Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_199691475873373331480.0
PYIR_134181475874770727370.0
PYU1_G0017331475873268424350.0
PYAP_177631475879453116270.0
PHYCA_5114151475874469915760.0
PHYKE_839514758142069615710.0
PPTG_171291475874552915530.0
PHYSO_3489031475876672715500.0
PHYRA_810981475874169315460.0
PITG_184581475874769915350.0
PYAR_135711475866649414830.0
HYAP_071041475872160614470.0
PHALS_064761475872669713652e-178
PYVX_235901475868967212863e-167
CCI441111475857652810032e-126
CCA22843147585865299963e-125
SPRG_06355147587135696678e-76
SDRG_01763147587365796452e-72
PITG_172501382110464642213e-17
PHYSO_4705331382110844172213e-17
PPTG_113651382111064152187e-17
H257_117731382110264232151e-16
SDRG_045751382110034282115e-16
SPRG_126211382110033642098e-16
H257_0193413355510223802071e-15
H310_082921382110074342034e-15
SDRG_079831335559913801856e-13
PYIR_141071382111764211831e-12
PYAP_222301382111164441793e-12
PYU1_G002110138219993951775e-12
SPRG_1903013355510003811704e-11
PYVX_215131382114462001614e-10
PYIW_157171382111214441605e-10
PYAR_14788138217953791481e-08
PHYCA_52605612293805263910.072
PYIR_18103970542107840.50
H257_025621348798975830.63
PYVX_14828970565107811.0
PYAR_23233970542107801.4
PYU1_G001876970539105801.5
H257_02565139367100575792.0
H310_022081393671000139792.1
PPTG_131031652734390772.8
PITG_211731652734390772.9
H310_022101348799975782.9
PITG_117239621551586773.5
PYAP_20633970539105773.6
PHALS_1032738268939703.7
PPTG_10263970541105764.1
PHYKE_34037550773661764.2
H310_1251613403531668754.4
PHYRA_722211652736290755.2
PHALS_040071652734590745.5
PHYSO_321022970540105755.7
PHYCA_572705970543105756.3
PYAP_1618398669893123756.9
PITG_01099970541105747.4
SDRG_036191348798551748.0
H310_125141328459768748.0
PHALS_07874970541105748.2
PHYKE_4131970543105739.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_19969

Length=733
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_19969                                                            1217       0.0   
PYIR_13418                                                            1058       0.0   
PYU1_G001733                                                          942        0.0   
PYAP_17763                                                            631        0.0   
PHYCA_511415                                                          611        0.0   
PHYKE_8395                                                            609        0.0   
PPTG_17129                                                            602        0.0   
PHYSO_348903                                                          601        0.0   
PHYRA_81098                                                           600        0.0   
PITG_18458                                                            595        0.0   
PYAR_13571                                                            575        0.0   
HYAP_07104                                                            561        0.0   
PHALS_06476                                                           530        2e-178
PYVX_23590                                                            499        3e-167
CCI44111                                                              390        2e-126
CCA22843                                                              388        3e-125
SPRG_06355                                                            261        8e-76 
SDRG_01763                                                            253        2e-72 
PITG_17250                                                            89.7       3e-17 
PHYSO_470533                                                          89.7       3e-17 
PPTG_11365                                                            88.6       7e-17 
H257_11773                                                            87.4       1e-16 
SDRG_04575                                                            85.9       5e-16 
SPRG_12621                                                            85.1       8e-16 
H257_01934                                                            84.3       1e-15 
H310_08292                                                            82.8       4e-15 
SDRG_07983                                                            75.9       6e-13 
PYIR_14107                                                            75.1       1e-12 
PYAP_22230                                                            73.6       3e-12 
PYU1_G002110                                                          72.8       5e-12 
SPRG_19030                                                            70.1       4e-11 
PYVX_21513                                                            66.6       4e-10 
PYIW_15717                                                            66.2       5e-10 
PYAR_14788                                                            61.6       1e-08 
PHYCA_526056                                                          39.7       0.072 
PYIR_18103                                                            37.0       0.50  
H257_02562                                                            36.6       0.63  
PYVX_14828                                                            35.8       1.0   
PYAR_23233                                                            35.4       1.4   
PYU1_G001876                                                          35.4       1.5   
H257_02565                                                            35.0       2.0   
H310_02208                                                            35.0       2.1   
PPTG_13103                                                            34.3       2.8   
PITG_21173                                                            34.3       2.9   
H310_02210                                                            34.7       2.9   
PITG_11723                                                            34.3       3.5   
PYAP_20633                                                            34.3       3.6   
PHALS_10327                                                           31.6       3.7   
PPTG_10263                                                            33.9       4.1   
PHYKE_3403                                                            33.9       4.2   
H310_12516                                                            33.5       4.4   
PHYRA_72221                                                           33.5       5.2   
PHALS_04007                                                           33.1       5.5   
PHYSO_321022                                                          33.5       5.7   
PHYCA_572705                                                          33.5       6.3   
PYAP_16183                                                            33.5       6.9   
PITG_01099                                                            33.1       7.4   
SDRG_03619                                                            33.1       8.0   
H310_12514                                                            33.1       8.0   
PHALS_07874                                                           33.1       8.2   
PHYKE_4131                                                            32.7       9.5   

>PYIW_19969
Length=733

 Score = 1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 733/733 (100%), Positives = 733/733 (100%), Gaps = 0/733 (0%)

Query  1    MHklksklssskskQRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRnttmntssa  60
            MHKLKSKLSSSKSKQRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSA
Sbjct  1    MHKLKSKLSSSKSKQRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSA  60

Query  61   sstssymsDDVEDMFYNGGDArstsssvrstDtygrstaastrstdtysratGGSLRVTD  120
            SSTSSYMSDDVEDMFYNGGDARSTSSSVRSTDTYGRSTAASTRSTDTYSRATGGSLRVTD
Sbjct  61   SSTSSYMSDDVEDMFYNGGDARSTSSSVRSTDTYGRSTAASTRSTDTYSRATGGSLRVTD  120

Query  121  VYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTngnysngnsgggsQLDALRTELS  180
            VYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTNGNYSNGNSGGGSQLDALRTELS
Sbjct  121  VYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTNGNYSNGNSGGGSQLDALRTELS  180

Query  181  EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTA  240
            EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTA
Sbjct  181  EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTA  240

Query  241  LFTSKATKDRRATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSD  300
            LFTSKATKDRRATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSD
Sbjct  241  LFTSKATKDRRATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSD  300

Query  301  ELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHD  360
            ELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHD
Sbjct  301  ELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHD  360

Query  361  NIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARK  420
            NIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARK
Sbjct  361  NIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARK  420

Query  421  LLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPSPE  480
            LLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPSPE
Sbjct  421  LLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPSPE  480

Query  481  LPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDF  540
            LPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDF
Sbjct  481  LPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDF  540

Query  541  TKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIV  600
            TKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIV
Sbjct  541  TKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIV  600

Query  601  TAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQR  660
            TAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQR
Sbjct  601  TAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQR  660

Query  661  AGEQFYVDVSGGMSALRQLHHQdssethsvgssdgsssnatsnvstasshLSYvvpppvp  720
            AGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDGSSSNATSNVSTASSHLSYVVPPPVP
Sbjct  661  AGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDGSSSNATSNVSTASSHLSYVVPPPVP  720

Query  721  kvnfkpvGILKKK  733
            KVNFKPVGILKKK
Sbjct  721  KVNFKPVGILKKK  733

>PYIR_13418
Length=747

 Score = 1058 bits (2737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/707 (81%), Positives = 629/707 (89%), Gaps = 36/707 (5%)

Query  1    MHklksklssskskQRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRnttmntssa  60
            MHKLKSKLSSSKSKQ+RLERAQSD+V   A DE++LRMSKHVQEEAHRFQRNTTMNTS+A
Sbjct  1    MHKLKSKLSSSKSKQKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRNTTMNTSAA  60

Query  61   sstssymsDDVEDMFYNG---GDArstsssvrstD----tygrstaastrstdtysratG  113
            SSTSSYMSDDVE+MFYNG   G+A  ++S+  + +    T     +  T S    SRATG
Sbjct  61   SSTSSYMSDDVEEMFYNGSANGNANPSASARSTDNFGRSTTSSMRSTDTYSNGNASRATG  120

Query  114  GSLRVTDVYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTngnysngnsgggsQLD  173
            GSLRVTD+YRTTEQ+RGT NL+PLQEDEVLPAASR TTT  M T        S GG+ +D
Sbjct  121  GSLRVTDMYRTTEQMRGT-NLMPLQEDEVLPAASRATTT--MAT-------ASNGGNPID  170

Query  174  ALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG-------  226
            ALR ELSEMKLEVQAIRREMMNEMHVTRYDVLKE+TMLKGTI+QLVTALE+KG       
Sbjct  171  ALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDAS  230

Query  227  -----------LSTDEINTISRTTALFTSKATKDRRATRDESSSPMLVRASSRLTQLAPV  275
                       LS+DE++TISRTTAL+TSKATK+RRATR E S+P+LVRASSRLTQLAPV
Sbjct  231  GAAVGAEAQPELSSDELDTISRTTALYTSKATKERRATR-EDSAPVLVRASSRLTQLAPV  289

Query  276  ADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDN  335
            AD+ALSTPLLQHQIDEMFPL+ECS EL A ++ YD SSREWA+ERFQEW+DSRFNVGVDN
Sbjct  290  ADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDN  349

Query  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPL  395
            LLALVG+GGSGKSTL GAL DKFHDN+VA+HLC FDRKSKSSPRNVLLSLVNQ+ISNLPL
Sbjct  350  LLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPL  409

Query  396  FKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLL  455
            FKNQLARLNLKYVLEE+DP+VLARK+LVDPLCALEEP+TAKVF+ DG+DQCKS+GRNDLL
Sbjct  410  FKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLL  469

Query  456  DFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSF  515
            DFLAVIIPELPTW+GVFITSKPSPELPA+LAI+SLLDFSAKNTNYMNDT+I+INDIIG+F
Sbjct  470  DFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNF  529

Query  516  SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyee  575
            SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEE
Sbjct  530  SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEE  589

Query  576  iFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVD  635
            IFEDKFGKGR+RIWKKVQPLLELIVTAASGPYALITE QAQEQF+LSKEDIRTIRR+FVD
Sbjct  590  IFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVD  649

Query  636  IIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHHQ  682
            II V HGTYRIE SALFEWLVDPQRAGEQFYVDVSGGM+ LRQLHHQ
Sbjct  650  IIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQ  696

>PYU1_G001733
Length=732

 Score = 942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/684 (72%), Positives = 575/684 (84%), Gaps = 37/684 (5%)

Query  15   QRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDM  74
            ++R+ERAQSD VRATA DED+LRMSKHV E+AHR+ RNTTMNTS+ASSTSSYMSDDVEDM
Sbjct  16   RKRVERAQSDGVRATA-DEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVEDM  74

Query  75   FYNGGDArstsssvrstDtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGTANL  134
            FYNGG   + S+S  +T     S   +     +       SLRVTDVYRTTEQLR T NL
Sbjct  75   FYNGGGGITRSTSDYTTGRTTSSMRDANGMNRST------SLRVTDVYRTTEQLRNT-NL  127

Query  135  IPLQEDEVLPAASRTTTTSQMPTngnysngnsgggsQLDALRTELSEMKLEVQAIRREMM  194
            +PL EDEVLPAA RTTT +              GGS+ DALR EL EMK E+Q IRREMM
Sbjct  128  MPLNEDEVLPAAMRTTTGA-------------AGGSEADALRAELVEMKQEMQTIRREMM  174

Query  195  NEMHVTRYDVLKEVTMLKGTILQLVTALETKG---------------LSTDEINTISRTT  239
            NEMHVTRYDVLKE+TMLKGTI+QLV ALE+KG               LS  +++TI+RTT
Sbjct  175  NEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTITRTT  234

Query  240  ALFTSKATKDRRATRDESSSPMLVRAS-SRLTQLAPVADEALSTPLLQHQIDEMFPLIEC  298
            A+ TSKATKDR A R+ ++ P ++R + SRLTQLAPVAD+ALSTPLLQHQID+MFPL++ 
Sbjct  235  AVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPLVDF  294

Query  299  SDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKF  358
            S +L   ++ +D +SREWA ERFQ+W+DSRFNVG DNLLALVG+GGSGKSTL GAL D+F
Sbjct  295  SADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALCDRF  354

Query  359  HDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLA  418
            HDNIVA+HLC FDRKSKSSPRNVLLSLVNQ+I+NLPLFKNQLARLNLKYVLEE+DP+VLA
Sbjct  355  HDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPLVLA  414

Query  419  RKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPS  478
            RK+LVDPLCALEEP+TAKV ++DG+DQCKS+ RNDLLDFLA IIPE PTW+G+FITSKPS
Sbjct  415  RKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIFITSKPS  474

Query  479  PELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFL  538
            PELPA+LAI+SLLDFS KN NYMNDT+I+INDIIG+FSDKDV +AR+ILKRKSGGNFTFL
Sbjct  475  PELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGNFTFL  534

Query  539  DFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLEL  598
            DFTKQALSHPGMEE+NGY+PLDVLHDLPESIYEIY+EIFEDKFGKG NR+WKKVQPLL+L
Sbjct  535  DFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQPLLDL  594

Query  599  IVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDP  658
            IVTAASGPYALITE QAQEQF+LS++DIR IRR+F DIIDVRHGTYR+E SA++EWLVDP
Sbjct  595  IVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEWLVDP  654

Query  659  QRAGEQFYVDVSGGMSALRQLHHQ  682
            QR+GEQFYV++S  M  LR+LH +
Sbjct  655  QRSGEQFYVNISASMDILRRLHRK  678

>PYAP_17763
Length=794

 Score = 631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/531 (58%), Positives = 398/531 (75%), Gaps = 24/531 (5%)

Query  173  DALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG------  226
            D LR EL EMK E+QAI+REMMNEMH+TRYDVLKEVTMLKGTI+QLV+ ++  G      
Sbjct  181  DLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDT  240

Query  227  ----------------LSTDEINTISRTTALFTSKATKDR-RATRDESSSPMLVRASSRL  269
                            LS +E   +SR T    SK TK+R   TR++   P+L   SSRL
Sbjct  241  ATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRL  300

Query  270  TQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRF  329
            TQLAPV D ALSTPL Q QID+MFPLI+ S E+   SR  ++ SREW  +R QEW+DSRF
Sbjct  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360

Query  330  NVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQM  389
            NVG D +LA+VG+ GSGK+  A ++ DK+ D +VA H C FDRK+KSSPRNVLLSLVNQ+
Sbjct  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420

Query  390  ISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSR  449
             S+LP+FK+QLARLNLKYVLEE+D   L+RK+L+DPL ALEEP+T K  + D +DQC++ 
Sbjct  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480

Query  450  -GRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMI  508
             G NDL DFL+ IIPE P W+G  ++SKPSPE    + +SS+LDFSA+N NYMNDTV +I
Sbjct  481  VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLI  540

Query  509  NDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPES  568
            NDI   F D D  +A++ILK KSGGN+++L+FTKQALS+PGMEE +G++P+DVLHDLP+S
Sbjct  541  NDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQS  600

Query  569  iyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRT  628
            +YEIYEEIFEDKFGKGR R+W+K  P+L+LI TAASGPYA ITE    +  + +K+++R 
Sbjct  601  LYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRM  660

Query  629  IRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
            +RR+F+DII +RHGTY I +SA+++WL D QR GEQ+++DV+  +  LR++
Sbjct  661  LRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711

>PHYCA_511415
Length=744

 Score = 611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/699 (49%), Positives = 454/699 (65%), Gaps = 84/699 (12%)

Query  28   ATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFYNGGDArstsss  87
            A A DEDSLR+ K  Q++A RF R+TT+  +   +      DDVE+MFY     RST++S
Sbjct  19   AWALDEDSLRL-KQQQDDAVRFDRSTTLADTVNVT------DDVEEMFYGRNTNRSTTAS  71

Query  88   vrstDtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGTA-NLIPLQEDEVLPAA  146
                                              YRTTEQ+RG    L  L E+ V P+A
Sbjct  72   EMPQ------------------------------YRTTEQIRGNNLTLSALHEEAVTPSA  101

Query  147  ----------SRTTTTSQMPTn-----------------gnysngnsgggsQLDALRTEL  179
                      S TT ++   +                     ++       +L+ LR+E+
Sbjct  102  SNVSSSFSQFSATTPSNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELERLRSEV  161

Query  180  SEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG------------L  227
             E+K EV+AIRRE+MNE+HVTRYDVLKE+T+LKG I QL  A  +              L
Sbjct  162  LEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPL  221

Query  228  STDEINTISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQLAPVADEALSTPL  284
            S +E   ++R T+  TS AT+DR A        + P   RAS RLTQLAPVAD ALSTPL
Sbjct  222  SAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLAPVADNALSTPL  281

Query  285  LQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGG  344
               QI+EMFPLI+ + +L A +R     SR WA+ R +EW+D+RFNVG D LLA+VGEGG
Sbjct  282  SSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGG  341

Query  345  SGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN  404
            +GKS   G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ NLPLFKNQLARLN
Sbjct  342  TGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLN  401

Query  405  LKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVII  462
            LKYVLEE+DP++LA K+LVDPL A+EEP+ A   ++DG+DQC +   GRN+LL F A +I
Sbjct  402  LKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVI  461

Query  463  PELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQ  522
            P+LP+WIG  ++SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI  +FSD D  +
Sbjct  462  PQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAE  521

Query  523  AREILKRKSGGNFTFLDFTKQALSHPGMEEDN--GYIPLDVLHDLPESiyeiyeeiFEDK  580
            A+++LK KSGGNF +L+FTKQALSHPGM   +  G +PL VLH+LPE++Y+IY EIFEDK
Sbjct  522  AKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDK  581

Query  581  FGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVR  640
            FG+GR R+W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R +RRSFVD++ V+
Sbjct  582  FGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVK  641

Query  641  HGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
            HG+YRIE+SAL  WL DP R+ EQFY  +   + ALR++
Sbjct  642  HGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKM  680

>PHYKE_8395
Length=1420

 Score = 609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/696 (48%), Positives = 453/696 (65%), Gaps = 80/696 (11%)

Query  28    ATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFYNGGDArstsss  87
             A A DEDSLR++K  Q++A RF RNT M  +   S      DDVEDMFY  G + + S  
Sbjct  689   AWALDEDSLRLNKQ-QQDADRFDRNTAMTDTVNVS------DDVEDMFY--GRSTTQSQL  739

Query  88    vrstDtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGT-ANLIPLQEDEVL-PA  145
               ++D                             YRTTEQ+RGT + L  L E+E + P+
Sbjct  740   SNTSDVPS--------------------------YRTTEQMRGTNSTLTALHEEEAMTPS  773

Query  146   ASRTTT-----------------------TSQMPTngnysngnsgggsQLDALRTELSEM  182
             AS  +                        T+         + ++   +++  LR EL E+
Sbjct  774   ASHLSNSFASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRAELQEV  833

Query  183   KLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLS------------TD  230
             K EVQ IRRE+MNE+H+TRYDVLKE+T+LKG + QL +A +T G               +
Sbjct  834   KAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGSVSPSTSSSSDPLSAE  892

Query  231   EINTISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQLAPVADEALSTPLLQH  287
             +   ++R  +  TSK TKDR A       +  P   RAS RLTQLAPVAD ALSTPL   
Sbjct  893   DRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNPQ  952

Query  288   QIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGK  347
             QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+RFNVG D +LA+VG+GG+GK
Sbjct  953   QINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTGK  1012

Query  348   STLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKY  407
             S   G ++ +F  N++A H C FDRKSKS+PRNVLLS V+Q++ NLP FKNQLARLNLKY
Sbjct  1013  SAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLKY  1072

Query  408   VLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVIIPEL  465
             VLEESDP +LA K+ VDPL A+EEP+ A   +++GLDQC +   GRN+LL+FL+ IIP+L
Sbjct  1073  VLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQL  1132

Query  466   PTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQARE  525
             P+W+G  I+SKP  +   RL +SS+LDFSAKN  +++D   +++DI  +FSD+D  +A+ 
Sbjct  1133  PSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAKR  1192

Query  526   ILKRKSGGNFTFLDFTKQALSHPG--MEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGK  583
             +LKRKSGGNF +L+FTKQALSHPG  M    G +PL+VL DLP+S+++IY EIFEDKFG+
Sbjct  1193  VLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFGQ  1252

Query  584   GRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGT  643
             GR RIW K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +RRSFVD+++V+HG 
Sbjct  1253  GRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHGA  1312

Query  644   YRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
             YR+E+SAL  WL DP R+ EQFY+ V   ++ALR+L
Sbjct  1313  YRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348

>PPTG_17129
Length=745

 Score = 602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/529 (56%), Positives = 390/529 (74%), Gaps = 20/529 (4%)

Query  171  QLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG----  226
            +L+ LR+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL     +      
Sbjct  155  ELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVS  214

Query  227  ---------LSTDEINTISRTTALFTSKATKDRRA---TRDESSSPMLVRASSRLTQLAP  274
                     LS +E   ++R T+  TS+AT+DR A   T    + P   RAS RLTQLAP
Sbjct  215  STESSSSDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAP  274

Query  275  VADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVD  334
            VAD ALSTPL   QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+RFNVG D
Sbjct  275  VADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGND  334

Query  335  NLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLP  394
             LLA+VGEGG+GKS   G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ NLP
Sbjct  335  TLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLP  394

Query  395  LFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRN  452
             FKNQLARLNLKYVLEE+DP +LA K+LVDPL A+EEPM A   ++DG+DQC +   GRN
Sbjct  395  SFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRN  454

Query  453  DLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDII  512
            +LL+F A +IP+LP+W+G  I+SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI 
Sbjct  455  ELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIA  514

Query  513  GSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESiy  570
             +FSD D  +A+++LK+KSGGNF +L+FTKQALSHPGM      G +PL+VLH+LPE++Y
Sbjct  515  RNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLY  574

Query  571  eiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIR  630
            +IY EIFEDKFG+GR R+W K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +R
Sbjct  575  DIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLR  634

Query  631  RSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
            RSFVD++ V+HG YRIE+SAL  WL DP R+ EQFY  +   + ALR++
Sbjct  635  RSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKM  683

>PHYSO_348903
Length=766

 Score = 601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/727 (47%), Positives = 454/727 (62%), Gaps = 106/727 (15%)

Query  17   RLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFY  76
            RL  ++ D+  A A DEDSLR+ +   +   R+ R+ T++ +   +      DDVEDMFY
Sbjct  17   RLGSSKKDA--AWALDEDSLRLKQAQDDAPVRYDRSGTLSDTVNVT------DDVEDMFY  68

Query  77   NGGDArstsssvrstDtygrstaastrstdtysratGGSLRVTDV--YRTTEQLRGTA-N  133
               +  + S+                                +DV  YRTTEQLR T   
Sbjct  69   GRNNRSTASA-------------------------------ASDVPQYRTTEQLRDTHLT  97

Query  134  LIPLQEDEVLPAASRTTTTS----------------------------------------  153
            L  L ED   P+A+   ++S                                        
Sbjct  98   LSALHEDAETPSATNNLSSSFSQFSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGF  157

Query  154  -QMPTngnysngnsgggsQLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLK  212
              +PT    +    G   +L+ LR E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LK
Sbjct  158  SAIPTTVGSAVAEEG---ELERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLK  214

Query  213  GTILQLVTALETKG-------------LSTDEINTISRTTALFTSKATKDRRATRD---E  256
            G + QL  A  +               LS D+   + R T+  TS AT++R A      +
Sbjct  215  GAVAQLTAAQHSSPPSVSSTDSSSLDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQ  274

Query  257  SSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREW  316
             + P   RAS RLTQLAPVAD+ALSTPL   QI+EMFPLI+ + EL A +R     SR W
Sbjct  275  KTPPPFARASVRLTQLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTW  334

Query  317  AVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKS  376
            A+ R +EW+DSRFN G D LLA+VGEGG+GKS   G ++ +F  N++A H C FDRKSKS
Sbjct  335  ALTRVEEWLDSRFNTGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKS  394

Query  377  SPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAK  436
            +PRNVLLS+V+Q++ N P FKNQLARLNLKYVLEE+DP++LA K+LVDPL ALEEP+ A 
Sbjct  395  TPRNVLLSMVHQIVDNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAA  454

Query  437  VFMIDGLDQCK--SRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFS  494
              M+DG+DQC   ++GRN+LL+F A IIP+LPTW+G  ++SKPS +L  RL +SS+LDFS
Sbjct  455  FMMVDGIDQCAAGAQGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFS  514

Query  495  AKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EE  552
            A+N  ++ D   ++ DI  +FSD D  +A+ +LK+KSGGNF +L+FTKQALSHPGM    
Sbjct  515  AENDAFVADVAPLVEDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAAS  574

Query  553  DNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITE  612
              G +PL VL+DLPE++Y+IY EIFEDKFG+GR R+W K +PLL+L+V AASGPY+ +TE
Sbjct  575  KEGAVPLGVLNDLPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTE  634

Query  613  TQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGG  672
             QA+E F L+ ED+R +RRSFVD++ VRHG+YRIE+SAL  WL DP R+ EQFY  +   
Sbjct  635  EQAREHFNLTAEDLRMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDA  694

Query  673  MSALRQL  679
            + ALRQ+
Sbjct  695  LQALRQM  701

>PHYRA_81098
Length=741

 Score = 600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/693 (48%), Positives = 444/693 (64%), Gaps = 89/693 (13%)

Query  30   AADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFYNGGDArstsssvr  89
            A DEDSLR+ K  Q++A R  R+TT+  +   +      DDVE+MFY             
Sbjct  22   ALDEDSLRL-KQTQDDALRLDRSTTLTDTVNVT------DDVEEMFY-------------  61

Query  90   stDtygrstaastrstdtysratGGSLRVTDV--YRTTEQLRGT-ANLIPLQEDE-----  141
                                   GG   V+DV  YRTTEQLRGT   L  L ED      
Sbjct  62   -----------------------GGRSTVSDVPQYRTTEQLRGTHMTLSALHEDAEASNA  98

Query  142  ---------VLPAASRTTTTSQMP--------TngnysngnsgggsQLDALRTELSEMKL  184
                       P+    +T   +P        +  + +        +L+ LR+E+ E+K 
Sbjct  99   SSSFSQFSATTPSNYAASTPGHVPNQGAYHDFSTAHSTTRAISDAFELERLRSEVVEVKE  158

Query  185  EVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA--------------LETKGLSTD  230
            EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL                   +  LS D
Sbjct  159  EVKAIRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSAD  218

Query  231  EINTISRTTALFTSKATKDRRATRD---ESSSPMLVRASSRLTQLAPVADEALSTPLLQH  287
            E   ++R T+  TS AT++R A        + P   RAS RLTQLAPVAD ALSTPL   
Sbjct  219  ERAALTRQTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVADNALSTPLTPQ  278

Query  288  QIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGK  347
            QI++MFPLI+ + EL A +R+    SR WA+ R +EW+D+RFNVG D LLA+VGEGG+GK
Sbjct  279  QINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGK  338

Query  348  STLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKY  407
            S   G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ +LP FKNQLARLNLKY
Sbjct  339  SAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKY  398

Query  408  VLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKS--RGRNDLLDFLAVIIPEL  465
            VLEE+DP VLA K+LVDPL A+EEPM A   ++DG+DQC +  RGRN+LL+F A +IP L
Sbjct  399  VLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLL  458

Query  466  PTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQARE  525
            P+W+G  ++SKPS +L  RL +SS+LDFSAKN  +++D   ++ D+  +FSD D  +A++
Sbjct  459  PSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKK  518

Query  526  ILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGK  583
            +LK+KSGGNF +L+FTKQALSHPGM      G +PL VLH+LPE++Y+IY EIFEDKFG+
Sbjct  519  VLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQ  578

Query  584  GRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGT  643
            GR R+W K +PLL+LIV AA+GPY+L+TE QA++ F L+ ED+R +R SFVD++ VRHG 
Sbjct  579  GRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGA  638

Query  644  YRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676
            YRIE+SAL  WL DP R+ EQFY  +   + AL
Sbjct  639  YRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671

>PITG_18458
Length=747

 Score = 595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/699 (47%), Positives = 446/699 (64%), Gaps = 85/699 (12%)

Query  28   ATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFYNGGDArstsss  87
            A A DEDSLR+ +   ++  RF R+TT+  +   +      DDVE+MFY    + ++S  
Sbjct  19   AWALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFYGRSTSNTSSDM  72

Query  88   vrstDtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGT-ANLIPLQED------  140
             +                                YRTTEQLRG    L  L ED      
Sbjct  73   PQ--------------------------------YRTTEQLRGNNITLSALHEDVEASNV  100

Query  141  -----------EVLPAASRTTTTSQMPTngnysngnsgggs---------QLDALRTELS  180
                          P+    +T  +  +     N                +L+ LR+E+ 
Sbjct  101  SNVSSSFSQFSATTPSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERLRSEVL  160

Query  181  EMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTA-------------LETKGL  227
            E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL                  +  L
Sbjct  161  EVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPL  220

Query  228  STDEINTISRTTALFTSKATKDRRA---TRDESSSPMLVRASSRLTQLAPVADEALSTPL  284
            S DE   ++R T+  TS+AT+DR A   T    + P   RAS RLTQLAPVAD ALSTPL
Sbjct  221  SPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAPVADNALSTPL  280

Query  285  LQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGG  344
               QI+EMFPLI+ + EL A +R     +R WA+ R +EW+D+R+N+G D LLA+VGEGG
Sbjct  281  NPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGG  340

Query  345  SGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN  404
            +GKST  G ++ +F  N++A H C FDRKSKSSPRNVLLS+V+Q++ +LP FKNQLARLN
Sbjct  341  TGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLN  400

Query  405  LKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVII  462
            LKYVLEE+DP +LA K+LVDPL A+EEPM A   ++DG+DQC   S GRN+LL+  A +I
Sbjct  401  LKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVI  460

Query  463  PELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQ  522
            P+LP+W+G  ++SKPS +L  RL +SS+LDFSAKN  ++ D   +++DI  +FSD D  +
Sbjct  461  PQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAE  520

Query  523  AREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESiyeiyeeiFEDK  580
            A+++LK+KSGGNF +L+FTKQALSHPG+      G +PL+VLH+LPE++Y+IY EIFEDK
Sbjct  521  AKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDK  580

Query  581  FGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVR  640
            FG+GR R+W K +PLL+L+V AA+GPY+ +TE QA+E F L+ ED+R +RRSFVD++ V+
Sbjct  581  FGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVK  640

Query  641  HGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
            HG+YRIE+SAL  WL DP R+ EQFY  V   + ALR++
Sbjct  641  HGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKI  679

>PYAR_13571
Length=666

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/494 (57%), Positives = 365/494 (74%), Gaps = 32/494 (6%)

Query  188  AIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTALFTSKAT  247
            AIRREMMNEMH +RYDVLKEVTMLKGTI QL             I T++R T    SK+T
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQL-------------IETMARRTTTVASKST  166

Query  248  KDR-RATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALS  306
            K+R   TRD+   P+L   S RLTQLAPV D ALSTPL Q QIDE+FPL++ S E+   +
Sbjct  167  KERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQA  226

Query  307  RTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIH  366
            R  D  +REWA +R QEW+DSRFNVG D LLA+VG+ G+GK+                 H
Sbjct  227  RIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-----------------H  269

Query  367  LCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPL  426
             C F+RK KSSPRNVLLS+VNQ+ + LP FK+QLARLNLKYVLEE+D + LARK+LVDPL
Sbjct  270  FCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPL  329

Query  427  CALEEPMTAKVFMIDGLDQCK-SRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARL  485
             +LEEP+TAK  ++DGLDQC  + G NDLLDFL+V++PE P+W+G  IT+KPSPE   ++
Sbjct  330  ASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKV  389

Query  486  AISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQAL  545
             ++SLLDFSAKN  Y+NDT +++ DI+  F  +D   A +ILK KS GN+++L+FT+QA+
Sbjct  390  PVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAM  449

Query  546  SHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASG  605
            S+PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR R+W+K  P+L+LI TAASG
Sbjct  450  SNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASG  509

Query  606  PYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQF  665
            PYA ITE    +  + +K+D+R +RR+F+DII +RHGTY I +SALF+WL DPQR GE +
Sbjct  510  PYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPY  569

Query  666  YVDVSGGMSALRQL  679
            +VDV+  +  LR++
Sbjct  570  HVDVTLHVKVLRRV  583

>HYAP_07104
Length=721

 Score = 561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/606 (49%), Positives = 399/606 (66%), Gaps = 52/606 (9%)

Query  122  YRTTEQLRGTA-NLIPLQEDEVLPAASR----------------------------TTTT  152
            YR+TEQL G    L  L ED   P+                               TT+T
Sbjct  71   YRSTEQLPGRLLTLTSLNEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHLTTST  130

Query  153  SQMPTngnysngnsgggsQLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLK  212
            S M    ++     G  S+L+ LR EL E+K EV AIR+ ++NE+HVTRYDVLKE+ +LK
Sbjct  131  SMM----SHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLK  186

Query  213  GTILQLVTALE--------------TKGLSTDEINTISRTTALFTSKATKDRRATRDESS  258
            G I QL                   +  LS+ +   ++R T+  TS AT+DR A    ++
Sbjct  187  GAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAASRVNT  246

Query  259  ---SPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSRE  315
                P   RAS RLTQLAPVAD ALSTPL   Q++++FPLI+ + EL A +R     SR 
Sbjct  247  YKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTPGSRT  306

Query  316  WAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSK  375
            WA+ R +EW++SRF  G+D LLA+VGEGGSGKS   G ++ ++   +VA H C FDRK K
Sbjct  307  WALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFDRKGK  366

Query  376  SSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTA  435
            SSPRNVLLS+V+Q++ NLPLFKNQLARLNLKYVLEE+DPV+LA K+LVDPL ALE+P+  
Sbjct  367  SSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALEDPVDV  426

Query  436  KVFMIDGLDQCK--SRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDF  493
               ++DG+DQC     GRN+LL+FLA +IP+LP+W+GV ++SKPS +L  RL +SS+LDF
Sbjct  427  AFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSSVLDF  486

Query  494  SAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEED  553
            SAKN  ++ D   ++++I   F  +DV +A+E+LK KSGGNF +L+FTKQALS       
Sbjct  487  SAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMASVSK  546

Query  554  NGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITET  613
             G + +DVL +LPE++Y+IY EIFEDKFG GR R+W K + +L+L + A +GPY+ +TE 
Sbjct  547  EGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSPVTEE  606

Query  614  QAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGM  673
            QAQE F L+ ED+R +RRSFVD++ V+HG YRIENSAL  WL DP RA EQFY ++   +
Sbjct  607  QAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNIDDAL  666

Query  674  SALRQL  679
             ALR++
Sbjct  667  QALRKM  672

>PHALS_06476
Length=726

 Score = 530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 310/697 (44%), Positives = 415/697 (60%), Gaps = 110/697 (16%)

Query  32   DEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDMFYNGGDArstsssvrst  91
            ++DSLR  KH Q+E  R  R+ T+  +   +      DDVE+MFYN   A S        
Sbjct  27   NDDSLR-RKHTQDETVRVDRSATLTDTVNMT------DDVEEMFYNRSTATSGIPQ----  75

Query  92   DtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGTA-NLIPLQED----------  140
                                          YRTTEQ+RG    L  L ED          
Sbjct  76   ------------------------------YRTTEQIRGNNLALYALHEDFETQSTASDA  105

Query  141  --------EVLPAASRTTTTSQMPTngnysngnsgggsQLDA---------LRTELSEMK  183
                       P++   +T        +  +      S L A         L +E+ ++K
Sbjct  106  SSSFSQFSATTPSSYAASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLHSEVLKIK  165

Query  184  LEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTD-------------  230
             EV+ IRRE+MNE+HVTRYDVLKE+T+LKG I QL +       S+              
Sbjct  166  SEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSS  225

Query  231  -EINTISRTTALFTSKATKDRRAT---RDESSSPMLVRASSRLTQLAPVADEALSTPLLQ  286
             E   ++R T   TS+AT+DR A        + P  +RAS+RLTQLAPVAD+ALSTPL  
Sbjct  226  DERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNS  285

Query  287  HQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSG  346
             QI+E FPLI+ + EL A +R+    SR WA+ R QEW+D+RF++G D LLA+VGEGGSG
Sbjct  286  QQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSG  345

Query  347  KSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLK  406
            KS   G ++ +F  N++A H C FDRKSKS PRNVLLS+V+Q++ NLPLFKNQLARLNL+
Sbjct  346  KSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLR  405

Query  407  YVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCK--SRGRNDLLDFLAVIIPE  464
            YVLEE+DP +LA K+L+DPL ALEEP  +   +IDG+DQC   S GRN+LL+F++ II  
Sbjct  406  YVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISL  465

Query  465  LPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAR  524
            LP+W+G  ++SKPS +L   L +SS+LDFSAKN  ++ D   ++ DI   FSD D  +A+
Sbjct  466  LPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAK  525

Query  525  EILKRKSGGNFTFLDFTKQALSHPGME--EDNGYIPLDVLHDLPESiyeiyeeiFEDKFG  582
             +L +KSGGNF +L+FTKQALSHPGM     NG +PL VL +LPE++Y+IY EIFEDKFG
Sbjct  526  RMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFG  585

Query  583  KGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHG  642
            +G  R W K +PLL+LIV AA+GPY+L+TE QA++Q  L+ +D+R +RRSFVDI+ V+H 
Sbjct  586  QGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH-  644

Query  643  TYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQL  679
                                EQFY  +   + ALR++
Sbjct  645  -------------------EEQFYFSIEDALLALRKM  662

>PYVX_23590
Length=689

 Score = 499 bits (1286),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 309/672 (46%), Positives = 413/672 (61%), Gaps = 81/672 (12%)

Query  15   QRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRnttmntssasstssymsDDVEDM  74
            +R L+RAQSD V     D++SLR+S+ V E+A RFQR+TT++++S++ +       VE+M
Sbjct  18   ERDLKRAQSDGV--PLPDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDD-----VEEM  70

Query  75   FYNGGDArstsssvrstDtygrstaastrstdtysratGGSLRVTDVYRTTEQLRGTANL  134
            FY                  G +            R+T GS+R TDVYRTTEQLR T  L
Sbjct  71   FYG-------------GGPGGHAGHGGHAGHGGADRSTAGSVRTTDVYRTTEQLRST-GL  116

Query  135  IPLQEDEVLPAASRTTTTSQMPTngnysngnsgggsQLDALRTELSEMKLEVQAIRREMM  194
             PL ED VLP A    +          S  ++ G   L ALR EL++++ E QAIRRE+M
Sbjct  117  EPLAEDRVLPPAVPYGSVPHT------SGPHADGPGGLAALRAELADVRAETQAIRREVM  170

Query  195  NEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTALFTSKATKDRRATR  254
            NE+HV RYDVLKEVT+LKG + QL+ AL   G      +  SR  +  ++ +     ++ 
Sbjct  171  NELHVLRYDVLKEVTVLKGAVAQLLAALAPGG-----GDAGSRPGSAGSATSAATTASSS  225

Query  255  DESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSR  314
                SP    A      LAPV D ALS PL   Q+DE+FPL++ S ++ A +R     +R
Sbjct  226  SAELSPADRAAIGVAPTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTR  285

Query  315  EWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKS  374
            +WA  R QEW+DSRFNVG D LL +VG  G+GKST  G++ D    N++A H C FDRK+
Sbjct  286  DWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKA  345

Query  375  KSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMT  434
            KS+PR VLLSLV Q+++NLP FK QLARLNLKYVLEE D  VLA K+L+DPL A EEP+T
Sbjct  346  KSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPIT  405

Query  435  AKVFMIDGLDQCKS--RG--RNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSL  490
            AK  ++DGLDQCK+  RG  RN+LL+FLA ++P+LP+W+GV ++SKP+PEL  +L  +SL
Sbjct  406  AKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSL  465

Query  491  LDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM  550
            LDFS KN  ++ D   +++DI  +F+D    +AR +L+ K+GGNF +LDFT+QALS PG+
Sbjct  466  LDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL  525

Query  551  EEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALI  610
              D+G + LD+LHDLPES+YEIY EIFED                               
Sbjct  526  --DDGELELDMLHDLPESLYEIYLEIFED-------------------------------  552

Query  611  TETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVS  670
                         +D+R ++RSFVDII VR G YRIE+SALFEWL DP R+GE F+ D  
Sbjct  553  ------------NDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDAD  600

Query  671  GGMSALRQLHHQ  682
             G+  LR+L   
Sbjct  601  AGVDELRRLQQH  612

>CCI44111
Length=576

 Score = 390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 215/528 (41%), Positives = 322/528 (61%), Gaps = 24/528 (5%)

Query  171  QLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTD  230
            Q++A R E+  M+ E+Q +R+E++  +  TRYD+LKE+  LKG +  +   +++      
Sbjct  52   QIEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSP--INA  109

Query  231  EINTISRTTA-------------LFTSKATKDRRAT-RDESSSPMLVRASSRLTQ-----  271
            +IN ++ TTA             + ++  T DR     D S    LV  SS L +     
Sbjct  110  KINKLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPT  169

Query  272  LAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNV  331
            L  + +  LS PL + +IDEMFPLI+CS ++ + +    S +R WA++   +WI S F  
Sbjct  170  LMTMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFEN  229

Query  332  GVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMIS  391
            G + +L +VGEGG+GKSTLAG +  KF  N+ A H   FDRK  SS R+V+LSLV+Q  S
Sbjct  230  GNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFAS  289

Query  392  NLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCAL-EEPMTAKVFMIDGLDQCKSRG  450
             L L+K QL RLNL+Y+L ES+P+V+A KLL+DPL A+ E   T    + DG+DQC  + 
Sbjct  290  KLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKN  349

Query  451  R-NDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMIN  509
            + NDLL+ L+ I    P+WIG  +TSK  P   ARL  +S++     N +++ D+ I++ 
Sbjct  350  QSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILME  409

Query  510  DIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESi  569
            +++  F  K   +A +IL RKSGGN  +L F  +ALSHP +  +  ++ LDVL +LPES+
Sbjct  410  NLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESV  469

Query  570  yeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTI  629
             EI   IF+DKFG+G  R+WK  +P+LE+IV AA+GPY L+ E+Q ++QF L + + R I
Sbjct  470  DEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMI  529

Query  630  RRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALR  677
             R+F DII      YRI NS+L++WLV  +R+ + F+++       LR
Sbjct  530  NRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 388 bits (996),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 212/529 (40%), Positives = 324/529 (61%), Gaps = 25/529 (5%)

Query  171  QLDALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQL---VTALETKG-  226
            Q +A+R E+ +M+ E+Q++R+E++  +  TRYD++KE+  L+G +  +   +T ++ K  
Sbjct  59   QFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSS  118

Query  227  -LSTDEINTISRTTALFTSKATKDRRATR-----------DESSSPMLVR-----ASSRL  269
               T+E +T +  TA F+  A  D   +R           D S     V        S  
Sbjct  119  PTGTNENHTTANKTA-FSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSF  177

Query  270  TQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRF  329
            +   P+ +  LS PL + + DEMFP I+C  +L + +      +R WA++R +EWI+S F
Sbjct  178  STSVPLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNF  237

Query  330  NVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQM  389
                D++L ++GEGGSGKSTLAG +  KF   + A H C FDRKS+SS R+V+LSLV+Q 
Sbjct  238  KSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQF  297

Query  390  ISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMI-DGLDQCKS  448
             S  PL+K QL  LNL+Y+L+ES+P+V+A KLL++PL A+    + + F++ DG+DQC  
Sbjct  298  ASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFVLFDGIDQCLV  357

Query  449  RGR-NDLLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIM  507
                NDLLD ++ I    P+ IG  +TSK SP   A+    S++    +N  +MND+ I+
Sbjct  358  ENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRIL  417

Query  508  INDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPE  567
            + + I +F  K   +A +IL RKSGGN  +L FT++ALSHP +  +  ++ LDVL +LP+
Sbjct  418  MENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPD  477

Query  568  SiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIR  627
            S+ +I+  IFEDKFG+G  R+WK V+P+LE IV AA+G + L+ E Q +++F L KE+ R
Sbjct  478  SVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWR  537

Query  628  TIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676
             ++RSF DII      YRI  S+LF WL+   R+ + FY+D   G+  L
Sbjct  538  MMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGIKFL  585

>SPRG_06355
Length=713

 Score = 261 bits (667),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 178/569 (31%), Positives = 295/569 (52%), Gaps = 81/569 (14%)

Query  174  ALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTAL-----------  222
            A+   + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+           
Sbjct  141  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAATPL  200

Query  223  ---ETKGLSTDEINTIS-----------------------------RTTALFTSKATKDR  250
               E + LS     T+S                             RT +    ++T  R
Sbjct  201  LRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKRESTVVR  260

Query  251  RATRDESS----SPMLVRASSRLTQLA----------PVADEALSTPLLQHQIDEMFPLI  296
             + R  S     S  L R SS++++ +          P+ D+AL+ P  ++ +++  P +
Sbjct  261  ESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQHLPFL  319

Query  297  ECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSD  356
                  + +      S+R WA+ ++ +W           +L +VG  G+GKSTL   L  
Sbjct  320  NTQRPAMEML----PSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLSHLVS  375

Query  357  KFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV  416
             + + I+A H   +D +  +S   +L+SL +Q+   LP F+ QL RLNL Y+++E DPVV
Sbjct  376  NYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQEPDPVV  433

Query  417  LARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSK  476
            LA KLL++PL ++  P+ ++V ++D +D+  S    +L+  LA +  E P+W+   ++S+
Sbjct  434  LATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLFLLSSR  493

Query  477  PSPELPARLAISSLLDFSAKNTNYMNDTVIMINDII--GSFSDKDVPQAREILKRKSGGN  534
            P   +   L    +L F  ++  +  D  I +  ++      DK++     +LK KS G+
Sbjct  494  PVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNI---LFLLKAKSQGS  550

Query  535  FTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQP  594
            F +L F  QA +    E D G I      +LP+++YEIY+++FE+K+GKGR R+W+KVQP
Sbjct  551  FLYLQFVDQAFAMIHSEIDAGMI-----LELPKTLYEIYDQVFEEKYGKGRRRVWQKVQP  605

Query  595  LLELIVTAAS-----GPYALITETQAQEQFALSKEDIRTIRRSFVDI--IDVRHGTYRIE  647
            +LE IV AA+          +TE+  Q  F L + D+  I RSF DI  +D   G YR++
Sbjct  606  VLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVYRLQ  665

Query  648  NSALFEWLVDPQRAGEQFYVDVSGGMSAL  676
            +  LF++LVD  R+ E  +++V  G+  L
Sbjct  666  SKGLFDYLVDTSRSQEVAHINVERGVHYL  694

>SDRG_01763
Length=736

 Score = 253 bits (645),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 176/579 (30%), Positives = 295/579 (51%), Gaps = 91/579 (16%)

Query  174  ALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTAL-----------  222
            A+   + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+           
Sbjct  154  AMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRAVAT  213

Query  223  -----ETKGLSTDEINTI-----------------------------SRTTALFTSKATK  248
                 E + LS     T+                             SRT +    ++T 
Sbjct  214  PLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRESTV  273

Query  249  DRRATRDESS----SPMLVRASSRLTQLA------------------PVADEALSTPLLQ  286
             R +TR  S     S  L R SS+L++ +                  P+ D+AL+ P  +
Sbjct  274  FRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQP-WE  332

Query  287  HQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSG  346
            + +++  P +      + +      S+R WA+ ++ +W           +L +VG  G+G
Sbjct  333  NVLNQHLPFLNTQRPAMEML----PSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAG  388

Query  347  KSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLK  406
            KSTL   L   + + I+A H   +D   + +P  +L+SL +Q+   LP ++ QL RLNL 
Sbjct  389  KSTLLSHLVSNYPEQIMASHFVRYDE--RHAPSAILMSLAHQISCKLPDYQQQLVRLNLP  446

Query  407  YVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELP  466
            Y+++E DP+VLA KLL++PL ++  P+ ++V ++D +D+  S    +L+  LA +  E P
Sbjct  447  YLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVALEFP  506

Query  467  TWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDII--GSFSDKDVPQAR  524
            +W+   ++S+    +   L    +L F  ++  +  D  I +  ++      DK++    
Sbjct  507  SWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDDKNI---L  563

Query  525  EILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKG  584
             +LK KS G+F +L F  QA S    E D G I      +LP++++EIY+++FE+K+GKG
Sbjct  564  FLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMI-----LELPKTLHEIYDQVFEEKYGKG  618

Query  585  RNRIWKKVQPLLELIVTAASGPY-----ALITETQAQEQFALSKEDIRTIRRSFVDIIDV  639
            R R+W+KVQ +LE IV AA+  +       +TE+  Q  F L + D+  I RSF DI+ V
Sbjct  619  RRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVTV  678

Query  640  RH--GTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676
                G YR+++  LF++LVD  R+ E  +++V  G+  L
Sbjct  679  DEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

>PITG_17250
Length=1046

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 114/464 (25%), Positives = 192/464 (41%), Gaps = 67/464 (14%)

Query  263  VRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQ  322
            VR  SR  QL    +  L     Q ++  +        ++  L+ T+    REW  + FQ
Sbjct  401  VRYESRREQLVSALEGTLDHEGQQTRLFSLLSPFSFQRQISHLTETF--VGREWLFQLFQ  458

Query  323  EWID----SRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSP  378
             W+     S   +    +  ++G+ GSGKS++A  +     + I A H  T + +   + 
Sbjct  459  RWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQACPE-IAAFHFATQEDEQTHNA  517

Query  379  RNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLVDPLCALEEPMT  434
            R  +LSL  Q+ + LP + + L        LEE  PV     L   LL+ PL A+  P  
Sbjct  518  RRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGPLNAIARPSK  574

Query  435  AK--VFMIDGLD-----QC---------KSRGRNDLLDFLAVIIPELPTWIGVFITSKPS  478
             K  V +IDG++      C         +S+    L+  L +++  LP W+ + + S+  
Sbjct  575  YKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIVLLSREE  634

Query  479  PELPARLAISSLLDFSAKNTNYMNDTVI-----------MINDI--------IGSFSDK-  518
            P + ++L      D   +     ND  I            ++D+        IGS SD  
Sbjct  635  PPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASAQIGSGSDTG  694

Query  519  --DVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeei  576
               + Q  E++ R+S G F +     QA+S        G + L  L +LP  +     + 
Sbjct  695  EFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPVGMGAYLHQF  747

Query  577  FEDKFGKGRNRIWK-KVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVD  635
            F   F    + ++K +++P+LE +  AA  P  L T  +  E     + D   +  S   
Sbjct  748  FASHFAD--HDVYKHRIRPVLE-VCCAAYEPLPLATLARVLEWDVYEQRDAAAMLGSLFS  804

Query  636  I---IDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSAL  676
            I    D      R  +S++ +W+ D   +G  F+VDV+ G   L
Sbjct  805  IEAGHDPEAQLLRPFHSSVLDWVRDSNSSG-VFFVDVASGHERL  847

>PHYSO_470533
Length=1084

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 102/417 (24%), Positives = 170/417 (41%), Gaps = 71/417 (17%)

Query  313  SREWAVERFQEWIDSRFNVGVD---------NLLALVGEGGSGKSTLAGALSDKFHDNIV  363
             REW  ERFQ+W+     +             +  LVG+ GSGK+++A  +     + I 
Sbjct  471  GREWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPE-IA  529

Query  364  AIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LAR  419
            A H    + +   + R  +LSL  Q+ + LP + + L        LEE  PV     L  
Sbjct  530  AFHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVS  586

Query  420  KLLVDPLCALEEPMTAK--VFMIDGLD----------------QCKSRGRNDLLDFLAVI  461
            +LL+ PL A+  P T K  V +IDG++                   S+    L+  L  +
Sbjct  587  QLLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPAL  646

Query  462  IPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIM--------------  507
               LP W+ V + S+  P + ++L      D    +  + ND  I               
Sbjct  647  ASRLPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSE  706

Query  508  INDIIGSFSDKDVP---------QAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIP  558
            ++    S    DVP         Q  E++ R+S G F +     QA++        G + 
Sbjct  707  VDFAKASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRLR  759

Query  559  LDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQ  618
            L  L +LP  +    ++ F   F    +   ++V+P+LE ++ AA  P  L T  +  E 
Sbjct  760  LHELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLE-VLCAAYEPLPLATLARVLEW  817

Query  619  FALSKEDIRTIRRSFVDI---IDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGG  672
                + D  ++  S   I    D      R  +S++ +W+ D   +G+ F+VDV+ G
Sbjct  818  DVYEQRDASSVLGSLFCIEAGYDANSQLLRPFHSSVLDWIQDSNSSGD-FFVDVASG  873

>PPTG_11365
Length=1106

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 99/415 (24%), Positives = 172/415 (41%), Gaps = 70/415 (17%)

Query  314  REWAVERFQEWI------DSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHL  367
            REW  E+FQ W+       S   +    +  +VG+ GSGK+++A  +     + I A HL
Sbjct  503  REWLFEQFQRWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSCPE-IAAFHL  561

Query  368  CTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLV  423
             T + +   + R  +LSL  Q+ + LP + + L        LEE  PV     L   LL+
Sbjct  562  ATQEDEQTHNARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLI  618

Query  424  DPLCALEEPMTAK--VFMIDGLDQC------------------KSRGRNDLLDFLAVIIP  463
             PL A+  P   K  V +IDG++                    +++     +  L +++ 
Sbjct  619  GPLTAIARPSKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVS  678

Query  464  ELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVI--MINDII---------  512
             LP W+ + + S+  P + ++L      D + +   + ND  I   IN  +         
Sbjct  679  RLPEWVRIVLLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVE  738

Query  513  ------------GSFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLD  560
                        G+  +  + Q  E++ R+S G F +     QA+S        G + L 
Sbjct  739  FEKAAAQIGTDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLHLH  791

Query  561  VLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFA  620
             L +LP  +    ++ F   F    +    +V+P+LE +  AA  P  + T  +  E   
Sbjct  792  ELAELPVGMGAYLQQFFASHFAD-HDMYKHRVRPVLE-VCCAAYEPLPVATIARVLEWDV  849

Query  621  LSKEDIRTIRRSFVDI---IDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGG  672
              + D  T+  S   I    D    T R  ++++ +W+ D   +G  F+VDV+ G
Sbjct  850  YEQRDAATVLGSLFSIEAGNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDVASG  903

>H257_11773
Length=1026

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 109/423 (26%), Positives = 184/423 (43%), Gaps = 37/423 (9%)

Query  263  VRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQ  322
            V+ + RL QL       L     Q ++  +F       E+   ++ +  + REW +++  
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  323  EWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVL  382
            EW  S           + G+ G+GK+ +A ++       + A HL + + +   + R  +
Sbjct  479  EWKASS-----SQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  383  LSLVNQMISNLPLFKNQLARLN--LKYVLEESDPVVLARKLLVDPLCALEEPMTAK-VFM  439
            LSL  Q+ + LP +   L + +  L+ ++  S    L   LLV PL A+ +P T   V +
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  440  IDGLD--QCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPAR---LAISSLLDFS  494
            IDGLD  Q  +   N  +  LA  +  LP W+   +TS+  P +  +   L     LD  
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  495  AKNTNYMNDTVIMINDIIGSF---SDKDVPQA--REILKRKSGGNFTFLDFTKQALSHPG  549
               T   +D +  +   +  F   +DKDVP A  R I++R S G F +      ALS   
Sbjct  653  GHQTR--DDMLKYLQLALVQFVANADKDVPAATLRFIVER-SEGLFLYASHIVNALSQKR  709

Query  550  MEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYAL  609
            +        LD L   P  +     + FED+F          V+PLLE ++ AA  P  +
Sbjct  710  LT-------LDKLESFPVGMGGYLRQYFEDQFTALHYE--TSVRPLLE-VLCAAFEPLHM  759

Query  610  ITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDV  669
             T     +  + +  D     +S + + D      +  ++++FEWL D   AG +F+V  
Sbjct  760  STLHNIMKWDSYAHRDFLGSFKSLLYVSD--ENELKPFHTSVFEWLEDAHAAG-RFFVCA  816

Query  670  SGG  672
            + G
Sbjct  817  ANG  819

>SDRG_04575
Length=1003

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 104/428 (24%), Positives = 188/428 (44%), Gaps = 46/428 (11%)

Query  268  RLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDS  327
            RL Q+A      L    LQ ++  +F      +++   ++ +  + REW + +  +W  +
Sbjct  404  RLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLDQWKQT  461

Query  328  RFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVN  387
                  D +  + G+ G+GKS LA  +       I A HL   + +   S R  +LSL  
Sbjct  462  H-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSHRRCILSLAY  515

Query  388  QMISNLPLFKNQLARLN-LKYVLEESDPVVLARKLLVDPLCALEEPMTAK-VFMIDGLDQ  445
            Q+ + LP + + L + + L+ V+  S  V L   LLV PL A+ EP T   V ++DGLD 
Sbjct  516  QLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVILLDGLDS  575

Query  446  CKSRGRND--LLDFLAVIIPELPTWIGVFITSKPSPELPARL-------AISSLLDFSAK  496
             +     D  L+  L  ++ +LP+W+ V +TS+  P +  +L       A+   +D S +
Sbjct  576  LEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKLQGFTPQIALDKCVDNSRQ  635

Query  497  NT-NYMNDTVI----------MINDIIGSFS-DKDVPQAREILKRKSGGNFTFLDFTKQA  544
            +  NY+   ++            + + G+   ++D    R++L R   G F +      A
Sbjct  636  DIMNYLQRALVPYLPSVRHRRRCSSLRGAPKVERDATTHRDLLLRI--GLFLYASHIVHA  693

Query  545  LSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAAS  604
            LS          + LD L   P  +     + FE +F     +  + ++PLLE ++ AA 
Sbjct  694  LS-------QHRLTLDHLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-VLCAAY  743

Query  605  GPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQ  664
             P  L       +  +  + ++    +S + + D      +  ++++ EWL D   AG  
Sbjct  744  EPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTD--SNVLKPFHTSVLEWLQDSNAAGP-  800

Query  665  FYVDVSGG  672
            F+  V  G
Sbjct  801  FFARVEHG  808

>SPRG_12621
Length=1003

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 89/364 (24%), Positives = 164/364 (45%), Gaps = 34/364 (9%)

Query  312  SSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFD  371
            + REW +++  +W  +      D +  + G+ G+GKS LA  +       + A HL   +
Sbjct  459  AGREWVLDQLDQWKQTH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKE  512

Query  372  RKSKSSPRNVLLSLVNQMISNLPLFKNQLARLN-LKYVLEESDPVVLARKLLVDPLCALE  430
             +   S R  +LSL  Q+ + LP + + L + + L+ V+  S  V L   LLV PL A+ 
Sbjct  513  DEQTQSHRRCVLSLAYQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIA  572

Query  431  EPMTAK-VFMIDGLDQCKSRGRND--LLDFLAVIIPELPTWIGVFITSKPSP-------E  480
            EP T   V ++DGLD  +     D  L+  L  ++ +LP+W+ V +TS+  P        
Sbjct  573  EPATTPLVILLDGLDSLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQG  632

Query  481  LPARLAISSLLDFSAKNT-NYMNDTVIMINDIIGSFSDKDVPQAR-EILKRKSGGNFTFL  538
               ++A+    D S ++  +Y+   ++     + S +   VP+A  + +  ++ G F + 
Sbjct  633  FAPQIALDKCADHSRQDIMSYLQKALL---PYLPSTTAGVVPEATLQFIAGRAEGLFLYA  689

Query  539  DFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLEL  598
                 ALS   +  DN       L   P  +     + FE +F     +  + ++PLLE 
Sbjct  690  SHIVHALSQHRLTLDN-------LEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-  739

Query  599  IVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDP  658
            ++ AA  P  L       +  +  + ++    +S + + D      +  ++++ EWL D 
Sbjct  740  VLCAAYEPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTD--SNVLKPFHTSVLEWLQDS  797

Query  659  QRAG  662
              AG
Sbjct  798  NAAG  801

>H257_01934
Length=1022

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 167/380 (44%), Gaps = 38/380 (10%)

Query  308  TYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHL  367
            T     R W +  F EW+ S  +     +  L G  GSGK+ LA  +       +VA HL
Sbjct  457  TQGYCGRAWVLHEFDEWVTSPPS-NARRVFLLTGVIGSGKTALAAHIIQN-RPEVVAFHL  514

Query  368  CTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLV  423
             + + +   + R  +L+LV Q+ + LP + N L   + K  LEE+  V     L ++LL+
Sbjct  515  ASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLADLVQELLI  572

Query  424  DPLCALEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPA  483
             PL  +  P +  V +IDG+ +C     ++L+  L   +   P W+    TS+  P + +
Sbjct  573  APLERIATPPSTMVILIDGI-ECFPCADDNLVAILTASLNRWPAWMRFVFTSREDPRVLS  631

Query  484  RLAISSL----LDFSAKNTNYMNDTVIMINDIIGSFSDKD---VPQAREILKRKSGGNFT  536
             L    L    LD +   +    D    ++  +GS  D      P   ++L  ++ G F 
Sbjct  632  LLQAYMLPPIALDLACAQSK--RDVRQYLDTALGSHFDISPPMPPHVIDLLVDRTQGLFL  689

Query  537  FLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLL  596
            +      ++S       +G   LD L ++P ++     + F  +F    ++    V+P+L
Sbjct  690  YARHLVDSIS-------SGQWNLDNLDNVPTTMGGFLHQNFATQF-PVVDKYKVDVRPVL  741

Query  597  ELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRH----GTYRIENSALF  652
            E +V AA  P  L   +      A+   D+   ++   D   + H    G     + +L 
Sbjct  742  E-VVCAAHEPLTLDALS------AIMHFDVYQAQKLQSDFGSLFHAGEGGVILPFHLSLL  794

Query  653  EWLVDPQRAGEQFYVDVSGG  672
            +WL DP+ AG+ ++VDV  G
Sbjct  795  DWLQDPRSAGD-YFVDVCTG  813

>H310_08292
Length=1007

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 98/434 (23%), Positives = 185/434 (43%), Gaps = 39/434 (9%)

Query  253  TRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSS  312
            T++ +S+   V+ + R+ QL       L     Q ++  +F       E+   ++ +  +
Sbjct  396  TQNNTSTVNDVKYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--A  453

Query  313  SREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDR  372
             REW +++  +W              + G+ G+GK+ LA  +       + A HL + D 
Sbjct  454  GREWVMDQLTQW-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDD  507

Query  373  KSKSSPRNVLLSLVNQMISNLPLFKNQLARLN-LKYVLEESDPVVLARKLLVDPLCALEE  431
            +   +PR  +LSL  Q+ + LP +   L +   L+ ++  S    L   LLV PL A+ +
Sbjct  508  EQTQNPRRCILSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQ  567

Query  432  PMTAK-VFMIDGLDQCKSRGR--NDLLDFLAVIIPELPTWIGVFITSKPSPE-------L  481
            P T   V ++DGLD  +      N  +  L  ++ +LP+W+ +  TS+  P        L
Sbjct  568  PTTVPLVILLDGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGL  627

Query  482  PARLAISSLLDFSAKNT-NYMNDTVIMINDIIGSFSDKDVP-QAREILKRKSGGNFTFLD  539
              ++A+   +D S+ +   Y+   ++     +       VP +    +  +S G F +  
Sbjct  628  VPQVALDKCVDQSSADMLKYLQAALV---PFVRPDEGAVVPLETLHAIVARSEGLFLYAS  684

Query  540  FTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELI  599
                AL    +        LD L   P  +     + FED+F          ++PLLE++
Sbjct  685  HIVHALHQKRLT-------LDKLESFPVGMGGYLRQFFEDQFSAHHYE--TSIRPLLEVL  735

Query  600  VTAASG-PYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDP  658
              A    P A++ +    + +  S  D     +S + + +      +  ++++FEWL D 
Sbjct  736  CAALEPMPMAMLHDVMKWDTY--SHRDCLGAFKSLLYVSE--SDDIKPFHTSVFEWLQDA  791

Query  659  QRAGEQFYVDVSGG  672
              AG +F+V V  G
Sbjct  792  NAAG-RFFVRVEHG  804

>SDRG_07983
Length=991

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 91/380 (24%), Positives = 157/380 (41%), Gaps = 45/380 (12%)

Query  313  SREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDR  372
            +REW + ++  W+ +        +  + G  GSGKS +   +       I A HL + + 
Sbjct  441  AREWVLAKYDAWVQTPNG---SRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  496

Query  373  KSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLVDPLCA  428
                S R  +LSLV Q+ + LP + N    +N +  LEE  PV     L   LL+ PL A
Sbjct  497  DQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSA  553

Query  429  LEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPEL---PTWIGVFITSKPSPEL----  481
            +  P +  V +IDG+D C   G      F+A +   +   P+W+     ++  P +    
Sbjct  554  IAHPASILVLLIDGID-CFEPG------FVATLTAHMDLWPSWVRFVFGTREDPSVLQTL  606

Query  482  -----PARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFT  536
                 PA     SL D       Y++   + +   + S S     +  + +  +S G F 
Sbjct  607  QAYMPPAVSLDPSLPDSKLDIKAYLH---LALTPQLTSESQSKRNEIVDFIAARSEGLFL  663

Query  537  FLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLL  596
            +      A++        G + L+ L   P S+    +  F+ +F        K ++P+L
Sbjct  664  YARHLVNAIA-------VGQLQLNQLDAFPTSMGGCLQHCFDAQF-PSIEYYKKTIRPVL  715

Query  597  ELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLV  656
            E ++ AA+ P  L             ++DI     S   I D      +  +S++ +WL 
Sbjct  716  E-VLCAANEPLPLSMFRSILALAVYEQQDILAWFGSLFYITD--SDIIKPFHSSVLDWLQ  772

Query  657  DPQRAGEQFYVDVSGGMSAL  676
            D + AG  ++VD   G  A+
Sbjct  773  DAKSAGP-YFVDAENGHYAI  791

>PYIR_14107
Length=1176

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 180/421 (43%), Gaps = 78/421 (19%)

Query  312  SSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFD  371
            + REW   + + WI S     V     + G+ GSGK+ LA  +     + I A H    +
Sbjct  548  AGREWLFMQLENWIASPTATQV---FWVTGQIGSGKTALAARMVQVIPE-IAAFHFALQE  603

Query  372  RKSKSSPRNVLLSLVNQMISNLPLFKNQL-ARLNLKYVLEESDPVVLARKLLVDPLCALE  430
             +   + R  +LSL  Q+ + LP +   L +R  L+ ++  S+   L  +LLV+PL  + 
Sbjct  604  DEQTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIA  663

Query  431  EPMTAK--VFMIDGL--------------------------------DQCKSRGRND--L  454
             P + K  V +IDGL                                D C S    D  L
Sbjct  664  RPQSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECL  723

Query  455  LDFLAVIIPELPTWIGVFITSKPSPELPARL-------AISSLLDFSAKNT-----NYMN  502
            +  L  ++  LP W+ V + S+  P + A+L        + SL   S ++      N + 
Sbjct  724  VSALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQQDIKRYVENMLG  783

Query  503  DT--VIMINDIIGS--------FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEE  552
            ++    +   I GS        FS+K  P+  +++ ++S G F +     Q++     EE
Sbjct  784  ESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-----EE  838

Query  553  DNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITE  612
                + +D L  LP  +   + + F+  F + + +    ++P+LE ++ A+  P++L   
Sbjct  839  KR--LAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLE-VLCASFEPFSLWNI  893

Query  613  TQAQEQFALSKEDIRTIRRSFVDIIDV-RHGTYRIENSALFEWLVDPQRAGEQFYVDVSG  671
                        D + I  SF  ++ +   G  R  +S++ +W+ DP  AG +++V+++ 
Sbjct  894  VSI---LNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAG-KYFVNIAN  949

Query  672  G  672
            G
Sbjct  950  G  950

>PYAP_22230
Length=1116

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 105/444 (24%), Positives = 177/444 (40%), Gaps = 96/444 (22%)

Query  312  SSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFD  371
            + R W +E  ++WI++    G   +  + G+ GSGK+++A  +  +    I A H    D
Sbjct  494  TGRAWLLESIRQWINTPVTSG-SKVFWVTGQIGSGKTSVAARMV-QLMPEIAAFHFALQD  551

Query  372  RKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPV----VLARKLLVDPLC  427
                   R  +LSL  Q+ + LP +      L     LEE  PV     L   LLV+PL 
Sbjct  552  DDQTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLN  608

Query  428  ALEEPMTAK--VFMIDGLDQ---------------------------------C-KSRGR  451
            A+  P + K  V +IDGL+                                  C +S G 
Sbjct  609  AIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGS  668

Query  452  ND--LLDFLAVIIPELPTWIGVFITSKPSPELPARLAI---SSLLDFSAK----------  496
            +D  L+  L  +I  LP W+ V + S+  P +  +L +   S  LD   +          
Sbjct  669  SDECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFV  728

Query  497  ---------NTNYMNDTVIMINDI------IGSFSDKD------VPQAREILKRKSGGNF  535
                      +++++ TV +   I      I + S  D        +  E++ ++S G F
Sbjct  729  EMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLF  788

Query  536  TFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQPL  595
             +     QA+       + G + +D L  LP  +     + FE  F     +   K++P+
Sbjct  789  LYAANIVQAI-------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYK--TKIRPV  839

Query  596  LELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTY-RIENSALFEW  654
            LE++  A    Y  +T       F  S  + + +  SF  ++ V    Y R  +S++ EW
Sbjct  840  LEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEW  895

Query  655  LVDPQRAGEQFYVDVSGGMSALRQ  678
            + D + AG  F  DV+ G   + Q
Sbjct  896  VQDFKTAG-AFLTDVALGHERIAQ  918

>PYU1_G002110
Length=999

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 98/395 (25%), Positives = 172/395 (44%), Gaps = 64/395 (16%)

Query  314  REWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRK  373
            R+W + +  +WIDS        +  + G+ GSGK+ LA  L     + I A H    + +
Sbjct  432  RKWLIAQLTKWIDSP---TASQMFWVTGQIGSGKTALAARLVQTIPE-IKAFHFAFEEDE  487

Query  374  SKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLVDPL---  426
               + R  +LSL  Q+ + L   K+  A L  +  LEE  PV     L   LL+ PL   
Sbjct  488  QTQNARRCVLSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEI  544

Query  427  CALEEPMTAKVFMIDGLDQCKSRGRND----------------LLDFLAVIIPELPTWIG  470
              L+   T  V +IDGL+   S G++D                L+  L  ++ +LP W+ 
Sbjct  545  AQLQSQNTPLVLLIDGLENL-SDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVR  603

Query  471  VFITSKPSPELPARL-------AISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQA  523
            V + S+  P + A+L        + + +  + ++     +  +  +   G  S K +P  
Sbjct  604  VIVLSRNDPAINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPD  663

Query  524  R-EILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFG  582
            + +++  +S G F +     Q+L      E+  +    V   LP  +     + F   FG
Sbjct  664  QIDLIVERSEGLFLYAANVVQSL------EEKWFA---VGQSLPIGMNGYLYDFFVSHFG  714

Query  583  KGRNRIWKKVQPLLELIVTAASGPYAL-----ITETQAQEQFALSKEDIRTIRRSFVDII  637
              + +  + ++P+LE ++ AA  P +L     I + Q  EQ     ++I T   S + I 
Sbjct  715  AKQYK--RLIRPVLE-VLCAAFEPLSLPTIASILKLQTNEQ-----QEIATAFGSLLSI-  765

Query  638  DVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGG  672
                G+ R  +S++  W+ + Q   + FYVDV+ G
Sbjct  766  -GADGSVRPFHSSVLNWVQELQSV-DPFYVDVATG  798

>SPRG_19030
Length=1000

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 158/381 (41%), Gaps = 47/381 (12%)

Query  313  SREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDR  372
            +REW + ++  W+ +        +  + G  GSGKS +   +       I A HL + + 
Sbjct  449  AREWVLAKYDAWVQTPNG---SRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  373  KSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVV----LARKLLVDPLCA  428
                S R  +LSLV Q+ + LP + N    LN +  LEE  PV     L   LL+ PL A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  429  LEEPMTAKVFMIDGLDQCKSRGRNDLLDFLAVIIPEL---PTWIGVFITSKPSPEL----  481
            +  P +  V +IDG++ C   G      F+A +   +   P+W+     ++  P +    
Sbjct  562  IAHPASILVLLIDGIE-CFEPG------FVATLTAHMDLWPSWVRFVFGTREDPSVLQTL  614

Query  482  -----PARLAISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFT  536
                 PA     SL +       Y++   + +   + + S     +  + +  ++ G F 
Sbjct  615  QAYMPPAVSLDPSLYESKLDIKAYLH---LALTPQLTTESQGKRNEIVDFIAARAEGLFL  671

Query  537  FLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGK-GRNRIWKKVQPL  595
            +      A++        G + L+ L   P S+    +  F+ +F   G  +  K ++P+
Sbjct  672  YARHLVNAIA-------VGQLQLNELDAFPTSMGGCLQHCFDAQFPSIGYYK--KTIRPV  722

Query  596  LELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWL  655
            LE ++ AA+ P  L             + DI     S   I D      +  +S++ +WL
Sbjct  723  LE-VLCAANEPLPLSMFRSILSLDVYEQHDILAWFGSLFYITD--SDIIKPFHSSVLDWL  779

Query  656  VDPQRAGEQFYVDVSGGMSAL  676
             D + AG  ++VD   G  A+
Sbjct  780  QDAKSAGP-YFVDAENGHYAI  799

>PYVX_21513
Length=1446

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 27/200 (14%)

Query  308  TYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHL  367
            TY  + R+W  +R Q+WI+   +     +  + G+ GSGK+++A  +   F + I A H 
Sbjct  432  TYRFTGRDWLFKRVQQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPE-IAAFHF  490

Query  368  CTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPV----VLARKLLV  423
               +       R  +LSL  Q+ + LP +      L  +  LEE  PV     L   LLV
Sbjct  491  ALQEDDQTHIARRCVLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLV  547

Query  424  DPLCALEEPMTAKVFMIDGLDQCKSRGR------------------NDLLDFLAVIIPEL  465
            +PL  ++ P    + +IDGL +C   G                     L+  L  ++  L
Sbjct  548  EPLNTIKRPAKPLILLIDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARL  606

Query  466  PTWIGVFITSKPSPELPARL  485
            P+W+ + + S+   ++  RL
Sbjct  607  PSWVRLVLLSREDHDVMTRL  626

>PYIW_15717
Length=1121

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 100/444 (23%), Positives = 179/444 (40%), Gaps = 104/444 (23%)

Query  312  SSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFD  371
            + REW   + + WI S        +  + G+ GSGK+ LA  +  +    I A H    +
Sbjct  523  AGREWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMV-QLIPEIAAFHFALQE  578

Query  372  RKSKSSPRNVLLSLVNQMISNLPLFKNQL-ARLNLKYVLEESDPVVLARKLLVDPLCALE  430
             +   + R  +LSL  Q+ + LP + + L +R  L+ ++  S+   L  +LLV+PL  + 
Sbjct  579  DEQTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIA  638

Query  431  EPMTAK---VFMIDGLDQC--------------------KSRGRN------------DLL  455
             P TA    V +IDGL+                      +S G N             L+
Sbjct  639  RPQTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLV  698

Query  456  DFLAVIIPELPTWIGVFITSKPSPELPARLAISS---LLD-FSAKNTNYMNDTVIMINDI  511
              L  ++  LP W+ V + S+  P + A+L   +   +LD F  +N     D    +  I
Sbjct  699  SALPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFEREN---QQDIKSYVEKI  755

Query  512  IGSFSDKDV------------------------------------------PQAREILKR  529
            +G  S + V                                          P+   ++ +
Sbjct  756  LGEPSPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVK  815

Query  530  KSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIW  589
            +S G F +     Q++     EE    +P+  L  LP  +   + + F+  F + + +  
Sbjct  816  RSEGLFLYAVNIVQSI-----EERR--LPVSQLESLPIGMGGYFRQFFDSHFDEQQYK--  866

Query  590  KKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDV-RHGTYRIEN  648
              ++P+LE ++ A+  P++L T        + S  D + I  SF  ++ V   G  R  +
Sbjct  867  DSIRPVLE-VLCASFEPFSLATIASI---LSWSVYDQQEIAASFGSLLFVGADGNIRPFH  922

Query  649  SALFEWLVDPQRAGEQFYVDVSGG  672
            S++ +W+ D   AGE ++ DV+ G
Sbjct  923  SSVLDWVQDLATAGE-YFADVANG  945

>PYAR_14788
Length=795

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 151/379 (40%), Gaps = 63/379 (17%)

Query  339  LVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPLFKN  398
            + G+ G+GK+++A  +     + I A H    +       R  +LSL  Q+ + LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTIPE-IAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  399  QLARLNLKYVLEESDPVV----LARKLLVDPLCALEEPMTAK--VFMIDGLDQCKSR--G  450
                L     LEE  PV     L   LL+ PL A+  P + K  + +IDGL+   S   G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  451  RNDLLDFLAVIIPELPTWIGVFITSK-------------PSPELPAR----------LAI  487
                +  L  +I  LP+W+ V + S+             PS  L  R             
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENEEDIRGFVE  596

Query  488  SSLLDFS-AKNTNYMNDTVIMINDIIGSFSDKDVPQAR------------EILKRKSGGN  534
            ++L   S +K++     T    +  I S   +  P A             E++ ++S G 
Sbjct  597  AALCSPSHSKHSATAGSTQRHRSPSITSSFAESAPAASSPSVCKISSEQVELITKRSEGL  656

Query  535  FTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRNRIWKKVQP  594
            F +     Q++       + G + +D L  LP  +     + FE  F     +   K++P
Sbjct  657  FLYAVNIVQSI-------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYK--TKIRP  707

Query  595  LLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTY-RIENSALFE  653
            +LE++  A    Y  +T       F  S  D   +  SF  +  +    Y R  +S++ E
Sbjct  708  VLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFHSSVLE  763

Query  654  WLVDPQRAGEQFYVDVSGG  672
            W+ D + AG  F  DV+ G
Sbjct  764  WVQDIKTAG-LFLADVALG  781

>PHYCA_526056
Length=805

 Score = 39.7 bits (91),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 109/263 (41%), Gaps = 39/263 (15%)

Query  275  VADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVD  334
            V D   ++PL+Q  +D + PL++    LV      D +S +   E     ++  F    D
Sbjct  453  VGDTMCASPLMQQALDHVIPLVQREQRLVTRLFFTDKASGKHEQEDLTMMMEGVF----D  508

Query  335  NLLALVGEGGSGKSTLAGALSDKFHDNIV-AIHLCTFDRKSKSSPRNVLLSLVNQMISNL  393
             LL  + E G      AG+       NI+ A+ L      S    R     L N M+S  
Sbjct  509  KLLKRMNEFGEA----AGS------RNILDALALVVLVSGSMEEYRQQSAFLYNVMVS--  556

Query  394  PLFKNQLARLNLKYVLEESDPVVLARKLLVD-PLCALEEPMTAKVFMIDGLDQCKSRGRN  452
              F+ Q+ R+ +K+  EE +  + A+   VD  +  +  P    V MI  +++  +   N
Sbjct  557  --FQLQMKRMLIKFT-EEQETWISAQN--VDTKMAGVLGPTKKIVNMIARMEESGAGRGN  611

Query  453  D--LLDFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMIND  510
            D  ++    +I+P    WI     S+P      RL          +N  +++D++  IN 
Sbjct  612  DSTMVSIYNMIVPATMQWIDKIAESRPKYAALTRL----------ENYLFLSDSLRTINS  661

Query  511  I----IGSFSDKDVPQAREILKR  529
                 +  F+D+   +  E L+R
Sbjct  662  SPDLPLAQFADEAQERYNENLQR  684

>PYIR_18103
Length=542

 Score = 37.0 bits (84),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 52/107 (49%), Gaps = 14/107 (13%)

Query  445  QCKSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMN  502
            Q K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  332  QYKNYSPDDLVDLMAKLLAMVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  388

Query  503  DTVIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
            D  ++ ND+      I S  D+ VP   E+++R    +GG  TFL +
Sbjct  389  DLGLVCNDVRTREVGIKSIHDQTVPDQVELVRRDYVANGGWETFLSY  435

>H257_02562
Length=989

 Score = 36.6 bits (83),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (51%), Gaps = 8/75 (11%)

Query  305  LSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFH--DNI  362
            LS  YDS+   W +E     +++ F +G  + + +VG  G GKSTL G L   +   D +
Sbjct  683  LSFQYDSTVDHWDLED----VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGV  736

Query  363  VAIHLCTFDRKSKSS  377
            +A+        SKSS
Sbjct  737  IAVDDHNLHAYSKSS  751

>PYVX_14828
Length=565

 Score = 35.8 bits (81),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (48%), Gaps = 14/107 (13%)

Query  445  QCKSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMN  502
            Q ++   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  355  QYRNYAPDDLVDLMAKLLALVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  411

Query  503  DTVIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
            D  ++ ND+      I    D+ VP   E+++R    SGG  TFL +
Sbjct  412  DLGLVCNDVRTREVGIKGIHDQQVPDQVELVRRDYVASGGWETFLSY  458

>PYAR_23233
Length=542

 Score = 35.4 bits (80),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (49%), Gaps = 14/107 (13%)

Query  445  QCKSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMN  502
            Q K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  332  QYKNYSPDDLVDLMARLLAIVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  388

Query  503  DTVIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
            D  ++ ND+      I S  D+ +P   E+++R    +GG  TFL +
Sbjct  389  DLGLVCNDVRTREVGIKSIHDQTIPDQVELVRRDYVANGGWETFLSY  435

>PYU1_G001876
Length=539

 Score = 35.4 bits (80),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 51/105 (49%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  331  KNYSPDDLVDLMAKLLAMVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MKDL  387

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I S  D+ VP   E+++R    +GG  TFL +
Sbjct  388  GLVCNDVRTREVGIKSIHDQTVPDQVELVRRDYVANGGWETFLSY  432

>H257_02565
Length=1005

 Score = 35.0 bits (79),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (51%), Gaps = 8/75 (11%)

Query  305  LSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFH--DNI  362
            LS  YD +S  W ++     +++ F +G  + + +VG  G GKSTL G L   +   D +
Sbjct  679  LSFQYDPTSDVWNLQD----VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGV  732

Query  363  VAIHLCTFDRKSKSS  377
            +A+        SKSS
Sbjct  733  IAVDDHNLHAYSKSS  747

>H310_02208
Length=1000

 Score = 35.0 bits (79),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 60/139 (43%), Gaps = 24/139 (17%)

Query  257  SSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMF----PLIECSDELVALSRT----  308
            S+  +L R S+ +T L      A+       ++DE+       IEC  +L  + R     
Sbjct  621  SAVTLLGRVSTPVTVLGGFMRVAIGNASSLQRLDEIVYDKSETIECIQKLPLMPRMEQAL  680

Query  309  --------YDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFH-  359
                    YDS++  W ++     I + F +G  + + +VG  G GKSTL G L   +  
Sbjct  681  RVDQLNFRYDSTTDVWNLKD----ITTTFPMG--HYVCIVGPSGCGKSTLLGCLMQFYEP  734

Query  360  -DNIVAIHLCTFDRKSKSS  377
             D ++A+        SKSS
Sbjct  735  SDGVIAVDNHNLQGYSKSS  753

>PPTG_13103
Length=343

 Score = 34.3 bits (77),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 43/90 (48%), Gaps = 8/90 (9%)

Query  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISN---  392
            LL L G+GG GKST+A  L+         + L   D    S PR  +L LV Q +     
Sbjct  62   LLVLSGKGGVGKSTVACQLAFALAGKGFQVGLLDVDITGPSVPR--MLGLVGQEVHQSAA  119

Query  393  --LPLF-KNQLARLNLKYVLEESDPVVLAR  419
               P++  + L  +++ ++L  +D  ++ R
Sbjct  120  GWSPVYVDDNLGVMSIGFMLPNADDAIIWR  149

>PITG_21173
Length=343

 Score = 34.3 bits (77),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 43/90 (48%), Gaps = 8/90 (9%)

Query  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISN---  392
            LL L G+GG GKST+A  L+         + L   D    S PR  +L LV Q +     
Sbjct  62   LLVLSGKGGVGKSTVACQLAFALAGKGFQVGLLDVDITGPSVPR--MLGLVGQEVHQSAA  119

Query  393  --LPLF-KNQLARLNLKYVLEESDPVVLAR  419
               P++  + L  +++ ++L  +D  ++ R
Sbjct  120  GWSPVYVDDNLGVMSIGFMLPNADDAIIWR  149

>H310_02210
Length=999

 Score = 34.7 bits (78),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 38/75 (51%), Gaps = 8/75 (11%)

Query  305  LSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFH--DNI  362
            LS  YD++   W ++     +++ F +G  + + +VG  G GKSTL G L   +   D +
Sbjct  680  LSFQYDATVDHWDLQD----VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGV  733

Query  363  VAIHLCTFDRKSKSS  377
            +A+        SKSS
Sbjct  734  IAVDNHNLQGYSKSS  748

>PITG_11723
Length=5515

 Score = 34.3 bits (77),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 41/86 (48%), Gaps = 6/86 (7%)

Query  173  DALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEI  232
            DAL+  +   K+EV+A+      E+H   + + K++ ++KGT+ QL   L    L+   I
Sbjct  25   DALQISVWNGKIEVEAV------ELHPDAFPLPKQMRLVKGTLRQLRIDLPWTNLANQPI  78

Query  233  NTISRTTALFTSKATKDRRATRDESS  258
                R  +L       DR  + +E S
Sbjct  79   RVDIRDVSLLLEVCANDRAHSANEQS  104

>PYAP_20633
Length=539

 Score = 34.3 bits (77),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 51/105 (49%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  331  KNYSPDDLVDLMARLLAIVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MKDL  387

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I S  D+ +P   E+++R    +GG  TFL +
Sbjct  388  GLVCNDVRTREVGIKSIHDQTIPDHVELVRRDYVANGGWETFLSY  432

>PHALS_10327
Length=89

 Score = 31.6 bits (70),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  327  SRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAI  365
            +R N   D ++ L GEGGSGKS L   L   F  + V I
Sbjct  45   TRLNDKFDFMVLLYGEGGSGKSLLMNLLKYSFASDQVII  83

>PPTG_10263
Length=541

 Score = 33.9 bits (76),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 48/105 (46%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  505  VIMINDI------IGSFSDKDVPQAREILKRKSGGNF---TFLDF  540
             ++ ND+      I    D+ VP   E+++R  G N    TFL +
Sbjct  390  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYGANGGWETFLSY  434

>PHYKE_3403
Length=736

 Score = 33.9 bits (76),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query  339  LVGEGGSGKSTLAGALSDKFH--DNIVAIHLCTFDRKSKSSPRNVL---LSLVNQMISNL  393
            ++G+ GSGKS+L   L+++FH   NI      T++ K +SS  +VL   +S  NQ+  + 
Sbjct  188  VLGQPGSGKSSLMKVLANRFHMDKNITLNGDITYNGKDRSSMLDVLPRDVSYANQIDDHY  247

Query  394  P  394
            P
Sbjct  248  P  248

>H310_12516
Length=316

 Score = 33.5 bits (75),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (49%), Gaps = 1/68 (1%)

Query  325  IDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVA-IHLCTFDRKSKSSPRNVLL  383
            +D+   +       LVG  G+GKSTL  AL D   + I + IH+    +       N  L
Sbjct  57   VDAELKLEAGAHYGLVGRNGTGKSTLLQALGDGLFEGISSHIHVMYVHQLFHVDLENPEL  116

Query  384  SLVNQMIS  391
            S+VN ++S
Sbjct  117  SVVNVLLS  124

>PHYRA_72221
Length=362

 Score = 33.5 bits (75),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 44/90 (49%), Gaps = 8/90 (9%)

Query  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISN---  392
            LL L G+GG GKST+A  L+         + L   D    S PR  +L L+ Q +     
Sbjct  62   LLVLSGKGGVGKSTVACQLAFALAGQGFQVGLLDVDITGPSVPR--MLGLLGQEVHQSAA  119

Query  393  --LPLF-KNQLARLNLKYVLEESDPVVLAR  419
               P++  + L  +++ ++L ++D  ++ R
Sbjct  120  GWSPVYVDDNLGVMSIGFMLPDADDAIIWR  149

>PHALS_04007
Length=345

 Score = 33.1 bits (74),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 43/90 (48%), Gaps = 8/90 (9%)

Query  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISN---  392
            LL L G+GG GKST+A  L+         + L   D    S PR  +L L+ Q +     
Sbjct  62   LLVLSGKGGVGKSTIACQLAFALASKGFQVGLLDVDITGPSVPR--MLGLLGQEVHQSAA  119

Query  393  --LPLF-KNQLARLNLKYVLEESDPVVLAR  419
               P++  + L  +++ ++L  +D  ++ R
Sbjct  120  GWSPVYVDDNLGVMSIGFMLPNADDAIIWR  149

>PHYSO_321022
Length=540

 Score = 33.5 bits (75),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  332  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  388

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  389  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  433

>PHYCA_572705
Length=543

 Score = 33.5 bits (75),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  335  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  391

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  392  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  436

>PYAP_16183
Length=893

 Score = 33.5 bits (75),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (45%), Gaps = 11/123 (9%)

Query  236  SRTTALFTSKATKDRRATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPL  295
            S    +F +         R   S P   R   R   L+  AD  +S     ++ +E+ P 
Sbjct  9    SAVVGVFVTDNPFSPYGGRHRKSVP---RMELRFKNLSATADVVVS----DNKNEEILPT  61

Query  296  IECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALS  355
            +  S+ LV ++R+   +S++       + ++  F  G   L+  +G+ GSGKSTL   LS
Sbjct  62   L--SNTLVQMARSMLPTSKQTETRHILKNVNGVFKPGTMTLV--LGQPGSGKSTLMKILS  117

Query  356  DKF  358
             +F
Sbjct  118  GRF  120

>PITG_01099
Length=541

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  390  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  434

>SDRG_03619
Length=985

 Score = 33.1 bits (74),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (55%), Gaps = 6/51 (12%)

Query  304  ALSRTYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGAL  354
            ALS  YD++S  W +      + + F +G  + + +VG  G GKSTL G L
Sbjct  673  ALSFQYDTTSDHWDLSD----VHASFPLG--HYVCIVGPSGCGKSTLLGCL  717

>H310_12514
Length=597

 Score = 33.1 bits (74),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (49%), Gaps = 1/68 (1%)

Query  325  IDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVA-IHLCTFDRKSKSSPRNVLL  383
            +D+   +       LVG  G+GKSTL  AL D   + I + IH+    +       N  L
Sbjct  57   VDAELKLEAGAHYGLVGRNGTGKSTLLQALGDGLFEGISSHIHVMYVHQLFHVDLENPEL  116

Query  384  SLVNQMIS  391
            S+VN ++S
Sbjct  117  SVVNVLLS  124

>PHALS_07874
Length=541

 Score = 33.1 bits (74),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 50/105 (48%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I +  D+ VP   E+++R    +GG  TFL +
Sbjct  390  GLVCNDVRTREVGIKNIHDQSVPDQVELVRRDYVANGGWETFLSY  434

>PHYKE_4131
Length=543

 Score = 32.7 bits (73),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  447  KSRGRNDLLDFLAVIIPELPTWIGVFITSK--PSPELPARLAISSLLDFSAKNTNYMNDT  504
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  335  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  391

Query  505  VIMINDI------IGSFSDKDVPQAREILKR---KSGGNFTFLDF  540
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  392  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLAY  436

Lambda      K        H        a         alpha
   0.318    0.133    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58721233980

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40