKKGDWLPRWEERYLVLDGATLTYYNSKEEARSGRNLRGRMIISKVRPENY-----  132

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
                K  GF +      KG+    +   T  + + WVE++Q A+D   KH
Sbjct  133  ---GKAHGFLIE----TKGHKLFHLCCSTELEKDMWVEMMQAAIDEGVKH  175

>CCI44752
Length=1526

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 24/37 (65%), Gaps = 0/37 (0%)

Query  14   SHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNG  50
            S+ +  +  +  +C GY+TK+GH RKSW+ RY +  G
Sbjct  405  SNTTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG  441

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            EGY+TKRGH   +W+ R+ V +G  L+
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE  249

>PYIW_16987
Length=821

 Score = 41.6 bits (96),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 46/111 (41%), Gaps = 14/111 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaagg--ggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +S V    Y     
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAALTYYNTKEEARSARNLRGRMIISKVRPENY-----  174

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
                K  GF +      KG+    +   T  + + WVE++Q A+D    H+
Sbjct  175  ---GKAHGFLIE----TKGHKHFHLCCSTELEKDMWVEMMQAAIDEGVNHS  218

>PITG_17893
Length=747

 Score = 41.6 bits (96),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 45/104 (43%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH RK+W+ RY V   + L+       +    +   F      H   V V 
Sbjct  218  SMSGWLRKRGHVRKNWKARYFVLEKSVLRYYTDSSCAKLKGEVLLFHPQTRVHYVDVHVA  277

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  + VG      Y  L +    L D   W+  +++AL
Sbjct  278  GGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  315

>PYVX_18338
Length=746

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 1/37 (3%)

Query  15   HGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            HGS  D F+ T  EGY+ K+GH  +SWR RY V +G 
Sbjct  70   HGSIEDAFE-TDWEGYIWKQGHVVRSWRYRYAVLSGT  105

>PPTG_04553
Length=904

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 45/104 (43%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH RK+W+ RY V   + L+       +    +   F      H   V V 
Sbjct  361  SMSGWLRKRGHVRKNWKARYFVLEKSVLRYYADSSCTKLKGEVLLFHPQTRVHYVDVHVA  420

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  + VG      Y  L +    L D   W+  +++AL
Sbjct  421  GGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDAL  458

>PHYRA_73535
Length=875

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH RK+W+ RY V   + L+       +    +   F      H   V V 
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLRYYTDPSCAKLKGEVLLFHPQTRVHYVDVHVA  398

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  ++    P+     L +    L D   W+  +++AL
Sbjct  399  GGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  436

>H310_04843
Length=968

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 14/114 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPA--TPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L        +      +G   ++ V    Y     
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASLTYYNSKEEARTGKNLRGRMIITRVLPENY-----  157

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP  139
             G+   F  + +GH     +  L    E   D+  WVE++Q A+D    H   P
Sbjct  158  -GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAIDEGVHHPNQP  204

>SPRG_00890
Length=883

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 54/135 (40%), Gaps = 19/135 (14%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   ++ V    Y     
Sbjct  31   EGYVRKKGDWLPRWEERYLVLDGASLTYYNTKDEARSGRNLRGRMIITRVLPENY-----  85

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSS  145
                K  GF +      KG+    +   T  + + WVE++Q A+D    H        SS
Sbjct  86   ---GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAIDEGISHPPHLTTQQSS  138

Query  146  TTKNMFGFSATVSPQ  160
             T     F ATVS Q
Sbjct  139  GT-----FEATVSFQ  148

>CCA18875
Length=1514

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNG  50
            +C GY+TK+GH RKSW+ RY +  G
Sbjct  417  TCAGYLTKQGHKRKSWKKRYFILRG  441

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

 Score = 35.8 bits (81),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            EGY+TKRGH   +W+ R+ V +G  L+
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE  249

>PPTG_19371
Length=1195

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 14/113 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQa--aggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +GA L    +     S    +G   +S V    Y     
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATLTYYNSKEEARSARNLRGRMIISKVRPENY-----  125

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
             G+   F  +  GH     +  L    E   D+  WVE++Q A++   +H  +
Sbjct  126  -GKAHGFLIETQGH----KHFHLCCTTELEKDM--WVEMMQAAIEEGVRHAHS  171

>SDRG_01407
Length=815

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 54/135 (40%), Gaps = 19/135 (14%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   ++ V    Y     
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASLTYYNTKDEARSGRNLRGRMIITRVLPENY-----  139

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSS  145
                K  GF +      KG+    +   T  + + WVE++Q A+D    H        SS
Sbjct  140  ---GKAHGFLI----ETKGHKHFHLCCTTELEKDMWVEMMQAAIDEGISHPPHLTTQQSS  192

Query  146  TTKNMFGFSATVSPQ  160
             T     F ATVS Q
Sbjct  193  GT-----FEATVSFQ  202

>PHALS_06699
Length=884

 Score = 40.4 bits (93),  Expect = 0.013, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 45/104 (43%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH  K+W+ RY V + + L+       +    +   F      H   V V 
Sbjct  335  SMSGWLRKRGHVCKNWKDRYFVLHKSVLRYYSDACCTKLKGEVLLFHPQTCVHYVDVHVT  394

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  + VG         L +  E L D   W+  +++AL
Sbjct  395  GGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIEDAL  432

>PHYRA_73534
Length=1210

 Score = 40.4 bits (93),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 45/104 (43%), Gaps = 6/104 (6%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ KRGH RK+W+ RY V   + L+       +    +   F      H   V V 
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLRYYTDPSCAKLKGEVLLFHPQTRVHYVDVHVA  398

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            GGR+  F  ++    P+     L +    L D   W+  +++AL
Sbjct  399  GGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  436

>PYIR_17453
Length=2619

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (43%), Gaps = 17/122 (14%)

Query  27    CEGYVTKRGHFR-KSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEY-----  80
             CEGYV  R HF   +WR R+ V    D +       S A  +G     ++EKH+      
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLE--DTRLYLYPDTSAALSEGR-EQKALEKHDLIAVKK  2216

Query  81    ----WVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHT  136
                 +   +G     FGF++   A   GY+E  + +E   +  KW+  + NA+     H 
Sbjct  2217  WHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIE--DEQTKWLAAITNAVSEISTHV  2272

Query  137   RT  138
              +
Sbjct  2273  SS  2274

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 30/72 (42%), Gaps = 6/72 (8%)

Query  28    EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaS--PAT-PKGSFFVSSVEKHEYWVGV  84
             EGY+ KRGH   S R RY V     L+       S  PA  P GSF V  V     W G 
Sbjct  1222  EGYLVKRGHLIPSMRKRYCVLVKNTLEYFATHEDSRNPAIRPHGSFQVEIVSD---WHGK  1278

Query  85    MGGREKPFGFKL  96
                +    G +L
Sbjct  1279  TASKTYEHGMEL  1290

>PITG_11303
Length=293

 Score = 39.7 bits (91),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEGY+TKRGH   +W+ RY    G  L+
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE  241

>PHYSO_544598
Length=1163

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 36/134 (27%), Positives = 53/134 (40%), Gaps = 18/134 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +GA L          S    +G   +S V    Y     
Sbjct  19   EGYVRKKGDWLPRWEERYLILDGATLTYYNSKEEARSARNLRGRMIISKVRPENY-----  73

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSS  145
             G+   F  +  GH     +  L    E   D+  WVE++Q A++   +H    GA    
Sbjct  74   -GKAHGFLLETQGH----KHFHLCCSTELEKDM--WVEMMQAAIEEGVRH----GAHSRV  122

Query  146  TTKNMFGFSATVSP  159
            + + M       SP
Sbjct  123  SMEGMEALQMQASP  136

>H257_03093
Length=975

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (42%), Gaps = 14/110 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          +    +G   ++ V    Y     
Sbjct  104  EGYVRKKGDWLPRWEERYLVLDGASLTYYNSKDEARTGTNLRGRMIITKVLPENY-----  158

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
             G+   F  + +GH     +  L    E   D+  WVE++Q A+D    H
Sbjct  159  -GKAHGFLIETMGHK----HFHLCCTTELEKDM--WVEMMQAAIDEGVPH  201

>CCI10489
Length=777

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 61/145 (42%), Gaps = 18/145 (12%)

Query  7    PDMKLATS---HGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP  63
            P  +L+ S   + +  D FK T  EGY+ KRGH  +SWR R+ V +G  L        + 
Sbjct  84   PSQRLSVSPEVNHTFEDMFK-TDWEGYIWKRGHVVRSWRHRFAVLSGTCLSYYTSKEVA-  141

Query  64   ATPKGSFFVSSVEKHEYWVGVMGGR--EKPFGFKLVGHAPKKGYIELDIFVETLGDLNKW  121
                    + + EK+   V V   R  E      L+     K +I   I+  T  + + W
Sbjct  142  --------MLNTEKYRGRVTVTAARNDETRSCGVLITTTINKTFI---IYTRTPVERDIW  190

Query  122  VEVVQNALDAAKKHTRTPGAADSST  146
            V ++  A+     H  +P    S++
Sbjct  191  VCMITQAVANLSGHIHSPITKSSTS  215

>PYIR_24588
Length=909

 Score = 40.0 bits (92),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 7/123 (6%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHE  79
            D F  + C G++ K GH RK+W+ RY V   + L+       +    +   F  +   H 
Sbjct  404  DSFLDSMC-GWLRKLGHVRKNWKSRYFVLEKSVLRYYADESMARLKGEVLLFHPATRVHY  462

Query  80   YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP  139
              + + GG++  F    VG    K Y  L +  + L D   W+  +++AL     + + P
Sbjct  463  VDIHLSGGKDCTFAIH-VG----KDYALL-LQADQLSDRENWMYCIEDALLCRDSYHQDP  516

Query  140  GAA  142
              A
Sbjct  517  DQA  519

>PPTG_16659
Length=916

 Score = 39.7 bits (91),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 77/207 (37%), Gaps = 51/207 (25%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEG++ KRG     W+ RY    G  LQ   G G S   PKG+  V              
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQDGPGES--VPKGAGTV--------------  317

Query  87   GREKPFGFKLVGHAPKKGYIELD------IFVETLGDLNKWVEVVQNALDAAKKHTRTPG  140
                  G KL        Y++L       +  ++   ++KWV+ + + LD          
Sbjct  318  -----VGLKLGESGSNSVYVQLSSGRVLCVSADSQASVDKWVKAICSLLD----------  362

Query  141  AADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALREIEGAK----LIGREAVSDIK  196
              D  T +     SA VS      K A+T   L R   R    A     +  R A S + 
Sbjct  363  -KDPKTLEKESSASANVS------KGASTSNLLTRALSRAGSNACAPPVIASRSARSSLT  415

Query  197  GQGGKLNMIEDDLGKVESDLDHGGKLL  223
            G GG L   +D     E+D  + G+LL
Sbjct  416  GAGGYLEGYDD---TPETDDSNSGQLL  439

>PITG_19213
Length=1201

 Score = 39.7 bits (91),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 47/113 (42%), Gaps = 14/113 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +GA L          S    +G   ++ V    Y     
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATLTYYNSKEEARSARNLRGRMIINKVRPENY-----  125

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
             G+   F  +  GH     +  L    E   D+  WVE++Q A++   +H  +
Sbjct  126  -GKAHGFLIETQGHK----HFHLCCTTELEKDM--WVEMMQAAIEEGVRHAHS  171

>SPRG_17022
Length=107

 Score = 36.6 bits (83),  Expect = 0.034, Method: Composition-based stats.
 Identities = 27/91 (30%), Positives = 41/91 (45%), Gaps = 13/91 (14%)

Query  5   RVPDMKLATSHGSGG----DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
           R  +M+L T   S G    +    T  EGY+ K+GH  ++WR RY V +G          
Sbjct  8   RSSEMELGTESISMGLHSFEDIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCFTYYASKE  67

Query  61  aSPATPKGSFFVSSVEKHEYWVGVMGGREKP  91
           A+ A          +EK++  V V G ++ P
Sbjct  68  AASA---------DLEKYKGRVTVTGAKKDP  89

>PYIW_21108
Length=2593

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 54/132 (41%), Gaps = 16/132 (12%)

Query  13    TSHGSGGDKFKATSCEGYVTKRGHFRKS-WRVRYLVFNGADLQaaggggaSPATPKGSFF  71
             ++  SGG   K    EGYV  R HF  + WR R+ V  G  L        S A       
Sbjct  2142  SAKSSGGASAKRDQFEGYVRVRHHFLGAIWRERFAVLEGTRL---LLYTDSSAAMDEDRE  2198

Query  72    VSSVEKH-----EYWVGVMG---GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVE  123
              +++EKH     E W        G    FGF++   A   GY+E  +  E   +  KW+ 
Sbjct  2199  RTALEKHDLIAVEKWHPTYSANLGSGSRFGFRVENEA--GGYLECTVTTE--DEQTKWLA  2254

Query  124   VVQNALDAAKKH  135
             VV +A+     H
Sbjct  2255  VVSDAVSDLATH  2266

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 35/89 (39%), Gaps = 7/89 (8%)

Query  12    ATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLV-FNGADLQaaggggaS--PAT-PK  67
             AT     G   +    EGY+ KRGH   S R RY V    A L+       S  PA  P 
Sbjct  1218  ATGDSQPGGGLREALMEGYLVKRGHLIPSMRKRYCVLLKNASLEYFATHEDSRNPAIRPH  1277

Query  68    GSFFVSSVEKHEYWVGVMGGREKPFGFKL  96
             GSF V  V     W G    +    G +L
Sbjct  1278  GSFQVEIVSD---WHGKTASKSYDHGMEL  1303

>PYIW_21901
Length=913

 Score = 38.9 bits (89),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 58/135 (43%), Gaps = 9/135 (7%)

Query  7    PDMKLATSH--GSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPA  64
            PD+ LA      +  D F   S  G++ K GH RK+W+ RY V + + L+       +  
Sbjct  403  PDLVLAAQDEVNAFDDSF-LDSMRGWLRKLGHVRKNWKSRYFVLDRSVLRYYADESLARL  461

Query  65   TPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEV  124
              +   F  +   H   + + GG++  F    VG    K Y  L +  E L D   W+  
Sbjct  462  KGEVLLFHPATRVHYVDIHLSGGKDGTFAIH-VG----KDYALL-LQAEQLSDRENWMYC  515

Query  125  VQNALDAAKKHTRTP  139
            +++AL     + + P
Sbjct  516  IEDALLCRDSYHQDP  530

>SPRG_08346
Length=797

 Score = 38.5 bits (88),  Expect = 0.055, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 20/139 (14%)

Query  5    RVPDMKLATSHGSGG----DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            R  +M+L T   S G    +    T  EGY+ K+GH  ++WR RY V +G          
Sbjct  8    RSSEMELGTESISMGLHSFEDIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCFTYYASKE  67

Query  61   aSPATPKGSFFVSSVEKHEYWVGVMGGREKPF---GFKLVGHAPKKGYIELDIFVETLGD  117
            A+ A          +EK++  V V G ++ P    GF +     K       ++ +T  +
Sbjct  68   AASA---------DLEKYKGRVTVTGAKKDPSRSNGFVVTTSIDKL----FTMYTKTPIE  114

Query  118  LNKWVEVVQNALDAAKKHT  136
               W+ +++ A+     H+
Sbjct  115  TELWIRMIEKAVQNEYMHS  133

>PYAR_19291
Length=711

 Score = 38.5 bits (88),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 7/120 (6%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHE  79
            D F  + C G++ K GH RK+W++RY V   + L+       +    +   F  + + H 
Sbjct  204  DTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLRYYADEAMTRLKGEVLLFHPAAQVHY  262

Query  80   YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP  139
              + +  GR+  F  + VG      Y  L +  + + D   W+  +++AL     + + P
Sbjct  263  VDIHLSNGRDNTFAIQ-VG----PDYTLL-LEADRVSDRENWMYCIEDALLCRDSYLQDP  316

>SDRG_05150
Length=787

 Score = 38.5 bits (88),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 20/139 (14%)

Query  5    RVPDMKLATSHGSGG----DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggg  60
            R  +M+L T   S G    +    T  EGY+ K+GH  ++WR RY V +G          
Sbjct  8    RSSEMELGTESISMGLHSFEDIMDTDWEGYIWKQGHVVRNWRNRYAVLSGTCFTYYASKE  67

Query  61   aSPATPKGSFFVSSVEKHEYWVGVMGGREKPF---GFKLVGHAPKKGYIELDIFVETLGD  117
            A+ A          +EK++  V V G ++ P    GF +     K       ++ +T  +
Sbjct  68   AASA---------DLEKYKGRVTVTGAKKDPSRSNGFVVTTSIDKL----FTMYTKTPIE  114

Query  118  LNKWVEVVQNALDAAKKHT  136
               W+ +++ A+     H+
Sbjct  115  TELWIRMIEKAVQNEYMHS  133

>SDRG_05608
Length=121

 Score = 36.2 bits (82),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 42/112 (38%), Gaps = 32/112 (29%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP------------------------  63
            EG +TKR  + K WR RY V  G  L      G +P                        
Sbjct  13   EGELTKRSVWLKEWRARYFVLKGNKLYFCRAQGEAPHGMIDLSECLTVKSAEEKTNKRFC  72

Query  64   ---ATPKGSFFV--SSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110
               ATP+ ++++   S EK + W+G +G     F     G     GY E D+
Sbjct  73   FEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGYDEEDV  121

>PITG_00020
Length=927

 Score = 38.5 bits (88),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 58/154 (38%), Gaps = 40/154 (26%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEG++ KRG     W+ RY    G  LQ   G G S   PKG+  V              
Sbjct  274  CEGWLYKRGQRSTEWQRRYFKLKGFKLQYQDGPGES--VPKGAGTV--------------  317

Query  87   GREKPFGFKLVGHAPKKGYIELD------IFVETLGDLNKWVEVVQNALDAAKK------  134
                  G KL        Y++L       +  ++   ++KWV+ + + LD   K      
Sbjct  318  -----VGLKLGEAGSNSVYVQLSSGRVLCVSADSQASVDKWVQAICSLLDKDPKTLEKEV  372

Query  135  HTRTPGAADSSTTKNMF-------GFSATVSPQL  161
            H  + G +   ++ N+        G SA V P +
Sbjct  373  HAASAGVSKGGSSSNLLTRALSRAGSSACVPPPI  406

 Score = 32.3 bits (72),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (42%), Gaps = 16/108 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            C G++ K G   K+W+ RY   +G  L           +  G+   S    H     V+ 
Sbjct  798  CSGWLRKEGGTVKNWKRRYFTLHGPTLCYFK-------SDNGALLRSFTVCH-----VVT  845

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKK  134
             R K    ++     +K    L +  ET  DL++W++ +  A+ A K+
Sbjct  846  LRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKR  889

>PYU1_G001063
Length=783

 Score = 38.5 bits (88),  Expect = 0.068, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 25/53 (47%), Gaps = 6/53 (11%)

Query  7    PDMKLATSHGSGGDK------FKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            PD     S G  GD+            EGYVTKRGH  ++W+ R+    G +L
Sbjct  120  PDTGTPLSGGHEGDQAVESLDLPIVEWEGYVTKRGHLVRNWKNRFFTLEGTNL  172

>HYAP_13688
Length=1036

 Score = 38.1 bits (87),  Expect = 0.075, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 21/138 (15%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            ++  C G++ K G   KSW+ RY    GA L             KGS  + SV+     V
Sbjct  694  ESVGCVGWLRKEGGNVKSWKRRYFTLYGAKLSYYK-------CEKGS-LLRSVDT----V  741

Query  83   GVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAA  142
            GV      P G  +     +K  I+ D  VE     ++W+  +Q A  A++ H R    +
Sbjct  742  GVTVHPSMPNGLMVATAGGRKLIIQADTNVE----FDRWLNAIQRA--ASRGHDRR---S  792

Query  143  DSSTTKNMFGFSATVSPQ  160
              ST  +M  F  T S +
Sbjct  793  TVSTALSMTDFMETASSE  810

>SPRG_02502
Length=121

 Score = 36.2 bits (82),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 42/112 (38%), Gaps = 32/112 (29%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP------------------------  63
            EG +TKR  + K WR RY V  G  L      G +P                        
Sbjct  13   EGELTKRSVWLKEWRARYFVLKGNKLYFCRAQGEAPHGVIDLSECLTVKSAEEKTNKRFC  72

Query  64   ---ATPKGSFFV--SSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110
               ATP+ ++++   S EK + W+G +G     F     G     GY E D+
Sbjct  73   FEIATPESTYYMHAESEEKKDAWIGAIGRAIVKFSSSFTGD---DGYDEEDV  121

>SDRG_14487
Length=964

 Score = 38.1 bits (87),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 18/106 (17%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-ATPKGSFFVSSVEKHEYWVGVMG  86
            EG++ K+G    +W+ RY+V  G  +       ++P A  KG+F +++VE+         
Sbjct  7    EGWIYKQGSLMPTWKKRYMVLKGRHIAYYDKEVSNPRAKEKGTFTLAAVER-------TP  59

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
            G E   G  L G+    G I + I+ +T+G+      +  NA+ AA
Sbjct  60   GME--LGLTLAGY---DGKI-MHIYTKTVGEF----VLCNNAMTAA  95

>PYAP_23478
Length=897

 Score = 37.7 bits (86),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHE  79
            D F  + C G++ K GH RK+W++RY V + + L+     G +    KG   +       
Sbjct  372  DCFLDSMC-GWLRKLGHVRKNWKLRYFVLDKSVLRYYSDEGMTRL--KGEVLLFHPATQV  428

Query  80   YWVGVMGGREKPFGFKL-VGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
            ++V +   R K   F + VG  P+     L +  E L D   W+  +++AL     + + 
Sbjct  429  HYVDIHESRGKDHTFAIQVG--PE---YTLLLQAERLADRENWMYCIEDALLCRDSYLQD  483

Query  139  PGAA  142
            P  A
Sbjct  484  PKRA  487

>CCI46235
Length=1155

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 46/113 (41%), Gaps = 14/113 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +  V    Y     
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGATLTYYNTKEEARSARNLRGKMMIVKVRPENY-----  174

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
                K  GF +      KG+    +   T  + + W+E++Q A++ A   + T
Sbjct  175  ---GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQAVPFSNT  220

>PITG_02109
Length=522

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
            G+V K+G   K+W+ R++V +G  L        +P   PKGSF V +VE
Sbjct  138  GWVYKQGSLVKNWKKRFMVLSGRQLTYYDTSKLNPTVKPKGSFQVITVE  186

>SPRG_00889
Length=994

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 54/130 (42%), Gaps = 14/130 (11%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EG+V K+G +   W  RYLV +G  L          S    +G   ++       +VG  
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTLTYYSKQHDARSGKNLRGRMVLT-------YVGPD  175

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD-AAKKHTRTPGAADS  144
               +K  GF +      KG+    +   T  + + WVE++Q ALD A+   T+ P   D 
Sbjct  176  FKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSASTKPPPPQDD  231

Query  145  STTKNMFGFS  154
              +   +  S
Sbjct  232  FMSSPSYDLS  241

>H310_14019
Length=683

 Score = 37.4 bits (85),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 47/104 (45%), Gaps = 16/104 (15%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S EG++ KRG   K+W+ RY   NG +L+   G G   A PKG   V         VGV 
Sbjct  171  SFEGWLLKRGQRVKNWKRRYFTLNGQELKYMEGPG---AKPKGYGMV---------VGVK  218

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
               E P+    +   P +    LD+  E+  +   W++ + +A 
Sbjct  219  KLHELPYALS-ISIVPNR---TLDVQAESTDEQEAWMQRILDAC  258

 Score = 32.0 bits (71),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 11/27 (41%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYLVFNG  50
            AT+CEG++ K+G   K+W+ R+    G
Sbjct  341  ATTCEGWLYKQGSLVKNWKKRWFTLLG  367

>PYAP_17290
Length=835

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADL  53
            EGYVTKRGH  ++W++R+    G +L
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL  178

>PHYRA_77834
Length=936

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 22/49 (45%), Gaps = 0/49 (0%)

Query  2    NILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNG  50
            N    P   L+  H            EGYVTKRGH  ++W++R+    G
Sbjct  93   NSRSTPPSSLSGDHAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG  141

>CCA18023
Length=1138

 Score = 37.4 bits (85),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 14/107 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYLV +GA L          S    +G   +  V    Y     
Sbjct  125  EGYVRKKGDWLPRWEERYLVLDGATLTYYNTKEEARSARNLRGKMMIVKVRPENY-----  179

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
                K  GF +      KG+    +   T  + + W+E++Q A++ A
Sbjct  180  ---GKAHGFLI----ETKGHKHFHLCCATELEKDMWIEMMQAAIEQA  219

>PYAP_16297
Length=2466

 Score = 37.4 bits (85),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 40/96 (42%), Gaps = 9/96 (9%)

Query  7     PDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-  65
             P+    TS+ SGGD+      EGY+ KRGH   S R RY +     L        S  T 
Sbjct  1150  PNGNEFTSNESGGDEIL---MEGYLVKRGHLVPSMRKRYCMLVKNVLTYYLTHEDSRNTE  1206

Query  66    --PKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGH  99
               P GSF V  V     W G    +   +G +L  H
Sbjct  1207  IQPLGSFRVEIVSD---WHGKTTTQTYEYGMELETH  1239

>PPTG_14630
Length=398

 Score = 37.0 bits (84),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
           G+V K+G   K+W+ R++V +G  L         P   PKGSF V +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLSGRQLTYYDTSKLVPTVKPKGSFQVITVE  60

>CCA22367
Length=885

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 26/110 (24%), Positives = 48/110 (44%), Gaps = 8/110 (7%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
            +G++ KRGH +K+W+ RY       LQ       +    +G+  ++             G
Sbjct  544  DGFLWKRGHLKKNWKKRYFRIEDGQLQ---YFTENKKLMRGAIPLNGTVVSPGMTCCPDG  600

Query  88   REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTR  137
            R+  F    + H       EL +  ET  ++++WV+V+Q A    ++  R
Sbjct  601  RKNYFVISNMNHKS-----ELHLNAETEAEMHEWVQVLQQAQSGFERKKR  645

>PYAP_22646
Length=815

 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 56/143 (39%), Gaps = 40/143 (28%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVS------SVEKH  78
            T  EGY+ K+GH  +SWR RY + +G                  S+++S        EK+
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAILSGTTF---------------SYYISKDVAMLDTEKY  144

Query  79   EYWVGVMGGR---EKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
               V V G +    +  G  +     K       ++  T  +   WV+++Q A+      
Sbjct  145  RGRVSVTGAKRDDSRTNGVLITTTIHKI----FALYTRTPVEAEIWVKMIQQAV------  194

Query  136  TRTPGAADSSTTKNMFGFSATVS  158
                  A++ST K     S TVS
Sbjct  195  ------ANASTPKPSVSISTTVS  211

>PYIW_18480
Length=755

 Score = 37.0 bits (84),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 55/132 (42%), Gaps = 28/132 (21%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVS------SVEKH  78
            T  EGYV K+GH  +SWR RY + +G                  S++VS        EK 
Sbjct  50   TDWEGYVWKQGHVVRSWRYRYAILSGTTF---------------SYYVSKEVAMVDTEKF  94

Query  79   EYWVGVMGGRE---KPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
               V V G R+   +  G  LV     K +    ++  T  +   WV ++Q A+  A   
Sbjct  95   RGRVTVTGARKDDSRANGV-LVTTTINKVF---SLYTRTPIESEIWVRMIQQAVVNASGQ  150

Query  136  TRTPGAADSSTT  147
              +  A+ ++TT
Sbjct  151  KPSMSASATNTT  162

>SPRG_06021
Length=983

 Score = 37.0 bits (84),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query  29   GYVTKRGHFRKSWRVRYLVFN--------GADLQaaggggaSPATPKGSFFVSSVEKHEY  80
            GY++KRG +RK+W+ RY +              Q     G  P TP      +S+     
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPITPNTRVIDNSI-----  193

Query  81   WVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAK  133
                 G ++ PF F++  H P++    L +   T+ +  KW+  ++  ++  +
Sbjct  194  -----GCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVR  236

>PHYKE_2479
Length=171

 Score = 35.4 bits (80),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNG  50
           EGYVTKRGH  ++W++R+    G
Sbjct  76  EGYVTKRGHLVRNWKMRFFTLEG  98

>PHALS_03645
Length=830

 Score = 36.6 bits (83),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            D    T  EGY+ K+GH  +SWR RY V +G 
Sbjct  96   DDIFETDWEGYIWKQGHVVRSWRYRYAVLSGT  127

>H257_03361
Length=699

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 55/113 (49%), Gaps = 14/113 (12%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-ATPKGSFFVSSVEKHEYWVGVMG  86
            +G++ K+G    SW+ RYLV +G ++       ++P A  KGSF ++ V+ ++ +     
Sbjct  11   QGWIQKQGSVVPSWKKRYLVLSGQNISYFDKEVSNPRAKEKGSFVLAGVQPNKSYDN---  67

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP  139
                  G  L+    K+G   ++I  +T+G+       ++NA+   ++    P
Sbjct  68   ------GMTLLS---KEGK-AMNITTKTVGEYVMCKNALENAVSLPRRRVSNP  110

>PHYKE_6662
Length=765

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 45/110 (41%), Gaps = 14/110 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaagg--ggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EG+V K+G +   W  RYL+ +GA L          S    +G   +  V    Y     
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATLTYYNSKEEARSARNLRGRMIIVKVRPENY-----  126

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
             G+   F  +  GH     +  L    E   D+  WVE++Q A++   +H
Sbjct  127  -GKAHGFLIETQGHK----HFHLCCSTELEKDM--WVEMMQAAIEEGVRH  169

>PHYRA_79281
Length=809

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 6/47 (13%)

Query  7    PDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            PD+  A       D F+ T  EGY+ K+GH  +SWR RY V +G   
Sbjct  88   PDLSCAFE-----DIFE-TDWEGYIWKQGHVVRSWRYRYAVLSGTTF  128

>PHYSO_344112
Length=813

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY V +G   
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF  129

>PHYKE_5678
Length=809

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY V +G   
Sbjct  100  TDWEGYIWKQGHVVRSWRYRYAVLSGVTF  128

>PHYCA_506137
Length=810

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY V +G   
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF  129

>PPTG_05519
Length=810

 Score = 36.6 bits (83),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY V +G   
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF  129

>PITG_02762
Length=810

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY V +G   
Sbjct  101  TDWEGYIWKQGHVVRSWRYRYAVLSGTTF  129

>HYAP_08026
Length=798

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            T  EGY+ K+GH  +SWR RY V +G 
Sbjct  88   TDWEGYIWKQGHVVRSWRYRYAVLSGT  114

>SDRG_01408
Length=916

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 51/129 (40%), Gaps = 13/129 (10%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EG+V K+G +   W  RYLV +G  L          S    +G   ++       +VG  
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTLTYYSKQHDARSGKNLRGRMVLT-------YVGPD  177

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSS  145
               +K  GF +      KG+    +   T  + + WVE++Q ALD A      P   D  
Sbjct  178  FKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEANGAANKPAQDDDF  233

Query  146  TTKNMFGFS  154
             +   +  S
Sbjct  234  MSSPSYDLS  242

>PHALS_06533
Length=930

 Score = 36.6 bits (83),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W++R+    G
Sbjct  111  EGYVTKRGHLVRNWKMRFFTLEG  133

>PYU1_G003229
Length=810

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (43%), Gaps = 19/114 (17%)

Query  19   GDKFKATS-CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPA-TPKGSFFVSSVE  76
            G+ F  T+ CEG++ KRG    +W+ R+   NG  LQ       SP   PKG   V    
Sbjct  251  GETFNETNMCEGWLYKRGQRSTAWKKRFFTLNGFQLQ----YQDSPGENPKGEGSV----  302

Query  77   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
                 V +  G E  F  ++       G I L +  ++   +N WV+ +   L+
Sbjct  303  -----VDIQLGDEGTFSMEI---QLDTGRI-LSVTADSQDQVNMWVDAICTVLE  347

 Score = 32.7 bits (73),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (64%), Gaps = 2/33 (6%)

Query  23  KATSCE--GYVTKRGHFRKSWRVRYLVFNGADL  53
           K+T C+  G+ +K+G   KSW+ RY V  G +L
Sbjct  23  KSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL  55

>PPTG_14626
Length=1055

 Score = 36.6 bits (83),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 48/121 (40%), Gaps = 34/121 (28%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFF----VSSVEKHE---  79
            C G++ K G   KSW+ RY    G+ L           + KGS      V +VE H    
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKLSYYK-------SEKGSLLRSVSVINVEPHPSVS  766

Query  80   --YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTR  137
                V  +GGR      KL+  A            E+ G+ NKW+  +Q A+  A +   
Sbjct  767  LGLTVSTVGGR------KLIVQA------------ESNGEFNKWLNAIQEAVAEASERNS  808

Query  138  T  138
            T
Sbjct  809  T  809

>PPTG_14612
Length=331

 Score = 36.2 bits (82),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 52/102 (51%), Gaps = 5/102 (5%)

Query  124  VVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDALREIEG  183
            +VQ+  D A   T++      ++TK  F  +A + P  + K+   T EELLR  +R  E 
Sbjct  34   IVQDESDPASTFTQSSKYISRASTKRTFRSTADILPSSR-KRRKVTPEELLRRKIRRREV  92

Query  184  AKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNH  225
             ++  +  ++    Q   L  +EDD+ K++ D+  G +L +H
Sbjct  93   CRVNQQRYMNK---QRQLLADLEDDICKLQEDI-KGLELQHH  130

>SPRG_02752
Length=831

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 50/106 (47%), Gaps = 18/106 (17%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-ATPKGSFFVSSVEKHEYWVGVMG  86
            EG++ K+G    +W+ RY+V  G  +        +P A  KG+F +++VE+         
Sbjct  7    EGWIYKQGSLMPTWKKRYMVLKGRHIAYYDKEVTNPRAKEKGTFTLAAVER-------TP  59

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
              E   G  L G+    G I + I+ +T+G+      +  NA+ AA
Sbjct  60   AME--LGLTLAGY---DGKI-MHIYTKTVGEF----VLCNNAMTAA  95

>CCI41225
Length=981

 Score = 36.2 bits (82),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADL  53
            EGYVTKRGH  ++W++R+    G  L
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL  165

>CCA21715
Length=782

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            T  EGY+ K+GH  +SWR RY V +G 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>CCA21860
Length=782

 Score = 36.2 bits (82),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            T  EGY+ K+GH  +SWR RY V +G 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>CCI40991
Length=801

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            T  EGY+ K+GH  +SWR RY V +G 
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGT  132

>CCA16487
Length=975

 Score = 36.2 bits (82),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADL  53
            EGYVTKRGH  ++W++R+    G  L
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL  163

>PHYSO_343629
Length=977

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W++R+    G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>PYIR_15309
Length=937

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADL  53
            EGYVTKRGH  ++W+ R+    G +L
Sbjct  148  EGYVTKRGHLVRNWKNRFFTLEGNNL  173

>PYIW_13172
Length=939

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADL  53
            EGYVTKRGH  ++W+ R+    G +L
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL  175

>PYU1_G012859
Length=1183

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 52/117 (44%), Gaps = 16/117 (14%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGV  84
            ++C G++ K+G   K+W+ RY   +G  L+       S      SF +S VEK       
Sbjct  809  SNCHGWLNKQGGTIKTWKRRYFSLHGTTLRYFKRETGSMLR---SFTISHVEKQP-----  860

Query  85   MGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGA  141
                +   G +++  + +K    L +  E+  D  +W+  +Q ++ A     ++P A
Sbjct  861  ----QVALGLEVMTTSGRK----LMLTAESKEDYGRWLRALQASISAESSVPKSPTA  909

 Score = 35.4 bits (80),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 43/105 (41%), Gaps = 26/105 (25%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFV-----SSVEKHEYWVG  83
            G++ K+GH  +SW+ RY V +G  LQ           P+G   V      +V+++   V 
Sbjct  497  GWLLKQGHLIRSWKQRYFVLHGDSLQYFENIDK---PPRGGGIVVHVLRDTVDQNCLDVH  553

Query  84   VMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNA  128
            +  GR                   L I  +   DLN W + +QNA
Sbjct  554  LANGR------------------VLKISADARDDLNSWYDALQNA  580

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFN  49
            +CEG++ K+GH  K W+ RY   N
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLN  381

>PPTG_13401
Length=927

 Score = 36.2 bits (82),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W++R+    G
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG  131

>PYAR_19914
Length=788

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            EGYVTKRGH  ++W+ R+    G +L 
Sbjct  146  EGYVTKRGHLVRNWKNRFFTLEGNNLS  172

>PYVX_13574
Length=950

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W++R+    G
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG  181

>PITG_18067
Length=924

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W++R+    G
Sbjct  109  EGYVTKRGHLVRNWKMRFFTLEG  131

>PYU1_G007423
Length=928

 Score = 36.2 bits (82),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 29/117 (25%), Positives = 49/117 (42%), Gaps = 6/117 (5%)

Query  26   SCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVM  85
            S  G++ K GH RK+W+ RY V   + L+       +    +   F  +   H   + + 
Sbjct  433  SMRGWLRKLGHVRKNWKSRYFVLERSVLRYYSDDSMTRLKGEVLLFHPATRVHYVDIHLS  492

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAA  142
            GGR+  F  + VG    K Y  L +  + L     W+  +++AL     +   P  A
Sbjct  493  GGRDCTFAIQ-VG----KDYTLL-LQADQLSVRENWMYCIEDALLCRDSYYEDPEQA  543

>H257_00729
Length=121

 Score = 33.9 bits (76),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 35/88 (40%), Gaps = 29/88 (33%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP------------------------  63
           EG +TKR  + K WR RY V  G  L      G SP                        
Sbjct  13  EGELTKRSVWLKEWRTRYFVLKGNKLYFCRVKGESPHGVIDLSECLTVKSAEEKTNKRYC  72

Query  64  ---ATPKGSFFV--SSVEKHEYWVGVMG  86
              ATP+ ++++   S ++ E W+G +G
Sbjct  73  FEVATPEATYYMHAESEKQKEEWIGAIG  100

>PYIR_14494
Length=819

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query  19   GDKFKATS-CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP  63
            G+ F  T+ CEG++ KRG    +W+ R+   NG  LQ     G +P
Sbjct  256  GETFAETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQYQENPGDNP  301

 Score = 34.7 bits (78),  Expect = 0.89, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 44/113 (39%), Gaps = 16/113 (14%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            C G++ K G   K+W++RY   NGA L           +  G    +    H     V+ 
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATLSYFK-------SDNGPLLKTLKVCH-----VLV  763

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP  139
             R K F  ++   + +K    L I  E+  +  +W+  +  A+   K     P
Sbjct  764  MRTKKFCLEITTESGRK----LLIAAESNAEYERWLAALHQAVSTEKTRKENP  812

>PYVX_13312
Length=1016

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 44/105 (42%), Gaps = 14/105 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaagg--ggaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +GA L          S    +G   +S V    Y     
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAALTYYNSKDEARSGRNLRGRMQLSRVRPENYG----  131

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
                K  GF +      +G+    +   T  + + WVE++Q A+D
Sbjct  132  ----KAHGFLIE----TRGHKSFHLCCTTELEKDMWVEMMQAAID  168

>PYIW_20891
Length=291

 Score = 35.4 bits (80),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATP-KGSFFVSSVE  76
           G+V K+G   ++W+ R+LV  G  L        +P T  KGSF V +VE
Sbjct  9   GWVFKQGSLVRNWKKRFLVLRGKQLTYYDTASLTPKTKEKGSFQVITVE  57

>PHYCA_504801
Length=398

 Score = 35.4 bits (80),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
           G+V K+G   K+W+ R++V  G  L        +P T  KGSF V +VE
Sbjct  12  GWVYKQGSLVKNWKKRFMVLRGRQLTYYDTAKVNPTTKAKGSFQVITVE  60

>SDRG_05567
Length=980

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query  29   GYVTKRGHFRKSWRVRYLVFN--------GADLQaaggggaSPATPKGSFFVSSVEKHEY  80
            GY++KRG +RK+W+ RY +              Q     G  P TP      +S+     
Sbjct  137  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQVPITPNTRVIDNSI-----  191

Query  81   WVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAK  133
                 G ++ PF F++  H P++    L +   T+ +  KW+  ++  ++  +
Sbjct  192  -----GCQKAPFYFEV--HTPRR---VLYLGAGTVQEHRKWIRSIRETVELVR  234

>CCA19097
Length=688

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (44%), Gaps = 13/107 (12%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGGR  88
            G+V K+G   K+W+ RY+V NG  L+      +     KGS  + SVE       +  GR
Sbjct  9    GWVHKQGAVIKTWKRRYMVLNGNVLKYYDSALSIKMEEKGSVQILSVEMSG---SIQNGR  65

Query  89   EKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
                    + H   KG   L I+ ++     +W E + N +   +K+
Sbjct  66   --------IMHG--KGGRVLKIYTDSSMQNKEWFEAITNVVCGIEKY  102

>SPRG_09128
Length=620

 Score = 35.4 bits (80),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPK  67
            G++ K GH RKSW+ R+ V +G+ LQ      +   TPK
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQYYTDDVSKVKTPK  306

>PYU1_G004386
Length=837

 Score = 35.4 bits (80),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGA  51
            D    T  EGY+ K+GH  +SWR RY + +G 
Sbjct  131  DDMFETDWEGYLWKQGHVVRSWRYRYAILSGT  162

>H310_01094
Length=121

 Score = 33.5 bits (75),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 35/88 (40%), Gaps = 29/88 (33%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP------------------------  63
           EG +TKR  + K WR RY V  G  L      G SP                        
Sbjct  13  EGELTKRSVWLKEWRARYFVLKGNKLYFCRVKGESPHGVIDLSECLTVKSAEEKTNKRYC  72

Query  64  ---ATPKGSFFV--SSVEKHEYWVGVMG  86
              ATP+ ++++   S ++ E W+G +G
Sbjct  73  FEVATPESTYYMHAESEKQKEEWIGAIG  100

>PHYCA_503112
Length=214

 Score = 34.7 bits (78),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNG  50
            EGYVTKRGH  ++W+ R+    G
Sbjct  117  EGYVTKRGHLVRNWKSRFFTLEG  139

>SDRG_02154
Length=822

 Score = 35.0 bits (79),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPA-TPKGSFFVSSVEK  77
            G++ K+G   K+W+ R++V     L        +P   PKGSF V ++E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLHYFETDKLTPTLKPKGSFQVLAIER  177

>PYIR_13120
Length=814

 Score = 35.0 bits (79),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            T  EGY+ K+GH  +SWR RY + +G   
Sbjct  104  TDWEGYLWKQGHVVRSWRYRYAILSGTTF  132

>CCI42088
Length=1007

 Score = 35.0 bits (79),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 24/101 (24%), Positives = 43/101 (43%), Gaps = 8/101 (8%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
            +G++ KRGH +K+W+ R+       LQ            KG+  ++             G
Sbjct  666  DGFLWKRGHLKKNWKKRFFRVENGQLQYFTENR---KLMKGAIPLNGTVVSPGMTCCPDG  722

Query  88   REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNA  128
            R+  F    + H       EL +  ET  ++++W+E +Q A
Sbjct  723  RKNYFVISNMSHTK-----ELHLNAETEAEMHEWIEALQRA  758

>PYAP_14828
Length=604

 Score = 35.0 bits (79),  Expect = 0.75, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (47%), Gaps = 16/92 (17%)

Query  39   KSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVG  98
            + W+  + V +G D + +   G +    KG   V SVE+   W G      KP+G K V 
Sbjct  201  RKWKRYFAVLSGVDFRYSSEPGRAS---KGFGMVKSVER---WDG------KPYGIKFVY  248

Query  99   HAPKKGYIELDIFVETLGDLNKWVEVVQNALD  130
             +      E+  +  T  D N+W+++V  A+D
Sbjct  249  TSGA----EVPAYCATEQDRNEWIDIVTRAID  276

>PYAR_19883
Length=833

 Score = 35.0 bits (79),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNG  50
            T  EGY+ K+GH  ++WR RY + +G
Sbjct  100  TDWEGYIWKQGHVVRNWRYRYAILSG  125

>CCI43456
Length=126

 Score = 33.1 bits (74),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 21/96 (22%), Positives = 38/96 (40%), Gaps = 29/96 (30%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP----------------  63
            D+ +  + EG +TKR  + K WR RY +  G  L  +     +P                
Sbjct  13   DRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFSKSKNDAPHGFIDLADCLTVKSAE  72

Query  64   -----------ATPKGSFFV--SSVEKHEYWVGVMG  86
                       ATP  ++++   + E+ + W+G +G
Sbjct  73   DKTNKRYCFEVATPDTTYYMYAQNEEQKDEWIGAIG  108

>PYAP_13695
Length=348

 Score = 34.7 bits (78),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-ATPKGSFFVSSVE  76
           G++ K+G   K+W+ R++V  G  L        SP    KGSF V +VE
Sbjct  12  GWIYKQGSLVKNWKRRFMVLRGKQLTYYDTERISPRVKEKGSFQVITVE  60

>CCI42457
Length=906

 Score = 35.0 bits (79),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYLVFNG  50
            A   EGYV KRGH  ++W++R+    G
Sbjct  126  AVEWEGYVIKRGHLVRNWKMRFFTLEG  152

>CCA17102
Length=884

 Score = 34.7 bits (78),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            A   EGYV KRGH  ++W++R+    G  L
Sbjct  106  AVEWEGYVIKRGHLVRNWKMRFFTLEGNRL  135

>PYU1_G004115
Length=144

 Score = 33.5 bits (75),  Expect = 0.90, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (45%), Gaps = 4/65 (6%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFF--VSSVE--KHEYWVGV  84
           GY+ KRG   K+W+ RY VF    L        +  T +      VS  E  KH   V +
Sbjct  19  GYLIKRGERIKTWKRRYFVFQRGCLSYRKDSRDNSKTLRSDLVLNVSYYEGKKHGLSVRL  78

Query  85  MGGRE  89
           M GRE
Sbjct  79  MSGRE  83

>H257_09823
Length=654

 Score = 34.7 bits (78),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 27/118 (23%), Positives = 52/118 (44%), Gaps = 14/118 (12%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATP-------KGSFFVSSVEKHEYW  81
            G++ K GH RK+W+ R+ V +G+ LQ       +  TP       KG   +   +   ++
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQYFTDDVDA-TTPKSKTHKLKGEVLLFHKDTTVHY  323

Query  82   VGV-MGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRT  138
            V + + GR+  F  +  G     G   L +   +L +   W+  ++ A+   + +  T
Sbjct  324  VDIHLTGRDYTFAVETSG-----GDYSLVLQAASLDEREDWIFAIEEAILCRESYQET  376

>SDRG_14286
Length=670

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPK  67
            G++ K GH RK+W+ R+ V +G+ LQ      +   TPK
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQYYTDDVSKAKTPK  315

>PYU1_G012870
Length=352

 Score = 34.3 bits (77),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
           G+V K+G   ++W+ R++V  G  L        SP T  KGSF V + E
Sbjct  7   GWVFKQGSLVRNWKKRFMVLRGKQLTYYDTASISPKTKEKGSFQVITAE  55

>SPRG_16312
Length=261

 Score = 33.9 bits (76),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSV  75
           GYV K+G F K+W+ R++V +  D         + A P+G F V+SV
Sbjct  43  GYVRKQGSFVKNWKRRFMVLHD-DTLFYYVSERAMAKPRGFFRVTSV  88

>PHALS_03540
Length=904

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 51/123 (41%), Gaps = 19/123 (15%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            C G++ K G   K+W+ RY   +GA L           +  G+   S    H     V+ 
Sbjct  786  CSGWLRKEGGTVKNWKRRYFTLHGATLCYFK-------SDNGALLRSFTVCH-----VVT  833

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSST  146
             R K    ++     +K    L +  ET  DL++W++ +  A+ A K+  +     DSS 
Sbjct  834  LRTKRLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAIAAEKQKKQN---TDSSQ  886

Query  147  TKN  149
              N
Sbjct  887  WTN  889

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            CEG++ KRG     W+ RY +  G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PYAR_18690
Length=2455

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 30/76 (39%), Gaps = 7/76 (9%)

Query  28    EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaS----PATPKGSFFVSSVEKHEYWVG  83
             EGY+ KRGH   S R RY V     L        S     + P GSF V  V     W G
Sbjct  1138  EGYLVKRGHLVPSMRKRYCVLVKNVLTYYLTQEDSRNSDTSQPLGSFRVEIVSD---WHG  1194

Query  84    VMGGREKPFGFKLVGH  99
                 +   FG +L  H
Sbjct  1195  KTAMQTYEFGMELETH  1210

>HYAP_04457
Length=1203

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 44/110 (40%), Gaps = 14/110 (13%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggg--gaSPATPKGSFFVSSVEKHEYWVGVM  85
            EGYV K+G +   W  RYL+ +G  L          S    +G   +  V    Y     
Sbjct  62   EGYVRKKGDWLPRWEERYLILDGPTLTYYNSKEDARSARNLRGRMLLLKVRPENY-----  116

Query  86   GGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH  135
                K  GF L   + K  ++     +E     + WVE++Q A++   KH
Sbjct  117  ---GKAHGFFLETQSHKHFHLCCSSELEK----DMWVEMMQAAIEEGTKH  159

>H257_08182
Length=859

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 19/111 (17%)

Query  23   KATSC----EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKH  78
            + TSC    EG++ K+G   KSW+ RY V +G DL             +G+F        
Sbjct  655  RRTSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDLAYYKDELRGTVLGQGTF--------  706

Query  79   EYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
               V V    +KP+   ++ +  +     L + + +  D   W+  +Q+AL
Sbjct  707  ---VHVKPNPDKPWSLVIILNTGRL----LVVALSSEHDEATWLHALQSAL  750

>H310_07701
Length=811

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 16/111 (14%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGV  84
            T  EGYV K+GH  ++WR RY +  G           +         +S  EK +  V V
Sbjct  50   TDWEGYVWKQGHVVRNWRNRYGILTGTCFTYYSSKEHA---------MSDFEKFKGRVTV  100

Query  85   MGGREKPF---GFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
             G ++ P    GF +     K       ++ +T  +   W+ +++ A+  A
Sbjct  101  TGAKKDPSRSNGFVVTTTIDK----VFCMYTKTPIETELWIRMIEKAVQIA  147

>CCA19118
Length=125

 Score = 32.3 bits (72),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 21/107 (20%), Positives = 40/107 (37%), Gaps = 29/107 (27%)

Query  9    MKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP-----  63
            M +        ++ +  + EG +TKR  + K WR RY +  G  L  +     +P     
Sbjct  1    MSIENEENLSTERIQNPAFEGELTKRSMWMKEWRKRYFILKGNKLYFSKSKNDAPHGFID  60

Query  64   ----------------------ATPKGSFFV--SSVEKHEYWVGVMG  86
                                  ATP  ++++   + E+ + W+G +G
Sbjct  61   LADCLTVKSAEDKTNKRFCFEVATPDTTYYMYAQNEEQKDEWIGAIG  107

>PHALS_06568
Length=388

 Score = 33.5 bits (75),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaa-ggggaSPATPKGSFFVSSVE  76
           G+V K+G   KSW+ RY+V +G  L             PKGS  V +VE
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGRQLTYYDTAKVDQKVKPKGSCQVITVE  60

>SPRG_08834
Length=825

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPA-TPKGSFFVSSVEK  77
            G++ K+G   K+W+ R++V     L        +P   PKGSF V  +E+
Sbjct  128  GWICKQGSVVKNWKRRFMVLQSCHLHYFETDKLTPTLKPKGSFQVLVIER  177

>H310_06378
Length=837

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNG  50
           EG+V K+GH  ++W+VRY    G
Sbjct  59  EGFVQKKGHLVRNWKVRYFTLEG  81

>PHYSO_484541
Length=911

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 52/124 (42%), Gaps = 17/124 (14%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            C G++ K G   K+W+ RY   +G  L           +  G+   S    H     V+ 
Sbjct  781  CSGWLRKEGGTVKNWKRRYFTLHGPTLCYFK-------SDNGALLRSFTVCH-----VVT  828

Query  87   GREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSST  146
             R K    ++     +K    L +  ET  DL++W++ +  A+ AA+K  +  G A    
Sbjct  829  LRTKKLCLEITTEVGRK----LLVASETQADLDRWLDHLHRAI-AAEKRKKHGGDAPQRK  883

Query  147  TKNM  150
            T+ M
Sbjct  884  TETM  887

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 61/160 (38%), Gaps = 38/160 (24%)

Query  27   CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMG  86
            CEG++ KRG     W+ RY    G  LQ   G G S   PKG+  V              
Sbjct  273  CEGWLYKRGQRSTEWQRRYFRLKGYKLQYQDGPGES--VPKGAGTV--------------  316

Query  87   GREKPFGFKLVGHAPKKGYIELD------IFVETLGDLNKWVEVVQNALDAAKK--HTRT  138
                  G KL        Y++L       +  ++   ++KWV+ +   LD   K      
Sbjct  317  -----VGLKLGETGSNCVYVQLGSGRVLCVSADSQASVDKWVKAICGLLDKDPKTLEKEV  371

Query  139  PGAADS--STTKNMF-------GFSATVSPQLQVKKLAAT  169
            P A  S  +++ N+        G +A+  P L    +A++
Sbjct  372  PAAVISKGASSSNLLTRALSRAGSTASAPPVLPTSGVASS  411

>H257_07514
Length=810

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 16/111 (14%)

Query  25   TSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGV  84
            T  EGYV K+GH  ++WR RY +  G           +         ++  EK +  V V
Sbjct  50   TDWEGYVWKQGHVVRNWRNRYGILTGTCFTYYSSKEHA---------MADFEKFKGRVTV  100

Query  85   MGGREKPF---GFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
             G ++ P    GF +     K       ++ +T  +   W+ +++ A+  A
Sbjct  101  TGAKKDPSRSNGFVVTTSIDK----VFCMYTKTPIETELWIRMIEKAIQVA  147

>PHALS_04098
Length=1183

 Score = 33.9 bits (76),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADL  53
           EGYV K+G +   W  RYL+ +GA L
Sbjct  75  EGYVRKKGDWLPRWEERYLILDGATL  100

>H257_13567
Length=836

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 0/23 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNG  50
           EG+V K+GH  ++W+VRY    G
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEG  83

>H257_14025
Length=243

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 37/155 (24%), Positives = 59/155 (38%), Gaps = 16/155 (10%)

Query  5    RVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQ-aaggggaSP  63
            RVPD     S+ SG D       +G++ K+      WR +Y V  G  L           
Sbjct  14   RVPD-----SNPSGNDA------QGWLWKKCGVFSLWRRKYFVLCGPLLSFYDTLPDTCS  62

Query  64   ATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVE  123
            A P       +    +  + V+       GFK+ G + K  ++  +          KWV+
Sbjct  63   ANPSIVLSSGTCSSPQGVLRVVYVESTSKGFKVFGSSGKVIHVRANTSSTDF----KWVQ  118

Query  124  VVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVS  158
            V Q A    ++   TP  +D S+T  +     T+S
Sbjct  119  VCQRAAMLMQQQKETPSPSDCSSTCTVLSDHDTLS  153

>PYIR_22259
Length=144

 Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 25/64 (39%), Gaps = 4/64 (6%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSV----EKHEYWVGV  84
           GY++KRG   K+WR RY VF    L                  V       +KH   V +
Sbjct  19  GYLSKRGERIKTWRRRYFVFQNGCLSYRKDSREHTKVLCSELIVDVAYYDGKKHGLCVRL  78

Query  85  MGGR  88
           M GR
Sbjct  79  MSGR  82

>HYAP_13757
Length=262

 Score = 32.7 bits (73),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADL  53
           G++ KRGH  K+W+ R+ + NGA L
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL  39

>H257_06469
Length=76

 Score = 30.8 bits (68),  Expect = 2.5, Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)

Query  28  EGYVTKRGHFRKSWRVRYL  46
           EGYV K+GH  KSW+ RY 
Sbjct  2   EGYVFKQGHVVKSWQRRYF  20

>PYIR_13555
Length=355

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
           G+V K+G   ++W+ RY+V  G  L        +  T  KGSF V +VE
Sbjct  10  GWVFKQGSLVRNWKKRYMVLRGKQLTYYDTASLTAKTKEKGSFQVITVE  58

>PYAP_19560
Length=337

 Score = 33.1 bits (74),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 76/189 (40%), Gaps = 54/189 (29%)

Query  2    NILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaagggga  61
            +ILR+P M +           +     G++ K+G   K+W+ R+ + NG+ L        
Sbjct  73   SILRLPTMYV-----------RGPVFHGWLWKKGASFKTWKKRFFLLNGSTLTYYTQSCV  121

Query  62   -----------SPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDI  110
                        PA  KG   V+S +  +         E  FG ++V  + +       +
Sbjct  122  VATEVGTRCFDMPA--KGGLRVASADFTD---------ETSFGIRIVSSSGRV------L  164

Query  111  FVETLGDLN---KWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLA  167
            FV+  GD     KW+ V+Q   +A+KK+    G+ DS        F +T+  +L   +  
Sbjct  165  FVQA-GDRTSRIKWLGVLQ---EASKKYKHGSGSGDS--------FRSTIVSELSSFRPT  212

Query  168  ATKEELLRD  176
            AT    + D
Sbjct  213  ATGSPYVND  221

>SPRG_02939
Length=2161

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 27/109 (25%), Positives = 46/109 (42%), Gaps = 8/109 (7%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            +A + EGY+ K+GHF  + + +Y+V  G  L       A  A        S V     W 
Sbjct  461  EAATVEGYLVKQGHFVPTMKQKYVVLRGNHLFFYASYDAYMAKTTADVGCSQVASVGDWD  520

Query  83   G--VMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            G  ++     PF  + V HA      ++     T  + +KW+  ++ A+
Sbjct  521  GHTLLLTYPHPFRIETVAHA------QVLCSAPTASEKDKWMRGLRAAI  563

>PHYSO_485120
Length=122

 Score = 31.6 bits (70),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 0/26 (0%)

Query  24  ATSCEGYVTKRGHFRKSWRVRYLVFN  49
           AT  +GY+ +RG   KSWR R+ VF 
Sbjct  6   ATVVDGYLERRGRHLKSWRRRFFVFE  31

>PHYSO_478611
Length=522

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
            G+V K+G   K+W+ R++V  G  L         P    KGSF V +VE
Sbjct  141  GWVYKQGSLVKNWKKRFMVLRGRQLTYYDTAKVDPTVKAKGSFQVITVE  189

>PYAR_25115
Length=312

 Score = 32.7 bits (73),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (45%), Gaps = 8/89 (9%)

Query  150  MFGFSATVSPQLQVKKLAATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDL  209
            +F FS  +  Q Q+  LA TK      A   +  A ++      DI   G  L  + + L
Sbjct  94   IFPFSGKLPTQEQIYALATTK------ACTALFTACVLADLPQCDISELG--LKSVVETL  145

Query  210  GKVESDLDHGGKLLNHMKRPMLHLFSNDN  238
             KV  D+DHG    + M+   LH++  D+
Sbjct  146  LKVTVDIDHGKPAPDTMQFHNLHIWRRDS  174

>PYU1_G011261
Length=1328

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 33/144 (23%), Positives = 58/144 (40%), Gaps = 21/144 (15%)

Query  3    ILRVPDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaS  62
            + R+P   L  S        ++T   G++ K+G   +S++ RY+  NG  L         
Sbjct  144  VARIP-ANLIISDSDVTSTVESTFISGFLRKKGEKNRSFKRRYMELNGTVLSYYKKKPEK  202

Query  63   PATPKGSFFVSSVEKHEYWVGV-----------MGGREKPFGFKLVGHAPKKGYIELDIF  111
                K    +S+ EK  Y  G            M  + +PFG  LV  A  + ++   I 
Sbjct  203  ----KSGIPLSAAEKKAYERGSIDLDRVSSLQPMENKSEPFGIHLVTTA--RTWV---IA  253

Query  112  VETLGDLNKWVEVVQNALDAAKKH  135
             E+  D  +W++V+   +  +  H
Sbjct  254  AESDQDYQRWLKVLCGVVKYSAVH  277

>SDRG_14486
Length=308

 Score = 32.7 bits (73),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (51%), Gaps = 6/67 (9%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE-----KHEYW  81
           +G+V K+G   +SW+ RY+V     L        + +T  KGSF V ++E     +H   
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQLSYFDTENVTASTKAKGSFAVITIEYAKDIQHGLL  66

Query  82  VGVMGGR  88
           +  +GGR
Sbjct  67  IHGVGGR  73

>PYU1_G009249
Length=2580

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 26/53 (49%), Gaps = 5/53 (9%)

Query  28    EGYVTKRGHFRKSWRVRYLVF----NGADLQaaggggaSPAT-PKGSFFVSSV  75
             EGY+ KRGH   S R RY V     N  +  A      +P+  P GSF V +V
Sbjct  1179  EGYLVKRGHLIPSMRKRYCVLLKRGNTLEYYATHEDSRNPSVAPHGSFRVDTV  1231

>PYVX_14527
Length=1269

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
            G+V K+G   ++W+ R++V +G  L        +P+   KGSF + +VE
Sbjct  903  GWVYKQGSLVRNWKKRFMVLHGRQLTYYDTARLTPSVKAKGSFTLITVE  951

>PYIW_18591
Length=1387

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 55/135 (41%), Gaps = 20/135 (15%)

Query  20   DKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHE  79
            D   AT  +G + K+G   ++W+ RY + + + ++      +S A  + SF       H 
Sbjct  281  DNKAATIKKGRMYKQGRLMRNWKSRYFILSVSKIEYFKNPSSSAARGEMSFL-----DHR  335

Query  80   YWVGVMGGREKPFGFKLVGHAP----------KKGYIELDIFVETLGDLNKWVEVVQNAL  129
              V     R  P    +V  +P          + G   L +   +  D   W++ ++ A+
Sbjct  336  CTV-----RSLPATSDVVCKSPSVLAEYLLELRVGDRRLVMACTSESDKKGWMDAIKLAI  390

Query  130  DAAKKHTRTPGAADS  144
            DA+K   RT    +S
Sbjct  391  DASKTVNRTQSPGES  405

>SPRG_02753
Length=309

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (51%), Gaps = 6/67 (9%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE-----KHEYW  81
           +G+V K+G   +SW+ RY+V     L        + +T  KGSF V ++E     +H   
Sbjct  7   QGWVFKQGSLVRSWKKRYMVLKNKQLSYFDTENVTASTKAKGSFAVITIEYAKDIQHGLL  66

Query  82  VGVMGGR  88
           +  +GGR
Sbjct  67  IHGVGGR  73

>PHYKE_5588
Length=751

 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query  19   GDKFK-ATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSP  63
            G+ F+ +  CEG++ KRG     W+ RY    G  LQ   G   SP
Sbjct  243  GETFEESVLCEGWLYKRGQRSTEWQRRYFKLKGFTLQYQDGPAESP  288

>H310_14473
Length=613

 Score = 32.7 bits (73),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 23/48 (48%), Gaps = 0/48 (0%)

Query  7   PDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
           P + +A +  + G   +     G + KRGH RK+W  R+ V     L+
Sbjct  5   PSLAVAMAVATPGKSKEDVLHSGILLKRGHLRKNWLTRFFVLTSGALR  52

>HYAP_08248
Length=784

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQ  54
            G +TKRGHF K+W  R+LV +   LQ
Sbjct  84   GALTKRGHFFKAWLPRHLVLSRGALQ  109

>CCI44571
Length=140

 Score = 31.6 bits (70),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 42/107 (39%), Gaps = 18/107 (17%)

Query  23   KATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWV  82
            KA    GY+ KRG    +W+ RY++ +   L             K S  VS +       
Sbjct  7    KAPKLSGYLRKRGEIFTTWKKRYMILDQGVLSWRHDNKPESQAIKSSAVVSVI-------  59

Query  83   GVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNK--WVEVVQN  127
               GGR   FG  +     +      D++V+   D N+  W + ++N
Sbjct  60   -TWGGRN--FGLCIRLENGR------DLYVDCGTDTNQELWYDAIEN  97

>PITG_03318
Length=1343

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 10/44 (23%)

Query  15   HGSG---GDKFKATSCE-------GYVTKRGHFRKSWRVRYLVF  48
            HGS     D F AT  +       G++TK+GH  KSW+ R+ V 
Sbjct  115  HGSDPLLNDSFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL  158

>HYAP_06101
Length=984

 Score = 32.7 bits (73),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 10/44 (23%)

Query  15   HGSG---GDKFKATSCE-------GYVTKRGHFRKSWRVRYLVF  48
            HGS     D F AT  +       G++TK+GH  KSW+ R+ V 
Sbjct  119  HGSDPMLNDAFYATQVQVGNFVKMGWLTKQGHLWKSWKTRFFVL  162

>PHYRA_73297
Length=119

 Score = 31.2 bits (69),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)

Query  25  TSCEGYVTKRGHFRKSWRVRYLVF  48
           T  +GY+ +RG   KSWR RY +F
Sbjct  3   TVVDGYLERRGRHLKSWRRRYFIF  26

>PYIR_22667
Length=749

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 48/117 (41%), Gaps = 11/117 (9%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
            EG + KRGH  K+W+ R+      +L+            KGS  + S            G
Sbjct  405  EGCLLKRGHVNKNWKNRFFRIEKGELRYYTENQEE---LKGSVPLKSTIVSPGMAQCSDG  461

Query  88   REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADS  144
            R+  + F L     + G  E+ +       ++KW+E +Q A  A     RT GA ++
Sbjct  462  RK--YYFVLTS---RDGKFEMHLNAHNESSMHKWIEAIQEAQTAL---GRTVGAKET  510

>H310_00912
Length=2182

 Score = 32.7 bits (73),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 13/111 (12%)

Query  28    EGYV-TKRGHFRKSWRVRYLVFNG---ADLQaaggggaSPATPKGSFFVSSVEKHEYWVG  83
             EG+V  +R HF  +W+  Y V  G   A          +P  P     V  V   +++ G
Sbjct  1797  EGFVHLRRSHFGAAWKEHYCVLKGPWLATYDTREDFATAPGKPTSKREVVFVG--DWYGG  1854

Query  84    V-MGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAK  133
             V  GG +  F  + +    + G++E   +V+   D  +W++ +Q A+ + K
Sbjct  1855  VSAGGAKNMFRIETI----EDGFVE--AYVDDAADKPQWMQTLQTAVSSLK  1899

>PPTG_16044
Length=1378

 Score = 32.7 bits (73),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 10/44 (23%)

Query  15   HGSG---GDKFKATSCE-------GYVTKRGHFRKSWRVRYLVF  48
            HGS     D F AT  +       G++TK+GH  KSW+ R+ V 
Sbjct  115  HGSDPLLNDSFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL  158

>HYAP_09304
Length=1144

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 64/164 (39%), Gaps = 34/164 (21%)

Query  13   TSHGSGGDKFKATSCE----GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKG  68
            T H SG D  + +  +    GY+ K+G F KSWR R+ +                  P  
Sbjct  105  TVHTSGDDVEQFSDADIITSGYLVKQGSFWKSWRRRFFILRR-------------DCPVL  151

Query  69   SFFVSS--------VEKHEYWVGVMGGRE-KPFGFKLVGHAPKKGYIELDIFVET-LGDL  118
            S++ S+        +   E+    M  R+ +P  F +     K     L +  E    D+
Sbjct  152  SYYTSAEELAKLGEITIDEHTTVQMTPRDGEPHRFTIENDKRK-----LTLIAEQGKADM  206

Query  119  NKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQ  162
            + W+  +Q  +    + T    +A+ S  +   G   +VS QLQ
Sbjct  207  DAWISCIQGCITQRARSTTRILSANGSILRR--GEGGSVSAQLQ  248

>PPTG_16047
Length=645

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (47%), Gaps = 3/75 (4%)

Query  91   PFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTP-GAADSS--TT  147
            P GF+L  H     + +L+   +TLGDLN   +  Q A+   ++   +P   AD S  T 
Sbjct  421  PNGFELPDHQDALVHSQLNQIRQTLGDLNVHDDQSQPAMPGRRRKPPSPMSMADFSAPTP  480

Query  148  KNMFGFSATVSPQLQ  162
            +     SA  SP  Q
Sbjct  481  QKRMTISAVDSPSFQ  495

>PHYSO_248481
Length=1283

 Score = 32.7 bits (73),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 10/44 (23%)

Query  15   HGSG---GDKFKATSCE-------GYVTKRGHFRKSWRVRYLVF  48
            HGS     D F AT  +       G++TK+GH  KSW+ R+ V 
Sbjct  68   HGSDPLLNDAFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL  111

>SDRG_00080
Length=298

 Score = 32.0 bits (71),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query  29   GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSV  75
            GYV K+G F K+W+ RY+V +  D         +   P+G F V+ +
Sbjct  75   GYVRKQGSFVKNWKRRYMVLHD-DTLFYYVSERATTKPRGFFRVTGI  120

>PYU1_G007013
Length=750

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 43/107 (40%), Gaps = 8/107 (7%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
            EG + KRGH  K+W+ R+      +L+            KGS  +              G
Sbjct  411  EGCLLKRGHVNKNWKNRFFRIEKGELRYYTENQEE---LKGSVKLKGTIVSPGMAQCSDG  467

Query  88   REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKK  134
            R+  + F L     K G  E+ +   T   +++W+E +Q A  A  K
Sbjct  468  RK--YYFVLTS---KDGKFEMHLNAHTETSMHRWIEAIQEAQTALGK  509

>CCI44857
Length=1070

 Score = 32.3 bits (72),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 61/143 (43%), Gaps = 23/143 (16%)

Query  79   EYWVGVMGGREKP-FGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKH--  135
            EY       R KP    K+  HA  K Y                +E ++NAL+AA++   
Sbjct  328  EYAHRARSIRNKPEVNQKMTKHALLKEY-------------GSEIESLRNALEAARQKDG  374

Query  136  TRTPGAADSSTTKNMFGFSATV---SPQLQVK-KLAATKEELLRDALREIEGAKLIGREA  191
               P A      + + G +A V     QL V+ K     E+L+ D  +++E AK   RE 
Sbjct  375  IYLPPAQYDEMQQRLAGQAAQVLELEDQLDVRSKTCKELEDLIDDQRQQLEQAKNTQREL  434

Query  192  VSDIK---GQGGKLNMIEDDLGK  211
              DI+   GQ  +L ++ D L K
Sbjct  435  EGDIEKKMGQISELELLRDALRK  457

>PHYKE_7856
Length=346

 Score = 32.0 bits (71),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 23/44 (52%), Gaps = 10/44 (23%)

Query  15  HGSG---GDKFKATSCE-------GYVTKRGHFRKSWRVRYLVF  48
           HGS     D F AT  +       G++TK+GH  KSW+ R+ V 
Sbjct  39  HGSDPLLNDGFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL  82

>PHYSO_556902
Length=454

 Score = 32.0 bits (71),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  107  ELDIFVETLGDLNKWVEVVQNALD  130
            EL+ F  ++ D+ +WV+ VQNALD
Sbjct  265  ELEAFSASVDDIARWVKAVQNALD  288

>PHYCA_98948
Length=124

 Score = 30.8 bits (68),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVF  48
           +GY+ +RG   KSWR RY +F
Sbjct  5   DGYLLRRGRHLKSWRRRYFIF  25

>H310_09363
Length=1954

 Score = 32.3 bits (72),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  3    ILRVP-DMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            + R+P D+ +  +  +     K TSC GY+ KRG    + + RY++    +L
Sbjct  821  VARIPMDVLVLDTTNTSSQNNKRTSCAGYLMKRGEVNVTMQRRYMILQDNEL  872

>PHYRA_73430
Length=395

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPAT-PKGSFFVSSVE  76
           G+V K+G   ++W+ R++V  G  L         P    KGSF V +VE
Sbjct  12  GWVFKQGSLVRNWKKRFMVLRGRQLTYYDTAKVDPTVKAKGSFQVITVE  60

>SPRG_18807
Length=776

 Score = 32.0 bits (71),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 78/189 (41%), Gaps = 15/189 (8%)

Query  12   ATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFF  71
            A+S  S  D        G++ K+G F KS + RY       L    G     A  KGS  
Sbjct  255  ASSTSSAHDNNDVLLHAGWLRKQGQFMKSVKRRYFRLTSGALTYYRGPDVVKA--KGSVG  312

Query  72   VSSVEKHEYWVGVMGGRE--KPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNAL  129
            +         V +   R+  +   F +  +   K    L +F ++  DL  WV  +  A+
Sbjct  313  IGPNTS----VALFDTRKTGERHSFCITENTSAKRSRVLTVFADSQEDLMIWVASLSAAI  368

Query  130  DAAKKHTRTPGAADSSTTKNMFGFSATV----SPQLQV-KKLAATKEELL--RDALREIE  182
            D   +H R   ++ ++   ++    A +    SP L V   ++ T  +++   +A  +++
Sbjct  369  DGHHQHKRRHSSSSNNQLHDVLDCDAIIDDHPSPTLSVGSSMSDTDSDVVVGAEAQSKVD  428

Query  183  GAKLIGREA  191
             A+ I REA
Sbjct  429  IAREIAREA  437

>H257_03521
Length=685

 Score = 32.0 bits (71),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (53%), Gaps = 12/59 (20%)

Query  24   ATSCEGYVTKRGHFRKSWRVRYL-----VFNGADLQaaggggaSPATPKGSFFVSSVEK  77
            A+ CEG++ K+G F ++W+ R+      V +  D+Q       S  T KG   V SV++
Sbjct  345  ASECEGWLYKQGSFVRNWKKRWFSLTHHVLSYRDMQ-------SSVTIKGHGCVHSVQR  396

>SDRG_03175
Length=934

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADL  53
           EGY+ KRG +   W   Y+V +G DL
Sbjct  26  EGYLRKRGDWLPRWDTYYVVLSGVDL  51

>CCI39367
Length=2046

 Score = 32.0 bits (71),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  29   GYVTKRGHFRKSWRVRYLVF  48
            G++ K+GH  KSWRVR+ V 
Sbjct  86   GWLRKQGHLWKSWRVRFFVL  105

>SDRG_02135
Length=306

 Score = 31.6 bits (70),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADL  53
           EGY+ K+GH  K+WR RY     A L
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL  27

>PHYCA_509385
Length=557

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 37/95 (39%), Gaps = 16/95 (17%)

Query  41   WRVRYLVFNGADLQaa---ggggaSPATPKGSFFVSSVEKHEYWVGVMGGREKPFGFKLV  97
            W+ RY V    +LQ               +G    SSV     W G      KP GF+  
Sbjct  42   WKKRYCVIYKGELQIVYFLSLEDFEKRAIRGKIPFSSVHA---WDG------KPNGFQF-  91

Query  98   GHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAA  132
             + P        ++ ET  D  KW+E +QN +D A
Sbjct  92   -YTPSDNCFR--VYTETAEDQAKWIETMQNCIDNA  123

>PYVX_14593
Length=964

 Score = 32.0 bits (71),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query  7    PDMKLATSHGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQ  54
            PD  LAT+   GG   K   C G++ K+G    SW+ RY    G+ L+
Sbjct  592  PD-ALATNSLDGG---KLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK  635

>SPRG_01654
Length=923

 Score = 32.0 bits (71),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADL  53
           EGY+ KRG +   W   Y+V +G DL
Sbjct  26  EGYLRKRGDWLPRWDTYYVVLSGVDL  51

>PHALS_12503
Length=340

 Score = 31.6 bits (70),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  22   FKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
             K +   G++ KRGH  K+W+ R+ + NG  L
Sbjct  94   LKGSVFYGWLWKRGHSFKTWKKRFFLLNGVAL  125

>PITG_14197
Length=349

 Score = 31.6 bits (70),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  21   KFKATSCEGYVTKRGHFRKSWRVRYLVFNGADL  53
            + K ++  G++ KRG   K+W+ R+ + NGA L
Sbjct  96   ELKGSAFYGWLWKRGQSFKTWKKRFFLLNGAAL  128

>PPTG_07800
Length=154

 Score = 30.4 bits (67),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  28  EGYVTKRGHFRKSWRVRYLVFN  49
           EGY+ +RG   KSWR R+ +F 
Sbjct  35  EGYLYRRGRHLKSWRRRFFIFE  56

>PYIW_20221
Length=584

 Score = 31.6 bits (70),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 29/117 (25%), Positives = 47/117 (40%), Gaps = 11/117 (9%)

Query  28   EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
            EG + KRGH  K+W+ R+      +L+            KGS  +              G
Sbjct  238  EGCLLKRGHVNKNWKNRFFRIEKGELRYYTENQE---VLKGSVLLKGTIVSPGMAQCSDG  294

Query  88   REKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADS  144
            R+  + F L     + G  E+ +       ++KW+E +Q A  A     RT GA ++
Sbjct  295  RK--YYFVLTS---RDGKFEMHLNAYNESSMHKWIEAIQEAQTAL---GRTVGAKET  343

>CCA25510
Length=1139

 Score = 31.6 bits (70),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 0/20 (0%)

Query  29   GYVTKRGHFRKSWRVRYLVF  48
            GY+ K+G F KSWR RY + 
Sbjct  197  GYLVKQGSFWKSWRRRYFIL  216

>SPRG_04912
Length=261

 Score = 31.2 bits (69),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query  29  GYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSV  75
           GYV K+G F K+W+ R +  +  D         + A P+G F V+SV
Sbjct  43  GYVRKQGSFVKNWKRRIMALHD-DTLFYYVSERAMAKPRGVFRVTSV  88

>PYAP_18890
Length=124

 Score = 30.0 bits (66),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 4/60 (7%)

Query  28  EGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKGSFFVSSVEKHEYWVGVMGG  87
           EGY+ KRG   KSW+ R+  F    L             +  +    VE   YW G+  G
Sbjct  5   EGYLVKRGERVKSWKRRFFTFENGVLAYKKNNKDDTRVIRREY----VENVLYWNGIAHG  60

>PITG_02106
Length=1015

 Score = 31.6 bits (70),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 51/125 (41%), Gaps = 26/125 (21%)

Query  11   LATSHGSGGDKFKATS--CEGYVTKRGHFRKSWRVRYLVFNGADLQaaggggaSPATPKG  68
            +++S    GD+  A +  C G++ K G   KSW+ RY    G+ L           + KG
Sbjct  658  ISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRLSYYK-------SEKG  710

Query  69   SFF----VSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVETLGDLNKWVEV  124
            S      V S+E H              G  +  H+ +K  ++ D   E     ++W+  
Sbjct  711  SLLRSVSVVSIEPHP---------TVSLGLVVSTHSGRKLIMQADSNEE----FDRWLSA  757

Query  125  VQNAL  129
            +Q A+
Sbjct  758  IQGAV  762

>SPRG_13968
Length=773

 Score = 31.6 bits (70),  Expect = 9.9, Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 53/127 (42%), Gaps = 25/127 (20%)

Query  119  NKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKLAATKEELLRDAL  178
            N+ VE ++  L A ++ TR  GA   +T +N F  +     Q Q K    TK+  L  + 
Sbjct  423  NQRVETLEEQLQAERR-TRVEGATLLTTERNTFCVALQ---QAQAKIETLTKDLELATS-  477

Query  179  REIEGAKLIGREAVSDIKGQG--------------------GKLNMIEDDLGKVESDLDH  218
             E+  ++L+  E  +  + Q                      K+  +EDDL K   + DH
Sbjct  478  TEVSASRLLSAETTAHARTQQLLAGLEALLAQQKDIHATHVAKIRTLEDDLTKTTENRDH  537

Query  219  GGKLLNH  225
              +L+ +
Sbjct  538  LQRLVPY  544

Lambda      K        H        a         alpha
   0.315    0.132    0.376    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 22852808520

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40