Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_19970147551301176121e-82
PYIR_13454147551291174914e-64
PYU1_G001736147551231173872e-48
PYAP_17747147551341193796e-47
PHYRA_95903147551341203641e-44
PITG_18455147551321203465e-42
PHYSO_321155147551361203467e-42
PPTG_17126147551361203422e-41
PHYKE_8392147551381223362e-40
PHYCA_11834147551341203353e-40
PHALS_06479147551361203328e-40
PYVX_18180147551351193301e-39
CCA17542147551201163143e-37
SPRG_06335147551231183101e-36
SDRG_01782147551231183056e-36
CCI44820147551231162971e-34
HYAP_07103147551641552992e-34
H257_06293147551231192804e-32
H310_09224147551231182597e-29
HYAP_084991114710856924e-04
PITG_137391114710592915e-04
HYAP_085006526017256910.001
PPTG_092521114710556890.001
PHYSO_3150171114710956890.001
H310_07567111479837880.001
PYAR_232071114711254870.003
PHYKE_58411114712154860.004
PHALS_115641114710756850.004
PYAP_228461114710456840.005
PHYCA_5353801114710856830.008
CCI442321114710588820.011
PHYRA_816751114710656800.020
H257_07358111479840800.021
PYVX_208541114710454800.023
PYU1_G0059631114710354790.024
CCA175211114710454760.067
PYIR_151861114710936710.37
H310_0607212501212152710.43
SDRG_0542012501211852700.67
CCI487201340311492681.1
SDRG_149121114710554671.2
SPRG_128831114710554671.3
PYVX_18358141636254641.7
PYVX_151505606474645691.8
SPRG_03475396739570682.4
H310_0223565269957652.4
PYIW_147431114710550652.9
CCA224011561310945653.0
H310_138701481110798673.6
CCI41296823696049655.3
CCA201021340311443635.3
PHYSO_343769297157298646.7
H257_0403012501212152627.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_19970

Length=130
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_19970                                                            240        1e-82
PYIR_13454                                                            193        4e-64
PYU1_G001736                                                          153        2e-48
PYAP_17747                                                            150        6e-47
PHYRA_95903                                                           144        1e-44
PITG_18455                                                            137        5e-42
PHYSO_321155                                                          137        7e-42
PPTG_17126                                                            136        2e-41
PHYKE_8392                                                            134        2e-40
PHYCA_11834                                                           133        3e-40
PHALS_06479                                                           132        8e-40
PYVX_18180                                                            131        1e-39
CCA17542                                                              125        3e-37
SPRG_06335                                                            124        1e-36
SDRG_01782                                                            122        6e-36
CCI44820                                                              119        1e-34
HYAP_07103                                                            119        2e-34
H257_06293                                                            112        4e-32
H310_09224                                                            104        7e-29
HYAP_08499                                                            40.0       4e-04
PITG_13739                                                            39.7       5e-04
HYAP_08500                                                            39.7       0.001
PPTG_09252                                                            38.9       0.001
PHYSO_315017                                                          38.9       0.001
H310_07567                                                            38.5       0.001
PYAR_23207                                                            38.1       0.003
PHYKE_5841                                                            37.7       0.004
PHALS_11564                                                           37.4       0.004
PYAP_22846                                                            37.0       0.005
PHYCA_535380                                                          36.6       0.008
CCI44232                                                              36.2       0.011
PHYRA_81675                                                           35.4       0.020
H257_07358                                                            35.4       0.021
PYVX_20854                                                            35.4       0.023
PYU1_G005963                                                          35.0       0.024
CCA17521                                                              33.9       0.067
PYIR_15186                                                            32.0       0.37 
H310_06072                                                            32.0       0.43 
SDRG_05420                                                            31.6       0.67 
CCI48720                                                              30.8       1.1  
SDRG_14912                                                            30.4       1.2  
SPRG_12883                                                            30.4       1.3  
PYVX_18358                                                            29.3       1.7  
PYVX_15150                                                            31.2       1.8  
SPRG_03475                                                            30.8       2.4  
H310_02235                                                            29.6       2.4  
PYIW_14743                                                            29.6       2.9  
CCA22401                                                              29.6       3.0  
H310_13870                                                            30.4       3.6  
CCI41296                                                              29.6       5.3  
CCA20102                                                              28.9       5.3  
PHYSO_343769                                                          29.3       6.7  
H257_04030                                                            28.5       7.8  

>PYIW_19970
Length=130

 Score = 240 bits (612),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/117 (100%), Positives = 117/117 (100%), Gaps = 0/117 (0%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT
Sbjct  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK
Sbjct  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PYIR_13454
Length=129

 Score = 193 bits (491),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 109/117 (93%), Gaps = 0/117 (0%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RPVYKKLL+LAKTLPEGKR+ T  QIRSEFR+RK++SDPKELNALLARAQSSI YLKIVT
Sbjct  13   RPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVT  72

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PRKSSDAGVKNYIYKNGQRVEA +V+EDGAKY +PDYN QM RHQKLLRRQHFMDRK
Sbjct  73   PRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129

>PYU1_G001736
Length=123

 Score = 153 bits (387),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 95/117 (81%), Gaps = 0/117 (0%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA+TLP  KR+TT +QIR EFR+     DPKE+ ALLARAQSSI YLKIVT
Sbjct  7    RPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGYLKIVT  66

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR +SDAGVKNY+Y  G+RVEAA   EDGA+Y+  DYN QM RH +LLRRQHFMDRK
Sbjct  67   PRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMDRK  123

>PYAP_17747
Length=134

 Score = 150 bits (379),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 96/119 (81%), Gaps = 3/119 (3%)

Query  14   RPVYKKLLQLAKTLP-EGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIV  72
            RP+YK+LL+LAK+LP E KRE T QQIRSEFRS K+  DPKE+ AL+ RAQ+ I YLKIV
Sbjct  7    RPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIGYLKIV  66

Query  73   TPRKSSDAGVKNYIYKNGQRVEAAAVM--EDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129
            TPR ++DAGVK+++Y NG+RV+++ V   E+GA+Y+  D+ G M RH +LLRRQHFMDR
Sbjct  67   TPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQHFMDR  125

>PHYRA_95903
Length=134

 Score = 144 bits (364),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 93/120 (78%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR+ +  QIR EFRS +EL+DPKE++AL+ RAQSS+ YLKIVT
Sbjct  7    RPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKIVT  66

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ G++ YIY+NGQRV A  V    E+ A+Y+  D  G + RH +LLRRQHFMDRK
Sbjct  67   PRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMDRK  126

>PITG_18455
Length=132

 Score = 137 bits (346),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 94/120 (78%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR+++  QIR +FRS  + +DPKE++AL+ RAQSS+SYLKIVT
Sbjct  5    RPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYLKIVT  64

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ GV+ YIY+NGQRV AA   E G   A++++ D  G + RH +LL+RQ+FM+RK
Sbjct  65   PRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYFMNRK  124

>PHYSO_321155
Length=136

 Score = 137 bits (346),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 92/120 (77%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KRE +  QIR EFRS  +L+DP+ ++AL+ RAQSS+SYLKIVT
Sbjct  9    RPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSLSYLKIVT  68

Query  74   PRKSSDAGVKNYIYKNGQRVEAA---AVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ GV+ +IY+NGQRV AA   A  E+ A+Y+  D    + RH +LLRRQ+FMDRK
Sbjct  69   PRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRRQYFMDRK  128

>PPTG_17126
Length=136

 Score = 136 bits (342),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 93/120 (78%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR+++  QIR +FR+  +L+DP+E++AL+ RAQSS+SYLKIVT
Sbjct  9    RPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSLSYLKIVT  68

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ GV+ YIY+NGQRV A    E G   A+++  D  G + RH +LLRRQ+F+DRK
Sbjct  69   PRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRRQYFLDRK  128

>PHYKE_8392
Length=138

 Score = 134 bits (336),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 5/122 (4%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL++A+ LPE KR  +  QIR EFR+  +LSDPKE++ LL  AQSS+SYLKIVT
Sbjct  9    RPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSLSYLKIVT  68

Query  74   PR--KSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMD  128
            PR    S++GV+ YIY+NGQRV AA + E G   A+Y+  D    + RH +L+RRQHFMD
Sbjct  69   PRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLMRRQHFMD  128

Query  129  RK  130
            RK
Sbjct  129  RK  130

>PHYCA_11834
Length=134

 Score = 133 bits (335),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 92/120 (77%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR+T+  QIR EFRS ++L+DPKE++ LL RAQSS+ YLKIVT
Sbjct  7    RPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKIVT  66

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVM---EDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ GV+ +IY++G+RV A  +    E+ A+++  D    + RH +LLRRQ+FMDRK
Sbjct  67   PRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMDRK  126

>PHALS_06479
Length=136

 Score = 132 bits (332),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 89/120 (74%), Gaps = 3/120 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA+ LP+ KR+++  QIR EFR  ++L+DPKE++  + RAQSS+SYLKI+T
Sbjct  9    RPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSLSYLKIIT  68

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDG---AKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            PR  S+ GV+ +IY+NGQRV AA   + G   A+++  D      RH +LLRRQ+FMDRK
Sbjct  69   PRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRRQYFMDRK  128

>PYVX_18180
Length=135

 Score = 131 bits (330),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 3/119 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR +T  QIR+EFRS  E++D  E+  LL RAQS + YLKIVT
Sbjct  8    RPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLGYLKIVT  67

Query  74   PRKSSDAGVKNYIYKNGQRV---EAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129
            PR  S +GVK YIY+NGQRV    A A  EDGA+Y+ PD  G + RH +LLRRQHFMDR
Sbjct  68   PRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQHFMDR  126

>CCA17542
Length=120

 Score = 125 bits (314),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 85/116 (73%), Gaps = 0/116 (0%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R +YK+L++LAK+LP  K+  T   IR+EFR  +++SDP +L+ LL RAQS+I YLKIVT
Sbjct  5    RSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYLKIVT  64

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129
            P K SD+GVK +++K+G+R+E      + A++++ D    + RH +LLRRQHFMDR
Sbjct  65   PHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>SPRG_06335
Length=123

 Score = 124 bits (310),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 1/118 (1%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R  YKKLL+LAK++P+ +R  T +++R+EFR+    + P+EL+ LL +AQS ISYLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIVT  65

Query  74   PRKSSDAGVKN-YIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            P+KS   G  N ++YKNGQR++   +  D A  +  DYN  M +H +L+RRQHFMDRK
Sbjct  66   PKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123

>SDRG_01782
Length=123

 Score = 122 bits (305),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 85/118 (72%), Gaps = 1/118 (1%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R  YKKLL+LAK++P+ +R  T +++R EFR+ +  + P+EL+ LL +AQS ISYLKIVT
Sbjct  6    RAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIVT  65

Query  74   PRKSSDAGV-KNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            P+KSS +    +++YKNGQR++   +  D A  +  DYN  M +H +L+RRQHFMDRK
Sbjct  66   PKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123

>CCI44820
Length=123

 Score = 119 bits (297),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 85/116 (73%), Gaps = 0/116 (0%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R ++KK+++LAK+LP  K+  T   IR+EFR  +++ DP +L  LL RAQS+I YLKIVT
Sbjct  8    RRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIGYLKIVT  67

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDR  129
            P K SD+GVK+++YK+G+R+E +    + AK+++ D    + RH +L+RRQ+FMDR
Sbjct  68   PHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFMDR  123

>HYAP_07103
Length=164

 Score = 119 bits (299),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 92/155 (59%), Gaps = 38/155 (25%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            RP+YKKLL+LA++LPE KR+ +  QIR EFR   +L+DPKE+++LL RAQSSI +LKIVT
Sbjct  2    RPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIVT  61

Query  74   PRKS-----------------------------------SDAGVKNYIYKNGQRVEAAAV  98
            PR                                     SD G++ ++Y++G+R++AA +
Sbjct  62   PRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAEL  121

Query  99   M---EDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
                E+ A+Y+  D    M RH +LLRRQHFMDRK
Sbjct  122  KKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156

>H257_06293
Length=123

 Score = 112 bits (280),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 85/119 (71%), Gaps = 3/119 (3%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R  YKKL++LA++LP  ++ T   +IR +FRSR  +S  +EL+ L+ +AQS ISYLKIVT
Sbjct  6    RTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIVT  65

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQL--PDYNGQMLRHQKLLRRQHFMDRK  130
            P+++  +G + +IYK+G+R+++ + ++DG    +   D N  M RH KL+RRQHFMDRK
Sbjct  66   PKRTPQSGPQRFIYKDGKRLDSQS-LDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123

>H310_09224
Length=123

 Score = 104 bits (259),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 78/118 (66%), Gaps = 1/118 (1%)

Query  14   RPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVT  73
            R  YKKL++LA++LP  ++     ++R EFRS   ++   +L+ ++ +AQS ISYLKIVT
Sbjct  6    RTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIVT  65

Query  74   PRKSSDAGVKNYIYKNGQRVEAAAVMED-GAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130
            P+++     + YIYK+G+R++   + +   A  +  D+N  M RH KL+RRQHFMDRK
Sbjct  66   PKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123

>HYAP_08499
Length=108

 Score = 40.0 bits (92),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+++L+LA+  P  KR++    I+SEFR+ + LSD +++   LA  Q+ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>PITG_13739
Length=105

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query  16   VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVTPR  75
            +Y+++L+LA+  P  KRE+  + I++EF + K+L+D +++   LA  ++ I+ L +    
Sbjct  10   MYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSMYA--  67

Query  76   KSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQL  107
             S    + N+  + G+       M  G K ++
Sbjct  68   -SLHPSLPNWSVEVGRDAIHPPPMHGGVKTKV  98

>HYAP_08500
Length=172

 Score = 39.7 bits (91),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  16   VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
            +Y+++L+LA+  P  KR++    I+SEFR+ + LSD +++   LA  Q+ I  L +
Sbjct  74   MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PPTG_09252
Length=105

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 37/56 (66%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+++L+LA+  P  KRE+  + I++EF + K L+D +++   LA  ++ I+ L +
Sbjct  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65

>PHYSO_315017
Length=109

 Score = 38.9 bits (89),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 37/56 (66%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+++L+LA+  P  KRE+  + I++EF + K+L+D +++   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELSM  65

>H310_07567
Length=98

 Score = 38.5 bits (88),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDP  52
           +Y+++LQLAK  P  KR+   + I++EF   K L+DP
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDP  46

>PYAR_23207
Length=112

 Score = 38.1 bits (87),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++LQLAK  P  KR+   + I+ EF   K L+D   +   +A AQ+ I  L
Sbjct  13  LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PHYKE_5841
Length=121

 Score = 37.7 bits (86),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 36/54 (67%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA+  P  KR++  + I++EF + K L+D +++   LA A++ I  L
Sbjct  10  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGIKEL  63

>PHALS_11564
Length=107

 Score = 37.4 bits (85),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           VY++LL+LA+  P  KRE   + I+ EF +   ++D +++   +A A + I  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PYAP_22846
Length=104

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+ +L+LAK  P  KR+   Q I+ EF   K  +D + +   +A AQ+ I  L +
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSM  65

>PHYCA_535380
Length=108

 Score = 36.6 bits (83),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+++L+LA   P  KRE+  + I++EF + K L+D + +   LA  ++ I  L +
Sbjct  10  MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKELSM  65

>CCI44232
Length=105

 Score = 36.2 bits (82),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (49%), Gaps = 17/88 (19%)

Query  16   VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVTPR  75
            +Y+++L+LA+  P  KR+   + IR EFR  + ++ P  +   +A               
Sbjct  9    LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIA---------------  53

Query  76   KSSDAGVKN-YIYKNGQRVEAAAVMEDG  102
             S++AG+K   +Y N   VEA   +E G
Sbjct  54   -SANAGIKELMMYANLNPVEANWTVEIG  80

>PHYRA_81675
Length=106

 Score = 35.4 bits (80),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 35/56 (63%), Gaps = 0/56 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+++L+LA+  P  KR +  + I++EF + K L+D +++   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELSM  65

>H257_07358
Length=98

 Score = 35.4 bits (80),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 15/40 (38%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKEL  55
           +Y+++LQLA   P  K++   Q I+ EF   K L+DP ++
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKI  49

>PYVX_20854
Length=104

 Score = 35.4 bits (80),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA+  P  KR++  + I++EF   K LSD +++   +  A++ I  L
Sbjct  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PYU1_G005963
Length=103

 Score = 35.0 bits (79),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA   P  KR    + I+ EFR  K L+D   ++A +  A+  I  L
Sbjct  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGIVEL  63

>CCA17521
Length=104

 Score = 33.9 bits (76),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 16/54 (30%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA+  P  KR+     IR EFR  ++++    ++  +A A + I  L
Sbjct  9   LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIASANAGIKEL  62

>PYIR_15186
Length=109

 Score = 32.0 bits (71),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 23/36 (64%), Gaps = 0/36 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSD  51
           VY+++L+LA   P  KR    ++I+ EF + K L+D
Sbjct  10  VYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTD  45

>H310_06072
Length=121

 Score = 32.0 bits (71),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  16  VYKKLLQLAKTLPEG-KRETTRQQIRSEFRSRKELSDPKELNALLARAQSSI  66
           VYK  L  A   P+   RET R  +R +FR +  + D + LN LL  A+  +
Sbjct  11  VYKACLVSAAKCPQHIHRETMRAYVRLKFREKMHVRDTQALNILLQDAKEEL  62

>SDRG_05420
Length=118

 Score = 31.6 bits (70),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 27/52 (52%), Gaps = 1/52 (2%)

Query  16  VYKKLLQLAKTLPE-GKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSI  66
           VY+  LQ A   PE   R T R  ++ +FR +  + D K +  LLA A+  +
Sbjct  11  VYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLADAKEEL  62

>CCI48720
Length=114

 Score = 30.8 bits (68),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 20/92 (22%), Positives = 39/92 (42%), Gaps = 2/92 (2%)

Query  17   YKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKIVTPRK  76
            Y++  ++   LP   R   R+QIR EF + + + + +++  LL   +  + Y+  +    
Sbjct  21   YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQLKYVSSLVDTA  80

Query  77   SSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLP  108
             S    K  + +N +      V  D  K   P
Sbjct  81   VSKQHQKRKVNRNPEHTNGQGV--DAVKMSWP  110

>SDRG_14912
Length=105

 Score = 30.4 bits (67),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA+  P  K++     I++EF     L+D  ++   +A A   I  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>SPRG_12883
Length=105

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYL  69
           +Y+++L+LA+  P  K++     I++EF     L+D  ++   +A A   I  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>PYVX_18358
Length=62

 Score = 29.3 bits (64),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (56%), Gaps = 2/54 (4%)

Query  16  VYKKLLQLAKTLP--EGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSIS  67
           +Y+  L+LAK +     K E  R+ +R EF   +  +DP+++ AL A A   +S
Sbjct  1   LYRDCLRLAKHIGGKSKKGEAIRELVRREFEKGRAETDPEKIEALKANAIRGLS  54

>PYVX_15150
Length=746

 Score = 31.2 bits (69),  Expect = 1.8, Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 25/45 (56%), Gaps = 2/45 (4%)

Query  43   FRSRKELSDPKELNALLA--RAQSSISYLKIVTPRKSSDAGVKNY  85
            FRS  + S+   +  +L   R+  S+ YL +V PR+  DA ++ +
Sbjct  614  FRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQHDASLERF  658

>SPRG_03475
Length=395

 Score = 30.8 bits (68),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 43/70 (61%), Gaps = 7/70 (10%)

Query  52   PKELNALLARAQSSISYLKIVTPRKSSDAGVKN---YIYKNGQR--VE-AAAVMEDGAKY  105
            P E++ + ARA ++ +++++++ R  +   + N   Y++   +R  +E A A+++ GA  
Sbjct  207  PLEVHIVTARADTT-TFVRLISFRGMNLNTLVNGTTYLHMAMERGYIEMACALVKAGASV  265

Query  106  QLPDYNGQML  115
             LPD+NG M+
Sbjct  266  NLPDHNGVMV  275

>H310_02235
Length=99

 Score = 29.6 bits (65),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (58%), Gaps = 1/57 (2%)

Query  16  VYKKLLQLAKTLPEGKR-ETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71
           +Y+K+ + A  +P   R E  R+++RSE+   +  +DP+ +  L+  A + +  L+I
Sbjct  26  LYRKIYRTAGRMPTKDRTEFVRRRLRSEYDKYRHETDPERIEFLIKVADTQLDTLEI  82

>PYIW_14743
Length=105

 Score = 29.6 bits (65),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query  16  VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSS  65
           +Y+++L+LA   P  KR    ++I+ EF   K L+D  +   +L + QS+
Sbjct  10  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAK---ILDKVQSA  56

>CCA22401
Length=109

 Score = 29.6 bits (65),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  16  VYKKLLQLAKTLPEGK-RETTRQQIRSEFRSRKELSDPKELNALL  59
           +Y+  L+ A+  PE + RE  +  I+ +FR ++ L DP+ +  LL
Sbjct  8   LYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAIKLLL  52

>H310_13870
Length=1107

 Score = 30.4 bits (67),  Expect = 3.6, Method: Composition-based stats.
 Identities = 25/98 (26%), Positives = 45/98 (46%), Gaps = 10/98 (10%)

Query  15   PVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNA-----LLARAQSSISYL  69
            P   +  Q+A TLP  +     QQ+R  FR+R ++S    + +     +L R  S ++ +
Sbjct  634  PHTPRTFQMALTLPATQTTVMCQQVRLVFRNRHDVSWTWTVTSFVPQTILTRRNSLLAEM  693

Query  70   KIVTPRKSSDAGVKNYIYK-----NGQRVEAAAVMEDG  102
            + V P     AG  ++  K     + + V  A + +DG
Sbjct  694  QGVIPGMGQGAGSPSFQRKPTTSLDFEDVTGAGLEDDG  731

>CCI41296
Length=960

 Score = 29.6 bits (65),  Expect = 5.3, Method: Composition-based stats.
 Identities = 16/49 (33%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query  15   PVYKKLLQLAKTLPEGKRET-------TRQQIRSEFRSRKELSDPKELN  56
            P  K+ +Q+  +LP+GKR T        R +IR+ F +   L  P +L+
Sbjct  414  PTLKEFVQVIASLPDGKRTTLRYFMIRDRHRIRTAFITMSRLWFPVQLS  462

>CCA20102
Length=114

 Score = 28.9 bits (63),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 12/43 (28%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  17  YKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALL  59
           ++   ++   LP   R   R+QIR+EF   + + D +++ +LL
Sbjct  21  FRDFQRVTAALPTSTRSDIRRQIRTEFEKCRFVEDDEQVQSLL  63

>PHYSO_343769
Length=572

 Score = 29.3 bits (64),  Expect = 6.7, Method: Composition-based stats.
 Identities = 27/98 (28%), Positives = 47/98 (48%), Gaps = 9/98 (9%)

Query  16   VYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI----  71
            +Y++   L +TLP  +   +RQ + +  RSR+ LS        +    + + +L +    
Sbjct  1    MYQRSDPLNETLPLTRGLRSRQTLPAAGRSRRLLSSTGR--RFIRYGVACLLFLAVGDLM  58

Query  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPD  109
            VT ++S     +N I + G+R     VMED A  + PD
Sbjct  59   VTLQRSLQT--ENLI-RTGERTPEPTVMEDSADAETPD  93

>H257_04030
Length=121

 Score = 28.5 bits (62),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 25/52 (48%), Gaps = 1/52 (2%)

Query  16  VYKKLLQLAKTLPEG-KRETTRQQIRSEFRSRKELSDPKELNALLARAQSSI  66
           VYK  L  A   P+   RET R   R +FR +  L D + +   LA A+  +
Sbjct  11  VYKACLVSASKCPQHVHRETMRAYARLKFRDKMHLRDVQAVKLCLADAKEEL  62

Lambda      K        H        a         alpha
   0.316    0.131    0.356    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3336362976

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40