Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_187931475799799750850.0
PYIR_13453147571186102442180.0
PYU1_G0017341475780080734470.0
PYAP_1774614757116999227860.0
PHYSO_321157147571180102026700.0
PPTG_17128147571177103126650.0
PITG_18457147571170102925790.0
PHYRA_95901147571075101825420.0
PHALS_06477147571166102524550.0
H310_09212147571113100621750.0
H257_0630514757109998621710.0
SDRG_0176414757109298721430.0
PHYCA_344751475769274021140.0
SPRG_063541475788493020470.0
CCA1889814757114776417260.0
CCI4512214757110591517240.0
PYAR_13581147577304479236e-110
PHYKE_8394147574282596974e-81
PHYKE_8470108151669114870.34
PHYSO_48929614211098164870.39
PHYCA_7562108131246112860.44
PHYRA_84534140501368179850.63
HYAP_00989495133050850.66
HYAP_1285012378697850840.69
PITG_13319108131297112840.78
PPTG_16825108131303123831.1
PYIR_202022856155599831.2
PPTG_16221140501259176821.4
H310_091715928159747811.6
H310_027096664139079811.9
PYIW_1987210283998223802.0
H310_023525362219353812.1
HYAP_035091211924118802.6
CCA165302856151243802.7
PYVX_15212143671907106793.2
HYAP_10791686144931783.7
PHYRA_970497103845151775.0
H310_05643123786131682775.2
PHYSO_345966108131304112775.3
PHYRA_83913108131293112775.4
PYU1_G007827126131649100776.0
HYAP_0862314050118782766.9
PITG_063785362213790767.2
PYAP_152029463198764767.3
PYAP_177471475513437717.9
PYAR_1738310613178452758.3
PHYRA_944172856193443758.4
PPTG_132145362223749759.3
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_18793

Length=997
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_18793                                                            1963       0.0   
PYIR_13453                                                            1629       0.0   
PYU1_G001734                                                          1332       0.0   
PYAP_17746                                                            1077       0.0   
PHYSO_321157                                                          1033       0.0   
PPTG_17128                                                            1031       0.0   
PITG_18457                                                            998        0.0   
PHYRA_95901                                                           983        0.0   
PHALS_06477                                                           950        0.0   
H310_09212                                                            842        0.0   
H257_06305                                                            840        0.0   
SDRG_01764                                                            830        0.0   
PHYCA_34475                                                           818        0.0   
SPRG_06354                                                            793        0.0   
CCA18898                                                              669        0.0   
CCI45122                                                              668        0.0   
PYAR_13581                                                            360        6e-110
PHYKE_8394                                                            273        4e-81 
PHYKE_8470                                                            38.1       0.34  
PHYSO_489296                                                          38.1       0.39  
PHYCA_7562                                                            37.7       0.44  
PHYRA_84534                                                           37.4       0.63  
HYAP_00989                                                            37.4       0.66  
HYAP_12850                                                            37.0       0.69  
PITG_13319                                                            37.0       0.78  
PPTG_16825                                                            36.6       1.1   
PYIR_20202                                                            36.6       1.2   
PPTG_16221                                                            36.2       1.4   
H310_09171                                                            35.8       1.6   
H310_02709                                                            35.8       1.9   
PYIW_19872                                                            35.4       2.0   
H310_02352                                                            35.8       2.1   
HYAP_03509                                                            35.4       2.6   
CCA16530                                                              35.4       2.7   
PYVX_15212                                                            35.0       3.2   
HYAP_10791                                                            34.7       3.7   
PHYRA_97049                                                           34.3       5.0   
H310_05643                                                            34.3       5.2   
PHYSO_345966                                                          34.3       5.3   
PHYRA_83913                                                           34.3       5.4   
PYU1_G007827                                                          34.3       6.0   
HYAP_08623                                                            33.9       6.9   
PITG_06378                                                            33.9       7.2   
PYAP_15202                                                            33.9       7.3   
PYAP_17747                                                            32.0       7.9   
PYAR_17383                                                            33.5       8.3   
PHYRA_94417                                                           33.5       8.4   
PPTG_13214                                                            33.5       9.3   

>PYIW_18793
Length=997

 Score = 1963 bits (5085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 997/997 (100%), Positives = 997/997 (100%), Gaps = 0/997 (0%)

Query  1    MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ  60
            MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ
Sbjct  1    MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ  60

Query  61   NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVN  120
            NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVN
Sbjct  61   NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVN  120

Query  121  GSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPE  180
            GSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPE
Sbjct  121  GSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPE  180

Query  181  TNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS  240
            TNVDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS
Sbjct  181  TNVDEDLMYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS  240

Query  241  FKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVN  300
            FKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVN
Sbjct  241  FKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVN  300

Query  301  EDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRV  360
            EDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRV
Sbjct  301  EDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRV  360

Query  361  YASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSAD  420
            YASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSAD
Sbjct  361  YASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSAD  420

Query  421  NFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFP  480
            NFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFP
Sbjct  421  NFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFP  480

Query  481  EHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGM  540
            EHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGM
Sbjct  481  EHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGM  540

Query  541  DPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKID  600
            DPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKID
Sbjct  541  DPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKID  600

Query  601  YDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPL  660
            YDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPL
Sbjct  601  YDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPL  660

Query  661  HPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLsssgg  720
            HPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGG
Sbjct  661  HPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLSSSGG  720

Query  721  cggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKS  780
            CGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKS
Sbjct  721  CGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKS  780

Query  781  HTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTsaslvqlqsssaa  840
            HTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAA
Sbjct  781  HTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTSASLVQLQSSSAA  840

Query  841  fasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGV  900
            FASGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGV
Sbjct  841  FASGASAADLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGV  900

Query  901  CFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFT  960
            CFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFT
Sbjct  901  CFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFT  960

Query  961  SGGEAETGNFADVLAAIRALTGGKSAKLEKIRRLRRN  997
            SGGEAETGNFADVLAAIRALTGGKSAKLEKIRRLRRN
Sbjct  961  SGGEAETGNFADVLAAIRALTGGKSAKLEKIRRLRRN  997

>PYIR_13453
Length=1186

 Score = 1629 bits (4218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/1024 (80%), Positives = 888/1024 (87%), Gaps = 30/1024 (3%)

Query  1     MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ  60
             MAQ+ARLLPSVNK DPSAPTPELSEQDAK+GMLSLVNRGFLPVG DLT AF+N+HG II+
Sbjct  166   MAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIK  225

Query  61    NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLA---ATAECREGDGSDSPSQHKAALA  117
             N KTRIYDRQEQPIR++P TNPSGFN+A+LKFD+A    T   RE      PS  + A A
Sbjct  226   NSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAA  285

Query  118   V----VNGSQL-----DHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRH  168
                    GS L       +SA  R+RG  V+TV+FQGDA RGN  A+V S     +    
Sbjct  286   TQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVT---AAAML  342

Query  169   HASANQEAESPETNVdedlmy------dekdddANAMDELRKNVEKIRGYNELLDTYSLH  222
                 +QEAESPETN+D+++        D+ +DD +AMDELRKNVEKIRGYNELLDTYSLH
Sbjct  343   STDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLH  402

Query  223   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVA  282
             QFIIHKGRAMRETPEFVSFKRVAQEVWGSV+EVI+ALEALLTRYFVPLAY+DGQRLMTVA
Sbjct  403   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462

Query  283   AMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYS  342
             AMEMA++SKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAA+TIQNFFRMWWNQKKY+
Sbjct  463   AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522

Query  343   RFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRV  402
             RFRHHLASVV IQRVWR +ASH+ LKR++K QR QQH QWEAKMQRLKRDW  IKGNRRV
Sbjct  523   RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582

Query  403   VIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKL  462
             VIHVPS S+DER R+SADNFSVKQN+QLSRLCGL+D NVDIVYVSPFELT DV QYSMKL
Sbjct  583   VIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKL  642

Query  463   LQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMP  522
             LQLGGIADPVARVKLV+PE A RFP HFSLTTLLLYSPHCLRRIQRYI+NKEAYLVTG+P
Sbjct  643   LQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIP  702

Query  523   GPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSL  582
             G EDKRLA+ALNVPILGMDPLSALPLMTKSG KRFFMRADVNVPTGTYDIYDEDELVFSL
Sbjct  703   GREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSL  762

Query  583   AKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAA  642
             AKLI+SHIEQSVWVLKIDYDPF TGTALLDVSTM  LREIRREK+SPEYW+QP TRDNAA
Sbjct  763   AKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAA  822

Query  643   RVIIAELERTLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPS  702
             R IIAELERTL +LVTPLHPE+YPSWQ++ DAI QFGVVVEAAPSAV+GHVRANLF+EPS
Sbjct  823   RAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPS  882

Query  703   GEVHVSSTQDILLs-----ssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGK  757
             GEVHVSSTQDI+ +     SSGG  GK  GAYR K+VGYAFPQTAAPYEAIRGASTAIGK
Sbjct  883   GEVHVSSTQDIITTSSNSSSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIGK  942

Query  758   LLAEDNVFGYASIDFLVFQEDKSHTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSG  817
             LLA++ VFGY+SID+LVFQEDK+H ARLWAMAL PYLTDSA+TF TFHLLNRGALN +SG
Sbjct  943   LLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSG  1002

Query  818   LYYLPAATVTsaslvqlqs----ssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYV  873
             LY+LP    + +S          S AA A+G SAADLV+ EATHSGLVSLEK GAQ TYV
Sbjct  1003  LYHLPPVAASPSSSSTKSLKPSHSRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYV  1062

Query  874   VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTAS  933
             VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG+MCCSD+AS
Sbjct  1063  VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSAS  1122

Query  934   GALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSAKLEKIRR  993
             GALGFLRTALEV+GREVGTQAL DEF  GGE+ETGNFADVLA IRALTGGKSAKLEKIRR
Sbjct  1123  GALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIRALTGGKSAKLEKIRR  1182

Query  994   LRRN  997
             LRRN
Sbjct  1183  LRRN  1186

>PYU1_G001734
Length=800

 Score = 1332 bits (3447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/807 (78%), Positives = 717/807 (89%), Gaps = 16/807 (2%)

Query  199  MDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKA  258
            MD+LRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEFVSFKRVAQE+WG V+EVIKA
Sbjct  1    MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  259  LEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGK  318
            LE LLTRYFVPLAYVDGQRLMTVA+MEMAS+SK+DLLSCIVNEDQVGSLIRRPGQRYKGK
Sbjct  61   LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  319  DRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQ  378
            DRKRRAA+TIQN FRMW NQKKYSR+R HL+SVV IQ+VWR YASH+DL+R++K+QR QQ
Sbjct  121  DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  379  HAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVD  438
            H QWEA+MQRL+R+W RIK NRRV+IHVPS S+DER R+ ADNF+VKQNLQLSRLCG++D
Sbjct  181  HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  439  SNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLY  498
            +NVDIVYVSPFELT++V QY MKLLQLGGIADPV RVKLVFPE A RFP HFSLTT+LLY
Sbjct  241  ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  499  SPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFF  558
            SPHCLRRI+R +K KEAYLVTGMPG EDKRLAMALNVPILGMDPL+ LPLMTKSG KRFF
Sbjct  301  SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  559  MRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVA  618
            MRADVNVPTGTYDIYDEDEL+FSLAKLIVSHIEQ+VW+LKIDYDPF TGTA++D S + A
Sbjct  361  MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  619  LREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPSWQDYADAIVQF  678
            LREIRREK+SPEYWRQPGTRDNAAR+IIAELERT+G LVTPLHPE+YP+WQ++ADAI QF
Sbjct  421  LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480

Query  679  GVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHKSVGYAF  738
            GVV+EAAPSA+VG++RANLFVEPSGEVHVSSTQD++LS++          ++ K  GYAF
Sbjct  481  GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILSTASI--------HKRKVAGYAF  532

Query  739  PQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTARLWAMALRPYLTDSA  798
            PQT APYEAIRGAS AIGK+L +D+VFGY+S+D+LVF+EDK+H  RLWAMAL PYLTDSA
Sbjct  533  PQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPYLTDSA  592

Query  799  ATFTTFHLLNRGALNTTSGLYYLPAATVT--------saslvqlqsssaafasgasaaDL  850
            +TF  FHLLNRGALN  +G Y+LPA   +        S+  ++L +SS   A  A++A+L
Sbjct  593  STFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSATSANL  652

Query  851  VLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGS  910
            VL EATH GLVSLEK GAQ TY V+EYIFHPNVSTMQYS+FFHTCRLHGVCFDVERC G+
Sbjct  653  VLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVERCFGT  712

Query  911  VFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNF  970
            +F+LADSLTAGVFG++CC DTAS ALGFLRTALEV+GREVGTQALTD+   GG+ E+GNF
Sbjct  713  IFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDCESGNF  772

Query  971  ADVLAAIRALTGGKSAKLEKIRRLRRN  997
            A+VL  +R LTGGKSAKLEKIRRLRR 
Sbjct  773  AEVLTVVRTLTGGKSAKLEKIRRLRRG  799

>PYAP_17746
Length=1169

 Score = 1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/992 (55%), Positives = 698/992 (70%), Gaps = 66/992 (7%)

Query  4     HARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-----SHGG-  57
             +ARLLP VNK DP+AP P LS  DAK G+LSL+NRGFLP   DLT AF +     S G  
Sbjct  169   NARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSSPKSQGNP  228

Query  58    --IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115
               +IQN   +++ R+EQP+RA  +++P  FN+ATLKFD+AA                   
Sbjct  229   TSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAV---------------NTV  273

Query  116   LAVVNGSQLDHDSAETRA-RGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQ  174
              A  N S   HD +E    R    +T+SF       +     R  + +H G R   +   
Sbjct  274   TAAENRSIEPHDESEALPLRAMKTVTISFHNGKSESSPRNNAR--ESEHDGRREDGNDTA  331

Query  175   EAESPETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRE  234
               E  + +V  D         AN+M++LR NVEKIRGYNELLD YSLHQFIIHKGRA+R+
Sbjct  332   PLEREDLDVTADEA-------ANSMEDLRNNVEKIRGYNELLDAYSLHQFIIHKGRALRD  384

Query  235   TPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDL  294
             TPEF SFKRVAQE+WGS++EVI+ALE LLTRYFVPLAY+DGQRLMT+A+MEMA  S  +L
Sbjct  385   TPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVPLAYIDGQRLMTLASMEMAKLSTCEL  444

Query  295   LSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAI  354
             L+C+VNEDQV SLIRRPGQRYKGKDRKRRAA T+Q FFRM  ++ ++ + R + +S + I
Sbjct  445   LTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQAFFRMVLHRNRFRKIRRNGSSAMLI  504

Query  355   QRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDER  414
             Q+ WR YA    L+RR+   R+++  +W+AK++R++  W  I+  RRVVIHV S SVDER
Sbjct  505   QKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRMRSQWRDIRQQRRVVIHVASISVDER  564

Query  415   LRLSADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVAR  474
              RLS +NFSVKQNLQLSRL GLVD NV+IVYV+PFEL+T+V QY +KLLQL GIA+   R
Sbjct  565   TRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPFELSTEVSQYFIKLLQLSGIANAHTR  624

Query  475   VKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALN  534
             V+LVFPEHA +FP HFSL T L+YSP+C+RRIQR ++ KEAYLV G+PGPED+RLA+AL 
Sbjct  625   VRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRLVQGKEAYLVMGVPGPEDQRLAVALQ  684

Query  535   VPILG-MDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQS  593
             VPILG  DP S LPLMT+SG KRFF++ADVNVPTGTYDIYD DEL+FSLAKLI+SH+ Q+
Sbjct  685   VPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTGTYDIYDIDELLFSLAKLIISHLNQN  744

Query  594   VWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTL  653
             VW+LK+D DP  TGTA+LDVS M  LR+IRREKR PEYW+QPG RD  AR ++ ELER +
Sbjct  745   VWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREI  804

Query  654   GNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDI  713
             G+L+ P HPE++ SW+++A AI +FGVVVEA P  V G +R N+F+EPSG+VHV ST D+
Sbjct  805   GSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPSGDVHVMSTNDV  864

Query  714   LLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVF-GYASIDF  772
             L        G      + +   + FPQT  P+EAI GAS+A+G++L E++ F GYAS+D 
Sbjct  865   L-----SGNGTTLSQRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDL  919

Query  773   LVFQED---KSHTA-RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTs  828
              + QE+     H A RLWA++L PYLTDSAATF  FH L+RG LN  +G Y L A   T 
Sbjct  920   QLSQEESLTSPHKAERLWAVSLFPYLTDSAATFAAFHALHRGVLNPATGRYNLTAREST-  978

Query  829   aslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQY  888
                                +D  L     S + +L+++GA  +Y V+EY+FHPNVS M Y
Sbjct  979   ----------------PPESDSAL---VSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSY  1019

Query  889   SAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGR  948
             +AFFHTCRLHGVCFDVERCVGSVFLLADSLTAG+FG++   ++A+ AL +LRTA EV+GR
Sbjct  1020  NAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGR  1079

Query  949   EVGTQALTDEFTSGGEAE--TGNFADVLAAIR  978
             EVGTQ++    +  G +   +GNFA++L  +R
Sbjct  1080  EVGTQSMVSGDSDIGSSVQLSGNFAEILGLLR  1111

>PHYSO_321157
Length=1180

 Score = 1033 bits (2670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/1020 (53%), Positives = 700/1020 (69%), Gaps = 67/1020 (7%)

Query  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-------SH  55
             QH RLLPSVNK DPSAPTPEL E+DAK+G+L+LV RGFLP   DLT AF         S 
Sbjct  175   QHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDGSG  234

Query  56    GGIIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115
             GG+++   TRI+DR EQ +R  P T  +G+N+A LKFDL A         +  P   +++
Sbjct  235   GGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPF-------TPPPPAPESS  287

Query  116   LAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQE  175
                   ++       +   GP+ +T+SF   AR      +VR +    + I   A+   +
Sbjct  288   PPATATTRRRSTRRGSAGHGPSKVTMSFPESARADKSGRSVRQSSLVSAAI---AAFTNQ  344

Query  176   AESPETN-------------VdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLH  222
             ++  E N              +E    + + D+   M+EL  NV+KIRGYNELLD YSLH
Sbjct  345   SDDLEDNRERFSEQPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNELLDAYSLH  404

Query  223   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVA  282
             QF+IHKGR MR+TPEFVSF+RVAQE+WGSV+E ++ALE LLT+YFVPLAY DGQRL+++A
Sbjct  405   QFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYADGQRLLSLA  464

Query  283   AMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYS  342
             +     +SKR+LLSCIVNE+QV +++RRPGQRYKG+DRKRRAA TIQ   RMW  +++Y 
Sbjct  465   STGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYV  524

Query  343   RFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRV  402
             R R    S   IQ  WR ++ H  LK R++  R +Q   WEAKM  LK  W +I G RRV
Sbjct  525   RSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWHQIAGRRRV  584

Query  403   VIHVPSFSVDERLRLSADNFSVKQNLQLSRLC-GLVDSNVD-IVYVSPFELTTDVVQYSM  460
             V+HVPS S+DE  RLSA+NF+V+QNLQL+R+C   +DSNVD +VYV+PFELT DV  Y +
Sbjct  585   VVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELTADVSHYFL  644

Query  461   KLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTG  520
             KLLQLGG+AD   RVKLVFPE A RFP HFSL+++LLYSPHCLRRI+ Y   K+AYLV G
Sbjct  645   KLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAGKDAYLVMG  704

Query  521   MPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVF  580
             +PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +RADVNVPTGTY++YDE EL  
Sbjct  705   LPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFA  764

Query  581   SLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDN  640
             +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+RE+RREK++PEYWRQPG RD 
Sbjct  765   ALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYWRQPGPRDA  824

Query  641   AARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAP------------  686
             A+++++AELER   L  L TP+H E++PSW++Y +AI  FG VVEA P            
Sbjct  825   ASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSFVASPETAS  884

Query  687   -SAVVGHVRANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPY  745
              S    +VRANLF++P G VH++STQ++L           GG    K+V + FPQT AP+
Sbjct  885   SSVEPAYVRANLFIDPDGTVHITSTQNVL---------ASGGGLNRKTVAFTFPQTVAPH  935

Query  746   EAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTF  804
             EA++GA TA GKLL E NV+GY S+DF+VFQ+DKS  A RLWA+A+ P+LTDSAA+F  F
Sbjct  936   EAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVHPFLTDSAASFACF  995

Query  805   HLLNRGALNTTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLVLHEATHSGLVSLE  864
             HLL RG L+ +SG Y + AA  T      L + ++  + G    DL+L EA+   L    
Sbjct  996   HLLARGVLDASSGGYRMAAANST------LAAVNSGRSGGGGTTDLLLREAS---LAKGA  1046

Query  865   KVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG  924
             + G    YVV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLL DSLTAGVFG
Sbjct  1047  QAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLTDSLTAGVFG  1106

Query  925   LMCCSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALTGG  983
             ++   +T  GAL F+RTALEV+GRE G T  +    +  G A +GNFA VL+A+RA TGG
Sbjct  1107  VLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSARSGNFAQVLSAVRASTGG  1166

>PPTG_17128
Length=1177

 Score = 1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/1031 (53%), Positives = 702/1031 (68%), Gaps = 65/1031 (6%)

Query  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVN-------SH  55
             QH RLLPSVNK DPSAP PEL E+DAK+G+L+LV RGFLP   DLT AF         S 
Sbjct  175   QHCRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSC  234

Query  56    GGIIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115
             GGI++   TRIYDR EQ +R+ P T  +G+N+A+LKFDL     C          + K  
Sbjct  235   GGIMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDL-----CAPPTPPPPIPESKDL  289

Query  116   LAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQE  175
             +   + ++       +  +GPN +T+SF    + GN     RSA Q        A+   +
Sbjct  290   MPPESTTRRRSVRKSSAVQGPNRVTMSF---PKSGNKVKNSRSAHQTSLMSAAVAAFTNQ  346

Query  176   AESPETNVdedlmydekdddAN----------AMDELRKNVEKIRGYNELLDTYSLHQFI  225
              E  + N       D  D+D             M+EL  NV+KIRGYNELLD YSLHQF+
Sbjct  347   GEDMDNNRGRFSDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDAYSLHQFL  406

Query  226   IHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAME  285
             IHKGR MR+TPEF+SF+RVAQE+WGSV+E ++ALEALLT+YFVPLAYVDGQRL+ +A   
Sbjct  407   IHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRLLALAGTG  466

Query  286   MASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFR  345
                +SKR+LLSCIVNEDQ+ S++RRPGQRYKG+DRKRRAA T+Q   RMW  +++Y+R R
Sbjct  467   QPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVRRRYARSR  526

Query  346   HHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIH  405
                 +   IQ  WR Y+ H  LK R++  R ++  +WE +M  LK  W +I   RRVV+H
Sbjct  527   ASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAARRRVVVH  586

Query  406   VPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNVD-IVYVSPFELTTDVVQYSMKLL  463
             VPS S+DE  RLSA+NF+V+QNLQL+R+C + +DSNVD +VYVSPFELT DV+QY +KLL
Sbjct  587   VPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVLQYFLKLL  646

Query  464   QLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPG  523
             QLGG+ D   RVK VFPE + RFP HFSL++LLLYSPHCLRRI+ Y   KEAYLV G+PG
Sbjct  647   QLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPG  706

Query  524   PEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLA  583
              ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +RADVNVP GTY++YDE EL  +LA
Sbjct  707   AEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHELCAALA  766

Query  584   KLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAAR  643
             KL ++H++Q  W++K+DYDP   G A++D+S + A+RE+RREKR+PEYWRQPG RD AA+
Sbjct  767   KLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAK  826

Query  644   VIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVV-----------  690
             +I+AELER   L  L  P+H E++P+W+DY DA+  FG V+EA P   +           
Sbjct  827   MILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALV  886

Query  691   --GHVRANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPYEAI  748
                +VRANLFV+P G VHV+STQ++L           GG    K+V + FPQTAAP+EAI
Sbjct  887   EPAYVRANLFVDPDGSVHVTSTQNVL--------ATGGGGLNRKTVAFTFPQTAAPHEAI  938

Query  749   RGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTFHLL  807
             +GA  A GKLL E NV+GY S+DF+VFQ++KS+ A RLWA+A+ P+LTDSAA+F  FHLL
Sbjct  939   KGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLTDSAASFACFHLL  998

Query  808   NRGALNTTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVG  867
              RG L+T SG Y + + ++T         +           DL+L EA+   L      G
Sbjct  999   ARGVLDTNSGAYRVASKSLT---------TVTGRNGSGCTTDLLLREAS---LAKDSLAG  1046

Query  868   AQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMC  927
             A   +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++FLLADSLTAGVFG++ 
Sbjct  1047  APRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGVLS  1106

Query  928   CSDTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALT-GGKS  985
               +T  GAL FLRTALEV+GRE G T  +    +      +GNFA VL+A+RA T GGKS
Sbjct  1107  IGETMEGALAFLRTALEVIGREAGSTINMVSSPSRPVSGRSGNFAQVLSAVRASTGGGKS  1166

Query  986   AKLEKIRRLRR  996
              +L K++R RR
Sbjct  1167  DRLGKMQRRRR  1177

>PITG_18457
Length=1170

 Score = 998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/1029 (52%), Positives = 697/1029 (68%), Gaps = 65/1029 (6%)

Query  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAF----VNSHGGI  58
             QH RLLPSVNK DPS PTPEL E+DAK+G+L+LV RGFLP   DLT  F      S GG+
Sbjct  172   QHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGV  231

Query  59    IQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDS-PSQHKAALA  117
             ++   TRIY+R EQ +R+ P T  +G+N+A+LKFDL A           + P       +
Sbjct  232   MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRS  291

Query  118   VVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAE  177
                 S L         +GPN  T S    + +     +        + +   A+   + E
Sbjct  292   TRRSSAL---------QGPNPFTRSVPISSSKIKNGRSAHPTSLMSAAV---AAFTNQGE  339

Query  178   SPETN----VdedlmydekdddANAMDE------LRKNVEKIRGYNELLDTYSLHQFIIH  227
               E N     D+D+  +E++ D N  DE      L  NV+KIRGYNELLD YSLHQF+IH
Sbjct  340   DTENNRDRFSDDDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLHQFLIH  399

Query  228   KGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMA  287
             KGR MR+TPEFVSF+RV QE+WGSV+E ++ALE LL +YFVPLAYVDGQRL+ +A     
Sbjct  400   KGRTMRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALAGTGQP  459

Query  288   SYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHH  347
              +SKR+LLSCIVNEDQV S++RRPGQRYKG+DRKRRAA TI+   RMW  +++Y+R R  
Sbjct  460   RFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYARTRAS  519

Query  348   LASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVP  407
               +   IQ  WR Y+ H  LK R++    ++  +WE +M  LK  W +I G RRVV+HVP
Sbjct  520   DFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRVVVHVP  579

Query  408   SFSVDERLRLSADNFSVKQNLQLSRLC-GLVDSNVD-IVYVSPFELTTDVVQYSMKLLQL  465
             S S+DE  RL A+NF+++QNLQL+R+C   +DSNV+ ++YVSPFELT+DV QY +KLLQL
Sbjct  580   SLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFLKLLQL  639

Query  466   GGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPE  525
             GG+ D   RVKLVFPE   RFP HFSL++LLLYSPHCLRRI+ Y   KEAYLV G+PG E
Sbjct  640   GGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMGLPGAE  699

Query  526   DKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKL  585
             D+RLAMAL++PILG  P  ALPL+T+SGGKR  +RADVNVP GTY++YDE E+  +LAKL
Sbjct  700   DQRLAMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCAALAKL  759

Query  586   IVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVI  645
              ++H++Q  W++K+DYDP   G A++D+S M A+RE+RREKR+PEYWRQPG RD AA++I
Sbjct  760   AIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLI  819

Query  646   IAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVV-------------  690
             +AELER   L  + TP+  E++P W+++ DA+  FG VVEA P   +             
Sbjct  820   LAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEP  879

Query  691   GHVRANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIRG  750
              +VRANLFV+P G VH+SSTQ++L           GG    K+V + FPQTAAPYEAI+G
Sbjct  880   AYVRANLFVDPDGSVHISSTQNVL--------AAGGGGLNRKTVAFTFPQTAAPYEAIKG  931

Query  751   ASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTFHLLNR  809
             A  A GKLL E NV+GY S+DF+VFQ++KS+ A RLWA+A+ P+LTDSA +F  FHLL R
Sbjct  932   ACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSATSFACFHLLAR  991

Query  810   GALNTTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQ  869
             G L+T SG+Y +   ++T        ++S   +   SA DL+L EA    L     VGA+
Sbjct  992   GVLDTNSGVYRVANKSLT-------TANSGRKSESGSATDLLLREAL---LAKSSLVGAR  1041

Query  870   HTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCS  929
               +V   Y+FHP+V TMQY+AFFH CRLHGVCFDVER +G++FLLADSLTAGVFG++   
Sbjct  1042  RCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSIG  1101

Query  930   DTASGALGFLRTALEVVGREVG-TQALTDEFTSGGEAETGNFADVLAAIRALT-GGKSAK  987
             +T  GAL FLRTALEV+GRE G T ++    +    + +GNFA +L+AIR  T GGKS +
Sbjct  1102  ETTEGALAFLRTALEVIGREAGSTISVASSPSRSVASRSGNFAQILSAIRVSTGGGKSDR  1161

Query  988   LEKIRRLRR  996
             L K+R+ +R
Sbjct  1162  LGKMRQRQR  1170

>PHYRA_95901
Length=1075

 Score = 983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/1018 (52%), Positives = 674/1018 (66%), Gaps = 133/1018 (13%)

Query  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQNH  62
             QH RLLPSVNK DP+APTPEL E+DAK+G+L+LV R          S+      G+++  
Sbjct  167   QHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTR----------SSGTKDGSGVMKQR  216

Query  63    KTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAEC---REGDGSDSPSQHKAALAVV  119
              TRIYDR EQP RA P T  +G+N+A LKFDL +T      R  D  +   +H      +
Sbjct  217   ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDDMEGNREH------I  270

Query  120   NGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESP  179
             +G   D D                QG A                         ++EAE  
Sbjct  271   DGEISDED----------------QGGADNDK---------------------DEEAE--  291

Query  180   ETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFV  239
                                M+EL  NV+KIRGYN+LLD YSLHQF+IHKGR+MR+TPEFV
Sbjct  292   -------------------MEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTPEFV  332

Query  240   SFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIV  299
             SF+RVAQE+WGSV+E ++ALE LLT+YFVPLAYVDGQRL+++AA     +SK +LL+CIV
Sbjct  333   SFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLACIV  392

Query  300   NEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWR  359
             NE+QV S++RRPGQRYKG+DRKRRAA TIQ   RMW  +++Y R R    S   IQ  WR
Sbjct  393   NEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQLAWR  452

Query  360   VYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSA  419
              Y+ H  LK R++  R +Q  +WEA+MQ L+  W +I G RRVV+HVPS S+DE  RLSA
Sbjct  453   SYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSRLSA  512

Query  420   DNFSVKQNLQLSRLCGL-VDSNVDI-VYVSPFELTTDVVQYSMKLLQLGGIADPVARVKL  477
             +NF+V+QNLQL+R+C   +DS+VD+ VYVSPFELT DV QY +KLLQLGG+AD   RVKL
Sbjct  513   ENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  572

Query  478   VFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPI  537
             VFPE A RFP HFSL++LLLYSPHCLRRI+ Y   KEAYLV G+PG ED+RLA+AL++PI
Sbjct  573   VFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEAYLVMGLPGAEDQRLAVALDLPI  632

Query  538   LGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVL  597
             LG  P  ALPL+T+SGGKR  +RADVNVPTGTY++YDE EL  +LAKL V+H+EQ  W+L
Sbjct  633   LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDEHELFAALAKLAVAHMEQPKWLL  692

Query  598   KIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELER--TLGN  655
             K+DYDP   G A++D+S M A+RE+RREKR+PEYWRQPG RD AA++++AELER   L  
Sbjct  693   KLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLAR  752

Query  656   LVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVG-------------HVRANLFVEPS  702
             L TP+H E++P+W+D+ +AI  FG V+EA P A +              +VRANLFV P 
Sbjct  753   LATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYPD  812

Query  703   GEVHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAED  762
             G+  ++S+   L                 K+V + FPQTAAP+EA++GA  A GKLL E 
Sbjct  813   GKNVLASSGGGL---------------NRKTVAFTFPQTAAPHEAVQGACDATGKLLVET  857

Query  763   NVFGYASIDFLVFQEDKSH-TARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYL  821
             +V+GY S+DF+VFQ++K+  + RLWA+A+ P+LTDSAA+F  FHLL RGA    +    +
Sbjct  858   SVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMV  917

Query  822   PAATVTsaslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHP  881
              A              +   +    AADL+L EA+   L      GA   +VV  Y+FHP
Sbjct  918   NA--------------NPGRSGSGGAADLLLREAS---LTKAALAGAPRCFVVCSYVFHP  960

Query  882   NVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRT  941
             +V+TMQYSAFFH CRLHGVCFDVER +G++FLLADSLTAGVFG++   +T  GAL FLRT
Sbjct  961   HVTTMQYSAFFHACRLHGVCFDVERTLGTLFLLADSLTAGVFGILSVGETTEGALAFLRT  1020

Query  942   ALEVVGREVGTQALTDEFTSGGEAET--GNFADVLAAIRALT-GGKSAKLEKIRRLRR  996
             ALEV+GREVG    T E  +     T  GNFA VL+A+RA T GGK  +L K+RRLRR
Sbjct  1021  ALEVIGREVGA---TIEMATSRPVSTRNGNFAQVLSAVRASTGGGKGDRLGKMRRLRR  1075

>PHALS_06477
Length=1166

 Score = 950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/1025 (49%), Positives = 673/1025 (66%), Gaps = 84/1025 (8%)

Query  3     QHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFV------NSHG  56
             QH RLLP VNK DPS PTP+L E+DA  G+L+LV RGFLP   DLT AF       N  G
Sbjct  190   QHYRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSG  249

Query  57    GIIQNHK-TRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAA  115
             G    H+ T IYDR ++  R  P     GFN+A LKFD            S +PS     
Sbjct  250   GCALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRT---------SSTPS-----  295

Query  116   LAVVNGSQLDHDSAETRARGPN-----VLTVSFQGDARRGNFHATVRSAQQQHSGIRH--  168
                 +  + +H SA   A  PN     ++     G A+R +    V + + Q+  I +  
Sbjct  296   ----SAPKPNH-SATVSASMPNTKFSSIMQTVSSGPAKRNSL--VVAAPRNQNEDIENNC  348

Query  169   -HASANQEAE--SPETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFI  225
              H+  +QE E  S ++++ +D  +        +  +L  NV KIR YN+L+D YSLHQ +
Sbjct  349   THSFEDQEDEEGSDDSDIIKDEGF--------STKDLAVNVAKIREYNDLVDAYSLHQIL  400

Query  226   IHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAME  285
             I+KGRA+R+TPEF SF+RV  ++WGSV+EV++ALEA+L +YFVPLA+VDGQRL+ +A+  
Sbjct  401   IYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIALASTN  460

Query  286   MASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFR  345
                +S+R+LLSCIVN++QV S++RRPGQRY G+DRK RAA TIQ   RMW    +Y + R
Sbjct  461   QPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRYVKSR  520

Query  346   HHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIH  405
                 + + IQ  +R Y+    LK R++  R ++ A+WEA+M   K  W +I   RR+V+H
Sbjct  521   SSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRRIVVH  580

Query  406   VPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNVDI-VYVSPFELTTDVVQYSMKLL  463
             VPS S+ E  RL+A+NF+V+QNLQL+R+C   +D  VD+ VYVSP+ELT DV QY  KLL
Sbjct  581   VPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYFHKLL  640

Query  464   QLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPG  523
             QL G AD   RVK V+PE A RFP HFSL++L+LYSP+CLRRI+ Y    EAYLV G+PG
Sbjct  641   QLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVMGLPG  700

Query  524   PEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLA  583
             PED+RLA+ L++PILG  P  ALPL+T+SGGKR  ++AD+NVPTGTY++YDE E+  +LA
Sbjct  701   PEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEISVALA  760

Query  584   KLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAAR  643
             KL V+HI+QS W++K+DYDP   G A++D+S+M A+RE+ REKR+PEYWRQPGTRD AA 
Sbjct  761   KLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAAN  820

Query  644   VIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVG-------HVR  694
             + + E ER   L  L TP+H ELYP+W++YA AI  FG V+EA P            ++R
Sbjct  821   LFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLR  880

Query  695   ANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTA  754
             AN+FV+P+G VH++STQ++L            G    KS  +AFPQT AP+ AI+GA  A
Sbjct  881   ANIFVDPNGTVHMTSTQNVL--------TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNA  932

Query  755   IGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALRPYLTDSAATFTTFHLLNRGALN  813
             +GK LAE NV+GY S+DF+VFQ+ KS+ A RLWA+A+ P+LT+SAATF  FHLL RG L+
Sbjct  933   VGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACFHLLTRGCLD  992

Query  814   TTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKV---GAQH  870
               SG+Y +P             + +A  +    A DL+L EA      SL K    GA  
Sbjct  993   ANSGIYRVPGT------KKLQTACTAEQSGNHDAMDLLLREA------SLTKAIFQGATR  1040

Query  871   TYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSD  930
              YVV  Y+FHPNV+  QY+ FF  CRLHGVCFDV R +G++FLLADSLTAGVFG++   +
Sbjct  1041  CYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADSLTAGVFGILSIGE  1100

Query  931   TASGALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSA-KLE  989
             TA  AL +LRTALEV+GRE G  A     +S   +  GNFADVL+ +RA TGG S+ +L 
Sbjct  1101  TAQDALSYLRTALEVIGREAG--ATKGIVSSSSRSVLGNFADVLSTVRASTGGGSSNRLG  1158

Query  990   KIRRL  994
             ++ R+
Sbjct  1159  QVHRM  1163

>H310_09212
Length=1113

 Score = 842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/1006 (44%), Positives = 635/1006 (63%), Gaps = 75/1006 (7%)

Query  6     RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64
             R+LP +N+ DP+AP P L + DA+ G+ +L+ RGFLP   D+T AF  +HG  +IQN + 
Sbjct  163   RILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAF--THGTSVIQNTRV  220

Query  65    RIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVNGSQL  124
             +IYDR  QP++++P+TNPSGFN+A+LKFD+             +P+    A   +N    
Sbjct  221   KIYDRASQPVKSMPYTNPSGFNMASLKFDMV------------TPTPPTVANVPINQG--  266

Query  125   DHDSAETRARGPNVLTVSFQGDARRG-NFHATVRSAQQQHSGIRHHASANQEAESPETNV  183
               D   ++   P  + ++F G A     F           SG +  ASA+  A   ++  
Sbjct  267   -GDIPPSKTSIPTPIDITFDGHANNAVPFRPEQPKGGNDPSG-KDCASADDGAGGNDST-  323

Query  184   dedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKR  243
                           ++  LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF+SF+R
Sbjct  324   --------------SIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQR  369

Query  244   VAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQ  303
               +++WGSV + I+ LEA+LT Y VPLAYVDGQ+LM +AAM+  +    +LLSCI+N D+
Sbjct  370   TTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDE  429

Query  304   VGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYAS  363
             V SL+RRPGQR+KGK     AAV +Q+ +RM+  +K+  +  H       IQR++R Y  
Sbjct  430   VSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRL-KNHHGNEDAAVIQRIYRSYRC  488

Query  364   HDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFS  423
                L++R+KS R+     W+A+MQR + +W  IK  RRVV+HVPSFS +ER RL  +NFS
Sbjct  489   FSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFS  548

Query  424   VKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHA  483
             ++QNLQ++R+C + D NVDI+Y+SPFEL+ D+ +Y ++LLQLGGIADP  R++++ PE+ 
Sbjct  549   IQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENV  608

Query  484   PRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPL  543
              RFP HFSLTT+LLYSPHCL++I+R+++ K+AY+VTG  GPEDKRLA+AL +P+LGMDP 
Sbjct  609   DRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDKRLAIALQLPLLGMDPD  668

Query  544   SALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDP  603
              AL   T+SGGKR FM ADVN+P G +DIYDEDEL+ SL+KLI + I+Q+ W++KID D 
Sbjct  669   KALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADIDQTEWLIKIDADQ  728

Query  604   FSTGTALLDVSTMVALREIRREKR-----SPEYWRQPGTRDNAARVIIAEL-ERTLGNLV  657
              +TG A L+V  M ++ + R EKR     + EY++QP  RD   R + +EL E      V
Sbjct  729   SNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVLRSVYSELNESYFAANV  788

Query  658   TPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLss  717
             TP  PE+Y SW       ++ GVV+EA PS V+ HVR N+F+EPSG VH++S  D+ +  
Sbjct  789   TPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEPSGGVHITSAHDVFMCP  848

Query  718   sggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQE  777
                         +H      FPQ++ PY+AIRGAS AI   +    + GYASID++ F +
Sbjct  849   VN----------KHLPQCAVFPQSSVPYQAIRGASLAIASSMFIKGIIGYASIDYISFAD  898

Query  778   DKSHTA-----RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYL-----PAATVT  827
              K+  +     RLWAM + P LT++A +F  F  L+    N  +G  +L     P AT++
Sbjct  899   PKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLS  958

Query  828   saslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQ  887
             +A+     +              +L   + +   S+   G + TY+V +YI+HPN++T+Q
Sbjct  959   TANAPITPTQQEIAT--------ILSPPSSAAAASV--CGPERTYMVLDYIYHPNMATLQ  1008

Query  888   YSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVG  947
             ++ FF+TCRLHGV FD++R +G+ ++LADSLTAGV GL+C  ++   A    R A+E++G
Sbjct  1009  FATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLICIGESDKEAFRIARQAVELIG  1068

Query  948   REVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSAKLEKIRR  993
              +VG QAL +  +  GE   GNF  +LA +R  +   +A   + RR
Sbjct  1069  DQVGVQALPNSLS--GE-RLGNFPHLLAIVRNKSDDPAAADRRKRR  1111

>H257_06305
Length=1099

 Score = 840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/986 (45%), Positives = 623/986 (63%), Gaps = 76/986 (8%)

Query  6     RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64
             RLLP +N+ DP+AP+P+L E+DA+ G+ +LV RGFLP   D+T AF  +HG  +IQN + 
Sbjct  160   RLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF--THGTSVIQNSRV  217

Query  65    RIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVNGSQL  124
             +IYDR  QP++++P+TNPSGFN+A+LKFD++ T        + +PS      AVV+G  +
Sbjct  218   KIYDRASQPVKSMPYTNPSGFNMASLKFDMSTTP------ATSTPS---PVAAVVSGGDV  268

Query  125   DHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPETNVd  184
                           + +SF   +   + H  V   +   +G              +TN  
Sbjct  269   SKMVVTP-------IDISFDAPS---SSHPPVEQPKGGATG------------GDDTN--  304

Query  185   edlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRV  244
                       D++ +  LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF+SF+R 
Sbjct  305   --------GGDSSTIHNLRRNVEKIRGYNELLDTYSLHQFIIRKGKTLSDTPEFISFQRT  356

Query  245   AQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQV  304
              +++WGSV   I+ LE +LT Y VPLAYVDGQ+LM +AAM+  +    +LLSCI+N D+V
Sbjct  357   TEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMDATTRGTTELLSCILNMDEV  416

Query  305   GSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASH  364
              SL+RRPGQRYKG      A V IQ+ +RM+  +K+  +  H       IQR++R Y   
Sbjct  417   SSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRL-KNHHGNEDAAVIQRIYRSYRCF  475

Query  365   DDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSV  424
               L++R+K  R+     W+A+MQR + +W  +K  RRVV+HVPSF+ D+R RL  DNFS+
Sbjct  476   SQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVHVPSFASDDRTRLKMDNFSI  535

Query  425   KQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAP  484
             +QNLQ++R+C + D NVDI+Y+SPFEL+ D+ +Y ++LLQLGGI DP  R++++ PE+  
Sbjct  536   RQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQLGGITDPQTRIRMLHPENVD  595

Query  485   RFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLS  544
             RFP HFSLTTLLLYSPHCL++I+R+++ K AY+VTG  GPEDKRLA+AL +P+LGMDP  
Sbjct  596   RFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPEDKRLAIALQIPLLGMDPDK  655

Query  545   ALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPF  604
             AL   T+SGGKR FM ADVN+P G +DIYDEDEL+ SL+KLI + ++Q+ W++KID D  
Sbjct  656   ALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIAADVDQNEWLVKIDADQS  715

Query  605   STGTALLDVSTMVALREIRREKR-----SPEYWRQPGTRDNAARVIIAEL-ERTLGNLVT  658
              TG A ++V  M ++ ++R EKR     + EY++QP  RD   R I  EL E      +T
Sbjct  716   DTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDAVLRSIFNELTESYFAANIT  775

Query  659   PLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLsss  718
             P  P++Y SW +     ++ GVV+EA PS V+  VRAN+F+EPSG VH++S  D+ +S  
Sbjct  776   PCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFIEPSGGVHITSAHDLFMSP-  834

Query  719   ggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQED  778
                      A +H      FPQT+ PY+AIRGAS AI   +    + GYASID++ F + 
Sbjct  835   ---------ANKHLPQCALFPQTSVPYQAIRGASLAIASSMFIKGIIGYASIDYMSFADP  885

Query  779   KSHTA------RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTsaslv  832
             K+         RLWAM + P LT++A +F  F  L+    N  +G  +L    V +   +
Sbjct  886   KTLVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQFNPITGKCHL---QVAAPPPI  942

Query  833   qlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFF  892
                ++ A       A + +L     +G V     G + TY+V +YI+HPN++T+ +S FF
Sbjct  943   AASATVAPITQAQKAVETILSARPPNGAVV---CGPERTYMVLDYIYHPNMATLHFSTFF  999

Query  893   HTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGT  952
             +TCRL+GV FD++R +G+ F+LADSLTAGV GLMC  +    A    R A+E++G +VG 
Sbjct  1000  NTCRLNGVSFDLQRAIGAAFILADSLTAGVMGLMCIGENDKEAFRIARQAVELIGDQVGV  1059

Query  953   QALTDEFTSGGEAETGNFADVLAAIR  978
             QAL D  +  GE   GNF  +LA +R
Sbjct  1060  QALPDSLS--GE-RLGNFPHLLAIVR  1082

>SDRG_01764
Length=1092

 Score = 830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/987 (43%), Positives = 608/987 (62%), Gaps = 85/987 (9%)

Query  6     RLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHG-GIIQNHKT  64
             RLLP VN+ DP AP P+L + DAK G+L+LVNRGF+P   DL+ AF  +HG GIIQN K 
Sbjct  162   RLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAF--THGDGIIQNSKL  219

Query  65    RIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAVVNGSQL  124
             R+YDR EQP+++ P+ N S FN+A+LK DLA      +             LAV      
Sbjct  220   RLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPD-------PTPLTRLAV------  266

Query  125   DHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAESPETNVd  184
                 A  +      + ++F G    G+                         E P T+  
Sbjct  267   ----ARNKKSAVATVQLTFPGAKDEGDV---------------------VPVEDPTTDDG  301

Query  185   edlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRV  244
                  D  D+  N ++++R       GYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+
Sbjct  302   PIEPTDTIDELRNNVEKIR-------GYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRI  354

Query  245   AQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQV  304
              +++WGSV   I+ LE LL  Y VPLAY+DGQ+L+ +AAM+  S SK +LL+C++N D+V
Sbjct  355   TEDLWGSVSMAIRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEV  414

Query  305   GSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVA--IQRVWRVYA  362
              + + RPGQR+KG+D +  AA+ +Q+ +RM   ++   R R H     A  IQRV+R Y 
Sbjct  415   TTFMARPGQRFKGEDSRHAAAILLQSVYRMHLTRR---RLRQHHGHSYASHIQRVYRTYK  471

Query  363   SHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNF  422
             S  +++ +++  R+     WE +M     +W +IK  RRVV+HVPSFS +ER RL+ DNF
Sbjct  472   SVKEIQVKLRLAREADARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNF  531

Query  423   SVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEH  482
             +++QNLQ++RLC + D NVD++Y+SPFEL+ D+ +Y M+LLQLGG+ADP +RV+++ PE+
Sbjct  532   AIRQNLQMARLCAIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPEN  591

Query  483   APRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDP  542
             A RFP HFSL T+LLYSPHCL++I+RY++ KEAY+V G  GPEDKRLA+ L +P+LGMDP
Sbjct  592   AERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDP  651

Query  543   LSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYD  602
               AL   T+SG KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K+D D
Sbjct  652   DRALLYGTRSGAKRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDAD  711

Query  603   PFSTGTALLDVSTMVALREIRREKRS---PEYWRQPGTRDNAARVIIAELERTLGNLVTP  659
             P  TG A +D+  +  + ++R EKR+    EY+ QP  ++   R I+AEL      L++P
Sbjct  712   PSDTGLASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISP  771

Query  660   LHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLsssg  719
               P++YP+WQ     + + G V+EA P  V+  VRAN+F+EPSG VH++S Q+ L+ +  
Sbjct  772   CFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLMQAKN  831

Query  720   gcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDK  779
                       +H+SVG  +P T  PY AIRGAS A+ + +    + GYASID++ F + K
Sbjct  832   ----------KHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVK  881

Query  780   SHTA-------RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTsaslv  832
             +          RLWA+ L P LT +A +F  F  L+   L+  +G  +LP          
Sbjct  882   TVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPA----PHP  937

Query  833   qlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFF  892
                +          A + +L E+  S       VG +  Y+  EYIFHPN++T+QY+ FF
Sbjct  938   SPATGQLPVTETQLAVEKILSESPRSS-----NVGPERAYIAHEYIFHPNMATLQYAVFF  992

Query  893   HTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGT  952
             + CR+HGV FD+++ +G+ F+LADSLTAGV GL+C  ++   A+   R ALE++G +VG 
Sbjct  993   NMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGV  1052

Query  953   QALTDEFTSGGEAETGNFADVLAAIRA  979
             Q   D  T  GE   GNFA VL AIR+
Sbjct  1053  QPAPDALT--GE-RLGNFAAVLGAIRS  1076

>PHYCA_34475
Length=692

 Score = 818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/740 (56%), Positives = 531/740 (72%), Gaps = 68/740 (9%)

Query  210  RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVP  269
            RGYNELLD YSLHQF+IHKGR MR+TPEF+SF RVAQE+WGSV+E ++ALE LLT YFVP
Sbjct  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  270  LAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQ  329
            LAYVDGQRL+++AA     +SKR+LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  330  NFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRL  389
             F RMW  +++Y+R R    +   IQ  WR Y+ H  LK R++  R +Q  +WEA+M RL
Sbjct  121  AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  390  KRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLC-GLVDSNVD-IVYVS  447
            K  W +I  +RRVV+HVPS S+DE  RLSA+N +V+QNLQL+R+C   +DS VD +VYVS
Sbjct  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  448  PFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQ  507
            PFELTTDV QY +KLLQLGG+AD   RVKL+FPE A RFP HFSL++LLLYSPHCLRRI+
Sbjct  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  508  RYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPT  567
             Y   KEAYLV G+PG ED+RLAM L++PILG  P  ALPL+T+SGGKR  +RADVNVP 
Sbjct  301  HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  568  GTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKR  627
            GTY++YDE EL  +LAKL V+H++Q  W+ K+DYDP   G A++D+S M A+RE+RREKR
Sbjct  361  GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  628  SPEYWRQPGTRDNAARVIIAELER--TLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAA  685
            +PEYWRQPG RD AA++++ ELER  TL  L  P+H +++PSW ++A+AI  FG V+EA 
Sbjct  421  TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  686  PSAVV-------------GHVRANLFVEPSGEVHVSSTQDILLsssggcggkpggAYRHK  732
            P   +              ++RANLFV+P G VHV+ST ++L           GG    +
Sbjct  481  PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNML--------ATGGGGLNRR  532

Query  733  SVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTA-RLWAMALR  791
            +V + FPQTAAP+EA++GA +A GKLL E NV+GY S+DF+VFQ+DKS+ A RLWA+A+ 
Sbjct  533  TVAFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLWALAVH  592

Query  792  PYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLV  851
            P+LTDSAA+F  FHLL RG L+  SG+Y + AA+                          
Sbjct  593  PFLTDSAASFACFHLLARGVLDANSGVYRMAAASTP------------------------  628

Query  852  LHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSV  911
                                +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++
Sbjct  629  ------------------RCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  670

Query  912  FLLADSLTAGVFGLMCCSDT  931
            FLLADSLTAGVFG++   +T
Sbjct  671  FLLADSLTAGVFGVLSIGET  690

>SPRG_06354
Length=884

 Score = 793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/930 (43%), Positives = 576/930 (62%), Gaps = 78/930 (8%)

Query  59   IQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALAV  118
            +QN K R+YDR EQP+++ P+ N SGFN+A+LK DLA             P++       
Sbjct  1    MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAP-----------PPTE-------  42

Query  119  VNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAES  178
                             P+ +  +    AR+    +TV + Q    G +         E 
Sbjct  43   -----------------PDAVPPTRPAVARKRK--STVATVQLSFPGAKDELVDAVPVED  83

Query  179  PETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF  238
            P T+       D   +  + +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF
Sbjct  84   PATD-------DGPIEPTDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLSETPEF  136

Query  239  VSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCI  298
            +SFKR+ +++WGSV   I+ LE LL  Y VPLAY+DGQ+L+ +AAM+  S SK +LL+C+
Sbjct  137  ISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCV  196

Query  299  VNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVW  358
            +N D+V + + RPGQR+KG D +  AA+ IQ+ +RM    ++  R  H  +    IQRV+
Sbjct  197  LNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMH-RTRRLLRQHHGHSYATHIQRVY  255

Query  359  RVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLS  418
            R Y    D++ +++  R+     WE +M     +W +IK  RRVV+HVPSFS +ER RL+
Sbjct  256  RTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVVVHVPSFSAEERARLN  315

Query  419  ADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLV  478
             DNF+++QNLQ++RLC + D NVD++Y+SPFEL+ D+ +Y M+LLQLGG+ADP +RV+++
Sbjct  316  MDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLLQLGGVADPHSRVRML  375

Query  479  FPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPIL  538
             PE+A RFP HFSL T+LLYSPHCL++I+RY++ KEAY+V G  GPEDKRLA+ L +P+L
Sbjct  376  HPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLL  435

Query  539  GMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLK  598
            GMDP  AL   T+SG KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K
Sbjct  436  GMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLAKLTAANLHQGMWLIK  495

Query  599  IDYDPFSTGTALLDVSTMVALREIRREKRS---PEYWRQPGTRDNAARVIIAELERTLGN  655
            +D DP  TG A +D+  +  + ++R EKR+    EY+ QP  ++   R I+AEL      
Sbjct  496  LDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHR  555

Query  656  LVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILL  715
            L++P  P++YP+WQ     + + G V+EA P  V+  VRAN+F+EPSG VHV+S Q+ L+
Sbjct  556  LISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHVTSAQEQLM  615

Query  716  sssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVF  775
                          +H+SVG  +P TA PY AIRGAS A+ + +    + GYASID++ F
Sbjct  616  HVKN----------KHQSVGAVYPPTAVPYAAIRGASLAVAQAMYASGIIGYASIDYVAF  665

Query  776  QEDKSHTA-------RLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTs  828
             + K+          RLWA+ L P LT +A +F  F  L+   L+  +G  +LP      
Sbjct  666  LDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLPA---  722

Query  829  aslvqlqsssaafasgasaaDLVLHEATHSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQY  888
                    +         A + +L E++ +       +GA+  Y+  EYIFHPN++T+QY
Sbjct  723  --PRPSSLAGPPATETQLAVEKILGESSPAA-----TMGAERAYIAHEYIFHPNMATLQY  775

Query  889  SAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGR  948
            + FF+ CR+HGV FD+++ +G+ F+LADSLTAGV GL+C  ++   A+   R ALE++G 
Sbjct  776  AVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGD  835

Query  949  EVGTQALTDEFTSGGEAETGNFADVLAAIR  978
            +VG Q   D  T  GE   GNFA VL AIR
Sbjct  836  QVGVQPAPDALT--GE-RLGNFAAVLGAIR  862

>CCA18898
Length=1147

 Score = 669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/764 (44%), Positives = 498/764 (65%), Gaps = 20/764 (3%)

Query  201   ELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALE  260
             ++  + E  +G N      S H F IH+G   R   +F SF+  A +VW +V+EV+  LE
Sbjct  362   KINTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLE  416

Query  261   ALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDR  320
              LL+ YF+P+A+++GQR++T++       + RDLLSC+ NE +V  L+ +PGQR++G ++
Sbjct  417   RLLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEK  476

Query  321   KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
               RAA+ +Q+F RM   ++ Y     +   V AIQ+ WR YA++   K +I++ R++Q  
Sbjct  477   CTRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDI  536

Query  381   QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSN  440
              +   M+    +W +I+  RR V+H+PS S+D R R+  + FS++QNLQL RLC L+D N
Sbjct  537   VFNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDEN  596

Query  441   VDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSP  500
             V+++Y+ PFELT D+VQY MKLLQL GI+D  AR+KL+ PE+A RFP+HFSL+ ++L SP
Sbjct  597   VELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSP  656

Query  501   HCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMR  560
             H ++R+ RYI+ + AYLV G PG EDKRLA  L +PILG+DP     + T SG KR F +
Sbjct  657   HTMKRLSRYIRGRNAYLVPGFPGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKK  716

Query  561   ADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALR  620
              + N   G+ D+YDE+EL+FSLAKLI ++  QS  VLK+DYDPF TGTAL+D+S + +++
Sbjct  717   TNANTLPGSIDLYDENELIFSLAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQ  776

Query  621   EIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPSWQDYADAIVQFGV  680
              +R   R+ +YWRQP  ++   R I+ E++  + +LV  ++PE+YPSW+ +  AI  +GV
Sbjct  777   VLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGV  836

Query  681   VVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDILLss--------sggcggkpggAYRHK  732
             V+E  P    G+VRANLF+EPS  V +SSTQ+ L           +         A + +
Sbjct  837   VIEVCPKNRQGYVRANLFIEPSRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMR  896

Query  733   SVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYASIDFLVFQEDKSHTARLWAMALRP  792
             ++G+ FPQT   +E ++ AS  IG+ LA+D + GY S+DFLV  +D++    L+AMAL+P
Sbjct  897   TIGFTFPQTLIDHEVLKSASLVIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQP  956

Query  793   YLTDSAATFTTFHLLNR-GALNTTSGLYYLPAATVTsaslvqlqsssaafasgasaaDLV  851
             +LT+SAA+F+ F  L+R G  N+ +GL++LP A  +        +S    +S  SA DL+
Sbjct  957   FLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITS-----HGVTSDTPSSSSLSATDLM  1011

Query  852   LHEATHSGLVSLE-KVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGS  910
             + EA  SG+VS E  +    +YV+ EY+ +PNV+T+ Y +FF  CR  GV FD+ER +G+
Sbjct  1012  IREARLSGIVSNELPLTPTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGT  1071

Query  911   VFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQA  954
             VFLLADSLTAGV G+MC SDT   AL   R A+E +    GT++
Sbjct  1072  VFLLADSLTAGVLGIMCISDTRKNALLSCRAAMEAIAASAGTKS  1115

 Score = 34.3 bits (77),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 23/89 (26%), Positives = 45/89 (51%), Gaps = 3/89 (3%)

Query  8    LPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQNHKTRIY  67
            LP+V     S  +  L++Q ++     L +R   P+ +   S   +++   +     +++
Sbjct  206  LPAVQNGHASTSSSALADQSSETAHF-LNSRHGSPLNSIEISQ--STYDRALMQRTAQLH  262

Query  68   DRQEQPIRAVPHTNPSGFNIATLKFDLAA  96
            +R E+PIR  P T+    +I +LKFD +A
Sbjct  263  NRLEEPIRTTPCTSTISHDITSLKFDFSA  291

>CCI45122
Length=1105

 Score = 668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/915 (38%), Positives = 536/915 (59%), Gaps = 56/915 (6%)

Query  58    IIQNHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLAATAECREGDGSDSPSQHKAALA  117
             ++      +++R E+PI+  P+T     N+ ++KFD            S SP        
Sbjct  213   VLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFDFMTPT-------SQSPC-------  258

Query  118   VVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQEAE  177
                         + + +   VLT   Q   R G   A  + +     G R   S      
Sbjct  259   -----------GKMQTQEKIVLTNDLQSKQRNGALLAN-QISLSPGGGCREDDSRFSPGR  306

Query  178   SPETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPE  237
              P   +               ++++ K++       E+  TY    F+IH+G   R+ PE
Sbjct  307   DPSKKIGIIKAITPIF-----LNDVTKSL-----VGEISKTYD---FVIHQGIIDRKRPE  353

Query  238   FVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSC  297
             F +F+R+A  +W SVD V++AL  +L+ YF+P+AY++GQR++T+A  +    + +DL+SC
Sbjct  354   FEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTLAQADNVPLTTKDLISC  413

Query  298   IVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRV  357
             I NED+V  L+ +PGQR++G +R +RA + +Q+F RM  ++K++   R+    V AIQR 
Sbjct  414   IRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRFLVMRYKYWKVTAIQRN  473

Query  358   WRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRL  417
             WR +++H   K +I+++R+ Q   +   M+    +W +I+  RR +IH+PS S+D R R+
Sbjct  474   WRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRRTIIHIPSISIDSRQRM  533

Query  418   SADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKL  477
               + FS++QNLQL RLC ++D NV+++Y+ PFELT D+VQY MKLLQLGGI+D  AR+KL
Sbjct  534   KTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYMKLLQLGGISDAAARIKL  593

Query  478   VFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPI  537
             + PE+A RFP+HFSL++++LYSP  L R+ R I+ + AY+V G PG EDKR+A  L VPI
Sbjct  594   ICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPGFPGLEDKRVATILGVPI  653

Query  538   LGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVL  597
             LG+D   +L   T SG KR+F +A+VN      D+YDE+EL+FSLAKL+ SH  Q   VL
Sbjct  654   LGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIFSLAKLVASHPHQLSVVL  713

Query  598   KIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLV  657
             ++DYDPF TG AL+D+S + +++E+R   ++ E W QP  +    R ++ E++  + + +
Sbjct  714   RLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFI  773

Query  658   TPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPSGEVHVSSTQDI----  713
               +HPE++PS + +  AI  +GV++E +P    GHVRANLF+EPS  V VSST +I    
Sbjct  774   FVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLE  833

Query  714   ----LLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVFGYAS  769
                 +       G     A + ++ G  FPQT   +E ++ AS AIG+ LA+D + GY S
Sbjct  834   TDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKDGICGYIS  893

Query  770   IDFLVFQEDKSHTARLWAMALRPYLTDSAATFTTFHLLNR-GALNTTSGLYYLPAATVTs  828
             +DF+V  +D++    L+A  L+P+LT++AA+F  F LL+R G+ N+ +G  +LP      
Sbjct  894   VDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEV---  950

Query  829   aslvqlqsssaafasgasaaDLVLHEATHSGLVS-LEKVGAQHTYVVSEYIFHPNVSTMQ  887
                  L        S  SA DL++ EA  SG+VS +       TY + EY+ +P V+T+ 
Sbjct  951   ----PLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPPTPTRTYALIEYVCNPCVATLS  1006

Query  888   YSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVG  947
              S+FF  CR  GV FD ER  G+VFLLADSLTAGVFG+MC SDT   AL   R A+E + 
Sbjct  1007  CSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIMCISDTRKNALSNCRAAMEAIA  1066

Query  948   REVGTQALTDEFTSG  962
                GT+    + + G
Sbjct  1067  GVAGTKMSVSKSSDG  1081

>PYAR_13581
Length=730

 Score = 360 bits (923),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 208/447 (47%), Positives = 256/447 (57%), Gaps = 96/447 (21%)

Query  61   NHKTRIYDRQEQPIRAVPHTNPSG-----FNIATLKFDLAATAECREGDGSDSPSQHKAA  115
            N   R+Y R+EQP+RAVP  +P        N  T+ F           DG   P Q    
Sbjct  1    NGAVRLYRREEQPVRAVPDISPRPPPPQQLNTVTISFT----------DGESPPQQST--  48

Query  116  LAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRHHASANQE  175
                       D  E     P + T                            HA    +
Sbjct  49   -----------DEPEMDESPPQLDT---------------------------EHAQHIDD  70

Query  176  AESPETNVdedlmydekdddANAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRET  235
            A++ E++             ANAMD+LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRET
Sbjct  71   ADASESD-------------ANAMDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRET  117

Query  236  PEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLL  295
            PEF SFKRV QE+WG+VDEVI+ALEALLTRYF                  MAS+    LL
Sbjct  118  PEFQSFKRVGQEIWGAVDEVIRALEALLTRYF------------------MASFPTSVLL  159

Query  296  SCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQ  355
            SC+VNEDQV SL+RRPGQRYKGKDRKRRAA T+Q FFRM +++ ++ R     AS   IQ
Sbjct  160  SCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQ  219

Query  356  RVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERL  415
              WR +A+   L+R +  +R +Q   W+ +M RL+  W  I   RRVV+HVPS S+DE  
Sbjct  220  TTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHA  279

Query  416  RLSADNFSVKQNLQLSRLCGLVDSNVD-IVYVSPFELTTDVVQYSMKLLQLGGIADPVAR  474
            R+S D+F+V+QNLQL+RL  +VD+ V+ +VYVSPFEL TD+           G+A+   R
Sbjct  280  RVSLDHFAVQQNLQLARLAAVVDATVEYVVYVSPFELPTDLSH---------GVANAAHR  330

Query  475  VKLVFPEHAPRFPTHFSLTTLLLYSPH  501
            VK+V PEHA  FP HFSL T LLYSPH
Sbjct  331  VKIVVPEHAATFPGHFSLATQLLYSPH  357

 Score = 190 bits (483),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 133/384 (35%), Positives = 175/384 (46%), Gaps = 104/384 (27%)

Query  608  TALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPS  667
            TALLDVS +  LREIRR  + P YW+QPG RD  AR ++ ELER +G L  P H E +P 
Sbjct  388  TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447

Query  668  WQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPS-----GEVHVSSTQDILLsssggcg  722
            W+ +A AI + GVV+EA P+ V G VR N+FV P+      +V V STQ+ L        
Sbjct  448  WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL--------  499

Query  723  gkpggAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVF-GYASIDFLVFQEDKSH  781
                 +     + +A PQT  P++A+ GA+ AIG+LL ED  F GYAS+D  + +++   
Sbjct  500  ---RASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE---  553

Query  782  TARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATVTsaslvqlqsssaaf  841
                                             TSGLY LP+  V               
Sbjct  554  ---------------------------------TSGLYLLPSPAVD------------TS  568

Query  842  asgasaaDLVLHEA---THSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRLH  898
            A  + A  LVL EA     S         +   +V  ++  HPN+ TM  +AFF  CR  
Sbjct  569  APLSPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTAAFFLACRRR  628

Query  899  GVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTDE  958
            GVCFDV R                            A+ +LRTA EV+ REVG       
Sbjct  629  GVCFDVTR---------------------------RAMQYLRTAFEVLAREVG-------  654

Query  959  FTSGGEAETGNFADVLAAIRALTG  982
              S   +  GNF DVLA +R   G
Sbjct  655  --SSTPSSDGNFGDVLALLRHRVG  676

>PHYKE_8394
Length=428

 Score = 273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 179/259 (69%), Gaps = 37/259 (14%)

Query  383  EAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGL-VDSNV  441
            +A+M+ L  +  +I+G             +E L    +NF+V+QNLQL+R+C   +DSNV
Sbjct  153  DAEMEELGANVDKIRG------------YNELLDAYTENFAVQQNLQLTRICAAALDSNV  200

Query  442  DI-VYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSP  500
            D+ VYVSPFELT DV QY +KLLQLGG+AD   RVKLVFPE A RFPT            
Sbjct  201  DLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKLVFPEQALRFPT------------  248

Query  501  HCLRRIQRYIKNKEAYLVTGMPGPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMR  560
                        K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SGGKR  +R
Sbjct  249  -----------GKDAYLVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIR  297

Query  561  ADVNVPTGTYDIYDEDELVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALR  620
            ADVNVPTGTY++YD+ EL  +LAKL V+H++Q  W+LK+DYDP   G A++D+S M A+R
Sbjct  298  ADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLLKLDYDPLGVGEAIIDLSGMQAMR  357

Query  621  EIRREKRSPEYWRQPGTRD  639
            E+RREKR+PEYWRQPG RD
Sbjct  358  ELRREKRAPEYWRQPGPRD  376

 Score = 39.3 bits (90),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 9/45 (20%)

Query  705  VHVSSTQDILLsssggcggkpggAYRHKSVGYAFPQTAAPYEAIR  749
            VHV+STQ++L           G     K+V Y FPQTAAP+EA++
Sbjct  390  VHVTSTQNVL---------ASGSGLNRKTVAYTFPQTAAPHEAVK  425

 Score = 38.5 bits (88),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)

Query  199  MDELRKNVEKIRGYNELLDTYS  220
            M+EL  NV+KIRGYNELLD Y+
Sbjct  156  MEELGANVDKIRGYNELLDAYT  177

>PHYKE_8470
Length=1669

 Score = 38.1 bits (87),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 19/114 (17%)

Query  319  DRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQ  378
            D   ++A+ +Q  +R   ++KKY+RFR    +VV IQ   ++    D   R++ S+R +Q
Sbjct  631  DAVEKSAIRVQAAYRKHLSEKKYARFR---GAVVKIQCTLKMRKQVDKY-RKLLSERKEQ  686

Query  379  HAQWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSR  432
             A  E ++  LK    R++  +R            R+ + A+N S++Q L   R
Sbjct  687  DA-METEVDLLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVR  725

>PHYSO_489296
Length=1098

 Score = 38.1 bits (87),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 39/164 (24%), Positives = 76/164 (46%), Gaps = 12/164 (7%)

Query  284  MEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAVTIQNFFRMWWNQK  339
            ME+    ++D ++  +     G L R+  QR K K   RR    +A  IQ  FR +  +K
Sbjct  606  MELMELRRQDRMASHIGSIARGILARKFIQREKRKRYHRRVLEPSAARIQRVFRGYIVRK  665

Query  340  KYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWI----R  395
            +    R  + + + +Q++WR  ++   +K +++  R      WEA   +++R ++    R
Sbjct  666  RLEDTRDQIEAAITLQQMWRSRSTVKTIKEKLRGFR---LMLWEAAAGKIQRCYLCYRAR  722

Query  396  IKGNRRVVIHVPSFSVDERLRLSA-DNFSVKQNLQLSRLCGLVD  438
             + N R + H   F        SA  ++  ++ L+  R C L++
Sbjct  723  QELNFRRLTHQACFGKAALAVQSAWRSYCSRKQLKEFRFCSLIE  766

>PHYCA_7562
Length=1246

 Score = 37.7 bits (86),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 58/112 (52%), Gaps = 19/112 (17%)

Query  321  KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
            K ++A+ +Q  +R + N+KKY++FR+   +V+ IQ   ++         R+ S+R +Q A
Sbjct  853  KEKSAIKVQTAYRKYRNEKKYAKFRN---AVIKIQSNLKMKKQVGKY-HRLLSERKEQDA  908

Query  381  QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSR  432
              E +++ LK    R++  +R            R+ + A+N S++Q L   R
Sbjct  909  -METEVELLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVR  945

>PHYRA_84534
Length=1368

 Score = 37.4 bits (85),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 74/179 (41%), Gaps = 31/179 (17%)

Query  322  RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHD---DLKRRIKSQRDQQ  378
            R+ A+ +Q   R W  ++++ R + H   +VAIQ+ WR Y  H     L+R +   + Q 
Sbjct  801  RKYAIVLQKNVRCWLMRRRFLRKKQH---IVAIQKYWRRYVVHKRYLTLRRGVVVLQAQA  857

Query  379  HAQWEAKMQR-LKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLV  437
                  KM R LK D+  ++      +H       ER R       +K+   + RL G  
Sbjct  858  RGVSARKMYRVLKFDYCIVRFQAYCRMHT------ERQRY------LKKLAAVRRLQGFF  905

Query  438  D-SNVDIVYVSPFE-------LTTDVVQYSMKL----LQLGGIADPVARVKLVFPEHAP  484
              S + +V++   E       L + V Q  MKL    +  G    P  + + + P   P
Sbjct  906  RFSLLRLVFLRKMEKEKAYKALGSKVAQLQMKLDRKQVHTGMKMSPSGKTRSLSPSDVP  964

>HYAP_00989
Length=1330

 Score = 37.4 bits (85),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 0/50 (0%)

Query  320  RKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKR  369
            RKRR+ V IQ  +R W   ++Y R      +VV +Q   R YA+   +KR
Sbjct  844  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKR  893

>HYAP_12850
Length=978

 Score = 37.0 bits (84),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 0/50 (0%)

Query  320  RKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKR  369
            RKRR+ V IQ  +R W   ++Y R      +VV +Q   R YA+   +KR
Sbjct  492  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKR  541

>PITG_13319
Length=1297

 Score = 37.0 bits (84),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 57/112 (51%), Gaps = 19/112 (17%)

Query  321  KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
            K ++A+ +Q  +R + ++KKY +FR    +V+ IQ   ++       +R + S+R +Q A
Sbjct  908  KEKSAIKVQTAYRKYLSEKKYVKFR---GAVIKIQSTLKMKKQVGKYQRLL-SERKEQDA  963

Query  381  QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSR  432
              E +++ LK    R++  +R            R+ + A+N S++Q L   R
Sbjct  964  -METEVELLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVR  1000

>PPTG_16825
Length=1303

 Score = 36.6 bits (83),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 19/123 (15%)

Query  321   KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
             K ++A+ +Q  +R   ++KKY++FR+   +V+ IQ   ++       +R + S+R +Q A
Sbjct  908   KEKSAIKVQTAYRKHLSEKKYAKFRN---AVIKIQSNLKMKKQVGKYQRLL-SERKEQDA  963

Query  381   QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSN  440
               E +++ LK    R++  +R            R+ + A+N S++Q L   R   +  +N
Sbjct  964   -METEVELLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVRNSSVPSAN  1008

Query  441   VDI  443
               I
Sbjct  1009  SSI  1011

>PYIR_20202
Length=1555

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 47/99 (47%), Gaps = 16/99 (16%)

Query  269   PLAYVDGQRLMTV--AAMEMASYSKRDLL----SCIVNEDQVGSLIRRPGQRYKGKDRKR  322
             PL Y  G+ L+      ME     K D +    +CI  +  V   I R     +   RK 
Sbjct  1316  PLEYQMGKTLIYFKNGVMEELEAMKSDFMYYEATCI--QKIVLGFIER-----RRLHRKI  1368

Query  323   RAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVY  361
              AA+ IQ+  RM   +K+Y RF+ H  ++V IQR W+ Y
Sbjct  1369  TAAIKIQSVLRMALERKEY-RFQRH--AIVNIQRGWKRY  1404

>PPTG_16221
Length=1259

 Score = 36.2 bits (82),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 70/176 (40%), Gaps = 25/176 (14%)

Query  322  RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHD---DLKRRIKSQRDQQ  378
            R+ A+ +Q   R W  +++Y R +     +V IQ+ WR Y  H     L+R +   + Q 
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQQ---IVVIQKYWRRYVVHKRYLTLRRGVVLLQAQA  754

Query  379  HAQWEAKMQR-LKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQ-----NLQLSR  432
                  KM R LK D+  ++      +H       ER R      +V++        L R
Sbjct  755  RGVAARKMYRVLKFDYCIVRFQAYCRMHT------ERQRYLKKLAAVRRLQGFFRFSLLR  808

Query  433  LCGLVDSNVDIVYVSPFELTTDVVQYSMKL----LQLGGIADPVARVKLVFPEHAP  484
            L  L     +  Y    EL + V Q  MKL    +  G    P A+ + + P   P
Sbjct  809  LVFLRKMEKEKAYK---ELGSKVAQLQMKLDRKQVHTGAKMSPSAKNRSLSPSDVP  861

>H310_09171
Length=1597

 Score = 35.8 bits (81),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query  313  QRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWR  359
            Q+ + +   R AAV +Q  +R W  + K  + R HLA+ + +QR WR
Sbjct  846  QQVRRQTATRTAAVLLQARYRGWVGRHKVRQLRQHLAA-ICVQRWWR  891

>H310_02709
Length=1390

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 7/79 (9%)

Query  317  GKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRD  376
            GK R +RA   IQ+  +M   QK Y R RH   +V+ IQ + R + +     R +   ++
Sbjct  815  GKRRTKRA-TQIQSVVKMHRAQKAYGRIRH---AVLKIQCLVRGFIAKKTYARMLVQAKE  870

Query  377  QQHAQWEAKMQRLKRDWIR  395
            +  A+ E ++QRLK D +R
Sbjct  871  E--AKLENQIQRLK-DRLR  886

>PYIW_19872
Length=998

 Score = 35.4 bits (80),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 97/223 (43%), Gaps = 63/223 (28%)

Query  245  AQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVAAMEM------ASYSKRDLLSCI  298
            A+   GS +E+ K +E LL+    P   +  +R++ +A+          S  K DLL  I
Sbjct  785  AEGTLGSGEELQKQIEKLLSANEDPSDQISAKRVVKIASESTLLFHSAESVEKLDLLLEI  844

Query  299  VNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWN-------QKKYSRFRHHL---  348
                                 R+ +AA+TIQ+F RM  +       QK+    ++ L   
Sbjct  845  ---------------------RQIQAAITIQSFARMLKDRNVYLEKQKELKSLKNELVEL  883

Query  349  ---ASVVAIQRVWRVYASH-DDLKRRIKSQR---DQQHAQWEAKMQRLKRDWIRIKGNRR  401
               A++  ++++   Y+S+ D+L+ +I +++    ++HAQ E    +L+RD         
Sbjct  884  YGEANMRKVEKILNKYSSNEDELRAKIAAKKLIVREEHAQIE----QLERD---------  930

Query  402  VVIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSNVDIV  444
                + S  +     L A+  +V + L   ++C L+  N  IV
Sbjct  931  ----LKSLCLSSEGGLRAE--TVNEILSDEKICSLLQQNESIV  967

>H310_02352
Length=2193

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 3/53 (6%)

Query  309  RRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVY  361
            R+  +R++   R+  AA  IQ +FR +W ++ +  F     S VAIQR +R Y
Sbjct  827  RKQAERFR---RQFEAATVIQRYFRGYWCRQAFRIFVRRHRSAVAIQRTYRRY  876

>HYAP_03509
Length=1924

 Score = 35.4 bits (80),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 18/118 (15%)

Query  529   LAMALNVPILGMDP------------LSALPLMTKSGGKRFFMRADVNVPTGTYDIYDED  576
             +A+AL +   G+ P             + LPL  +S G RF ++ D  +P+    I +  
Sbjct  1218  IALALPISGQGVKPGGRTDRPPLQHVFAYLPL--RSYGFRFILQGDFEIPSSREAITNGS  1275

Query  577   E----LVFSLAKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPE  630
             E    LV  L  L++  + Q  W+     DP S+   L   S ++   E+    R+ E
Sbjct  1276  EWNEWLVSKLPALVMLELRQVKWLAGASCDPCSSVVDLFMPSELIDCAELTENDRASE  1333

>CCA16530
Length=1512

 Score = 35.4 bits (80),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 3/43 (7%)

Query  319   DRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVY  361
             +RK RAA+ +Q+  RM   + +Y   R    ++V+IQR WR Y
Sbjct  1303  ERKIRAAILVQSLMRMELERVEYKLQRR---AIVSIQRCWRRY  1342

>PYVX_15212
Length=1907

 Score = 35.0 bits (79),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 25/106 (24%), Positives = 47/106 (44%), Gaps = 11/106 (10%)

Query  302   DQVGSLIRRPGQRYKGKD-----RKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQR  356
             +Q+ S+I+R  + +  +      ++ R A+ +Q  +R    +KKY   +    ++  IQR
Sbjct  1135  EQMASVIQRAFRAFYARMLLVRIKRERCAMHLQRLWRAKLARKKYKGLKKEDWAIRLIQR  1194

Query  357   VWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRV  402
              WR     D  + RI      Q       +QR+ R W+  +   R+
Sbjct  1195  HWRGKMGRDSYRDRI------QKYLAAVDIQRITRGWLACRKVERI  1234

>HYAP_10791
Length=449

 Score = 34.7 bits (78),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 3/31 (10%)

Query  355  QRVWRVYASHDDL---KRRIKSQRDQQHAQW  382
            QR W++   H DL   KRR+  Q++Q HA+W
Sbjct  84   QRDWKLLKRHSDLSIYKRRVSKQQEQGHAKW  114

>PHYRA_97049
Length=845

 Score = 34.3 bits (77),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 28/151 (19%)

Query  317  GKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRD  376
             ++RK+RAA  IQ FFR   +  +  R+     + + +Q VW+ +    +   R++S++ 
Sbjct  253  AENRKQRAARRIQAFFRSIKSILQVQRYAVENHAAILLQAVWKRFVHVKEYPHRVESRKQ  312

Query  377  QQHA-----------QWEAKMQRLKRDWIRIKGNRRVVIHVPS-------FS-VDER---  414
            +              QW A M++ +R+    +    V+ H          FS +D R   
Sbjct  313  EAEMLLMAQSEGELRQWMAAMEQQQREEAIARAMVFVLAHKTKGTDYHALFSEIDLRKDD  372

Query  415  ------LRLSADNFSVKQNLQLSRLCGLVDS  439
                  LRL A +F V+ + +++R   + +S
Sbjct  373  VLDRAELRLGAKSFGVRLDRKITRAAAIYES  403

>H310_05643
Length=1316

 Score = 34.3 bits (77),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 37/82 (45%), Gaps = 21/82 (26%)

Query  322  RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQ  381
            RRA + +Q+  RMW  + K+ R R      +A+Q + + + +H               A+
Sbjct  834  RRAIIVLQSHVRMWTARNKFRRLR------LAVQFIQKAWVAH--------------RAK  873

Query  382  WEAKMQRLKRDWIRIKGNRRVV  403
            W A+ +R +  W R     RVV
Sbjct  874  WSARSER-QLAWTRRHAAARVV  894

>PHYSO_345966
Length=1304

 Score = 34.3 bits (77),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 57/112 (51%), Gaps = 19/112 (17%)

Query  321  KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
            K ++A+ +Q  +R + ++KKY+ FR+   +V+ IQ   ++         ++ S+R +Q A
Sbjct  905  KEKSAIKVQTAYRKYLSEKKYATFRN---AVIKIQSTLKMKKQVGKY-HKLLSERKEQDA  960

Query  381  QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSR  432
              E +++ LK    R++  +R            R+ + A+N S++Q L   R
Sbjct  961  -METEVELLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVR  997

>PHYRA_83913
Length=1293

 Score = 34.3 bits (77),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 57/112 (51%), Gaps = 19/112 (17%)

Query  321  KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHA  380
            K ++A+ +Q  +R +  +KKY++FR+ +  + +  ++ +    +     ++ S+R +Q A
Sbjct  893  KEKSAIKVQTAYRQYLAEKKYAKFRNAVIKMQSTLKMKKQVGKY----HKLLSERKEQDA  948

Query  381  QWEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSR  432
              E +++ LK    R++  +R            R+ + A+N S++Q L   R
Sbjct  949  -METEVELLKH---RLEDEKRA-----------RMEIEAENSSLQQELNQVR  985

>PYU1_G007827
Length=1649

 Score = 34.3 bits (77),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 8/100 (8%)

Query  276  QRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMW  335
            QR++    ME     KRD+L   V E++  + I+   + Y    R+  AAVTIQ+  R +
Sbjct  890  QRMLKDQEME----KKRDILKKRV-ENRAAACIQIGYKTYSSWKRRLSAAVTIQSAVRCF  944

Query  336  WNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQR  375
               K   RF++    VV +QR  R++  ++ +K  ++ +R
Sbjct  945  LQHK---RFQYEYCRVVQLQRNVRIWRRNNQIKAFLRFER  981

>HYAP_08623
Length=1187

 Score = 33.9 bits (76),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 22/82 (27%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query  322  RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQ  381
            R+ A+ +Q   R W  ++++ R +     +V IQ+ WR Y  H   KR +K +R     Q
Sbjct  621  RKYAIVLQKNVRCWLMRRRFLRQKQQ---IVVIQKYWRRYVIH---KRYLKLRRGVVKLQ  674

Query  382  WEAKMQRLKRDWIRIKGNRRVV  403
             +A+    ++ +  +K + R+V
Sbjct  675  AQARGVSTRKMYRVLKFDYRIV  696

>PITG_06378
Length=2137

 Score = 33.9 bits (76),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 40/90 (44%), Gaps = 6/90 (7%)

Query  276  QRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQR------YKGKDRKRRAAVTIQ  329
            +R + +A  E  +  K      +   +   S+I+R  +R      +K   R  RAAVTIQ
Sbjct  856  ERAVHLAWSEFVTLKKEKRAESLRLRNHSASIIQRNFRRHLCQVVFKETLRNHRAAVTIQ  915

Query  330  NFFRMWWNQKKYSRFRHHLASVVAIQRVWR  359
              FR +  +    R R  + +   IQ VWR
Sbjct  916  RVFRGFLGRNAAQRRRWEMYAATQIQTVWR  945

>PYAP_15202
Length=987

 Score = 33.9 bits (76),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (58%), Gaps = 2/64 (3%)

Query  303  QVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRH-HLASVVAIQRVWRVY  361
            ++G+ ++    + K K RKR AA+TIQ   R    +K+ ++ R   LA ++A+ R+W  Y
Sbjct  651  RLGTQLKLLALKEKNKLRKR-AAITIQKMVRTRQARKRVAQMRESRLAGMIALARLWVEY  709

Query  362  ASHD  365
             S D
Sbjct  710  WSED  713

>PYAP_17747
Length=134

 Score = 32.0 bits (71),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 0/37 (0%)

Query  115  ALAVVNGSQLDHDSAETRARGPNVLTVSFQGDARRGN  151
            +   VNG ++D    +TR  G    T+ F+G+ RR N
Sbjct  78   SFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHN  114

>PYAR_17383
Length=1784

 Score = 33.5 bits (75),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  320   RKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRI  371
             R +RA++ ++ F R    ++K+   +H +  + A+ R W+ + S+  L++ +
Sbjct  1025  RLKRASIVLEAFVRQCLARRKFRHLKHRIVKLQALVRQWKHHKSYKALRKAV  1076

>PHYRA_94417
Length=1934

 Score = 33.5 bits (75),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 3/43 (7%)

Query  321   KRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYAS  363
             K RAAV +Q++ RM  + K+Y   R    +++ IQR WR Y +
Sbjct  1257  KTRAAVVLQSYARMSLDYKEYHFQRR---AIIKIQRRWRRYKT  1296

>PPTG_13214
Length=2237

 Score = 33.5 bits (75),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 25/49 (51%), Gaps = 0/49 (0%)

Query  315   YKGKDRKRRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYAS  363
             +K   R  RAAVTIQ  FR +  +    R R  + +   IQ VWR Y +
Sbjct  1003  FKDTLRNHRAAVTIQRLFRGFQGRNAALRRRWEMYASTRIQTVWRRYKA  1051

Lambda      K        H        a         alpha
   0.321    0.134    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 83010371925

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40