Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIW_187889320324421810692e-148
PYU1_G001739932032661615677e-72
PYU1_G001738534612261595421e-68
PHYRA_81105534612011584496e-55
PPTG_17123147532011584497e-55
PHYCA_537323449662001594489e-55
PITG_18452147538561594602e-51
PYU1_G001740147522061584151e-49
HYAP_07096534612511594163e-49
PHYSO_353401534611461404064e-49
PYIR_25089854042621584033e-47
PYU1_G001744568762131583916e-46
PYU1_G001742932042131583907e-46
PYVX_18173449665001584036e-45
PYIW_18791854041941593773e-44
PYIR_26626147522121623784e-44
PYU1_G001741854041991583758e-44
PHYSO_536424606911971583714e-43
PHYSO_507031586531971583714e-43
PHYSO_341599109791851583671e-42
PYAP_22279854042231663682e-42
PYAP_22273932032681633713e-42
PHALS_03284309411881583601e-41
PHYRA_85631109792281583612e-41
PYAR_24096932032271633594e-41
PPTG_10635528561991583559e-41
PHYRA_84190720132061583532e-40
PYAP_22278932042891663584e-40
PPTG_10634720132081583505e-40
PHYCA_14369109792481583537e-40
PPTG_10643457052501583521e-39
PHALS_00498109791991583472e-39
PHYCA_102550457052681583522e-39
PPTG_10636109792461583492e-39
PHYKE_3446231281991583453e-39
PHYCA_102624720131951583435e-39
PHYCA_102852242061951583411e-38
PHYSO_284086147522041583383e-38
PHYKE_7718109792201583385e-38
PPTG_15264231281941603357e-38
PPTG_17366239131941603357e-38
PYIR_26546866052391613371e-37
PHYCA_129425147522041583341e-37
PHYRA_82864231281931583322e-37
PHYKE_8388568762051583253e-36
PPTG_17122147522041583202e-35
PPTG_10048213141901583182e-35
PHYKE_8389147522041583123e-34
PHYRA_81107568762021583114e-34
PHYSO_477820568762021583106e-34
PITG_18450147522031583045e-33
PHYRA_81106147522021583002e-32
PHYCA_511409568762041582983e-32
PPTG_17121568762021582922e-31
PYVX_18176568762011582844e-30
PYVX_18174854042041592802e-29
PHYSO_499978231281741352763e-29
PHYSO_501575820771741352763e-29
PHYCA_510817445761881392721e-28
PHYSO_343376532371721162712e-28
PITG_13520109791711272693e-28
PPTG_14254445761881392694e-28
PHYKE_9185445762811362685e-27
PPTG_0882086622501422622e-26
PPTG_14255469372681362599e-26
PHYSO_417649445761851392494e-25
PHYKE_839053461130952411e-24
PHYSO_262732469371881232451e-24
PHYCA_53693413059831362592e-24
PHYSO_254168462841701412432e-24
PITG_1049986623231422513e-24
PHYSO_341596528562311082376e-23
PYAP_18131991722261142351e-22
PYU1_G007476539131951322322e-22
PHYSO_527908600641741252292e-22
PHYSO_342364529831941472277e-22
PHYSO_340369526762001392287e-22
PYAP_18711943562101312261e-21
PYAP_246891014392521332272e-21
PYIR_1643542333041302232e-20
H310_0636217301971492163e-20
PYU1_G005323943552511312161e-19
PHYRA_74651699693441572191e-19
PYIW_27477823991801242092e-19
PYU1_G005324845341911312085e-19
PYU1_G005326463491911312085e-19
PYU1_G00532842331911312085e-19
PHYRA_86016727462361202097e-19
PHYRA_86752732363001412111e-18
PYIR_1644442341821362041e-18
PYU1_G005325943562071312061e-18
PHYSO_533903604652081472051e-18
PHYCA_69583463492241322061e-18
PHYSO_255056463492691232082e-18
PYVX_14662510865401282123e-18
PHYRA_83499204334731892123e-18
PYAP_18709943552351312053e-18
PPTG_04622696962731302054e-18
PHYRA_73607194343431282084e-18
PHYCA_12942213313531642076e-18
PYIW_19151831912481292036e-18
PHYRA_7914038074241202087e-18
PYAR_14260845342121312017e-18
PYU1_G01469042342951312049e-18
PHYRA_77971705552301212001e-17
PHYRA_85794726192301212001e-17
PITG_0494842342321241982e-17
PHYSO_533682604462781352003e-17
PHYRA_83500718143941202033e-17
PYU1_G007364851643161322004e-17
PHYRA_78175764333191312004e-17
PPTG_0313997753201312004e-17
PHYRA_83494464352241211965e-17
PHYRA_7358442332871301995e-17
PHYCA_534473423310501342035e-17
PYIW_1552617302561501976e-17
PPTG_07509718142991411986e-17
PPTG_0750738072991411986e-17
PHYSO_48552442342781241976e-17
PYIR_16443823992751331951e-16
PYAP_1970799579241961932e-16
PHYRA_73606571983661571972e-16
H257_1355017302661451942e-16
PPTG_0461942342761241942e-16
PYIR_19612831912601191922e-16
PHYSO_459106194342231241903e-16
PHYKE_10578778802391731913e-16
PHYKE_2809752822911241933e-16
PHYSO_34033244782951491933e-16
PHYSO_340333526712841441914e-16
PHYKE_600144782891471925e-16
PYIR_24743851643571561935e-16
PHYCA_98479819502761481906e-16
PHYCA_1961197755311261947e-16
PHYCA_13036542352661261898e-16
PHYKE_2937571983661281928e-16
PITG_0527144782781301899e-16
PITG_1193697753331311901e-15
PHYCA_12943369712871411891e-15
PHYCA_97965401872881411881e-15
PHYRA_93650463492311171861e-15
PPTG_04647194343271281891e-15
PHYRA_7358342346301241921e-15
PYAR_14256943551991351832e-15
PYIW_242891643031961181832e-15
PHYKE_391342343211241882e-15
PHYSO_48395542353201261882e-15
PHYRA_86241728921951251823e-15
PHYCA_534296526713091271863e-15
PYAP_1971299581276971853e-15
PHYCA_12727044782791521853e-15
SDRG_173181339462411341833e-15
PHYSO_533747604512061411823e-15
PYIW_242881643022011301804e-15
PHALS_0539242353671261865e-15
PHYCA_1865738072951071845e-15
SPRG_199171339462411341826e-15
SPRG_19916161733051511846e-15
PITG_0494942353371261847e-15
PHYSO_438103557212381481809e-15
PHYRA_7868968382961481829e-15
PPTG_0461842353261251839e-15
PHALS_0317644782071431781e-14
PYAR_18165995792611271801e-14
PHYKE_6002526711971181771e-14
PPTG_07521450302811481802e-14
PYIW_1879293204125971712e-14
PHYKE_2454751493741361812e-14
PHALS_03177526712591601782e-14
PITG_0494742332981311793e-14
PHALS_0539442342881251783e-14
SDRG_081291363312181421753e-14
PHYSO_324715696932741351774e-14
PYAR_206171040482541311764e-14
PHYSO_246676457051871601734e-14
SDRG_081371363342821411774e-14
PYU1_G00152797792781271775e-14
PYU1_G00152397762781271775e-14
PPTG_0462042333421311785e-14
PHYRA_78174188562791381775e-14
PYIR_23585845342401331756e-14
PHYKE_574938073001431776e-14
PYAP_1871342341841321717e-14
PYAP_23672100905257991747e-14
PHYKE_1913732362801351757e-14
PHYCA_531163194343141571768e-14
PYVX_20789539132901301758e-14
PYIR_16375823732621191749e-14
PHALS_03179308833721421761e-13
PHYKE_6077188563221051751e-13
PHYSO_484051571982851341741e-13
SDRG_0878217304501511762e-13
PYAP_22257100361247761712e-13
SPRG_2216117303001511732e-13
SPRG_077951259793351281732e-13
PHYSO_374518539131161011632e-13
PYU1_G00152697803341271732e-13
PHYRA_78176597733121301723e-13
SDRG_075651244122781411713e-13
PHYRA_7358242353261261723e-13
PHYRA_78161375713731441733e-13
PYIR_14463819503691191723e-13
PPTG_1422144782751491704e-13
PHYCA_132255434681281011624e-13
PHYCA_14368528562191581666e-13
PYVX_2129779880263961686e-13
PHYRA_84947539132651321686e-13
PYAP_24691101441145671627e-13
PHYCA_112615308831961321657e-13
PYVX_16138786195591251708e-13
SPRG_077971259813181281689e-13
PHYCA_120062539132121031659e-13
PYIW_2196497752651321661e-12
PPTG_07516464352941301671e-12
PHYSO_524101597733081301671e-12
PPTG_0752038142941301671e-12
PPTG_0625673983181241671e-12
SDRG_17317161731221061581e-12
PHYRA_73581696932931331661e-12
PYVX_20783375052761021652e-12
PHYSO_488921574612961281662e-12
H257_112651431862821461652e-12
PYIR_2048117292771301652e-12
PPTG_04803375052681271652e-12
PHYSO_329293510323101281652e-12
PHYKE_6079597733021381652e-12
PHYCA_1512473982941311652e-12
PYU1_G00586817292671291642e-12
PHYCA_6388711612941261643e-12
PYIR_2213497753001811643e-12
PHYCA_122958161732601631633e-12
PITG_0889273983091241644e-12
H257_112641259792821291634e-12
SPRG_076271258855361341654e-12
SDRG_154261258855231511654e-12
PPTG_18166242064451201645e-12
PPTG_03138188562941301625e-12
PHYKE_1029517292921601626e-12
PYU1_G001528861322741801616e-12
PHYKE_10296574615121281637e-12
PYU1_G005871944962841271617e-12
PYIW_168101650732161711587e-12
H310_054321431863011371618e-12
PHYSO_24648197753181291618e-12
PYVX_24563161732541291598e-12
PYU1_G00152597813121381618e-12
PYU1_G005872161732971271618e-12
CCA1717917291851561569e-12
PYU1_G001524930993001381609e-12
PHYCA_19598375713901241629e-12
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIW_18788

Length=244
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIW_18788                                                            416        2e-148
PYU1_G001739                                                          223        7e-72 
PYU1_G001738                                                          213        1e-68 
PHYRA_81105                                                           177        6e-55 
PPTG_17123                                                            177        7e-55 
PHYCA_537323                                                          177        9e-55 
PITG_18452                                                            181        2e-51 
PYU1_G001740                                                          164        1e-49 
HYAP_07096                                                            164        3e-49 
PHYSO_353401                                                          160        4e-49 
PYIR_25089                                                            159        3e-47 
PYU1_G001744                                                          155        6e-46 
PYU1_G001742                                                          154        7e-46 
PYVX_18173                                                            159        6e-45 
PYIW_18791                                                            149        3e-44 
PYIR_26626                                                            150        4e-44 
PYU1_G001741                                                          149        8e-44 
PHYSO_536424                                                          147        4e-43 
PHYSO_507031                                                          147        4e-43 
PHYSO_341599                                                          145        1e-42 
PYAP_22279                                                            146        2e-42 
PYAP_22273                                                            147        3e-42 
PHALS_03284                                                           143        1e-41 
PHYRA_85631                                                           143        2e-41 
PYAR_24096                                                            142        4e-41 
PPTG_10635                                                            141        9e-41 
PHYRA_84190                                                           140        2e-40 
PYAP_22278                                                            142        4e-40 
PPTG_10634                                                            139        5e-40 
PHYCA_14369                                                           140        7e-40 
PPTG_10643                                                            140        1e-39 
PHALS_00498                                                           138        2e-39 
PHYCA_102550                                                          140        2e-39 
PPTG_10636                                                            139        2e-39 
PHYKE_3446                                                            137        3e-39 
PHYCA_102624                                                          136        5e-39 
PHYCA_102852                                                          135        1e-38 
PHYSO_284086                                                          134        3e-38 
PHYKE_7718                                                            134        5e-38 
PPTG_15264                                                            133        7e-38 
PPTG_17366                                                            133        7e-38 
PYIR_26546                                                            134        1e-37 
PHYCA_129425                                                          133        1e-37 
PHYRA_82864                                                           132        2e-37 
PHYKE_8388                                                            129        3e-36 
PPTG_17122                                                            127        2e-35 
PPTG_10048                                                            127        2e-35 
PHYKE_8389                                                            124        3e-34 
PHYRA_81107                                                           124        4e-34 
PHYSO_477820                                                          124        6e-34 
PITG_18450                                                            121        5e-33 
PHYRA_81106                                                           120        2e-32 
PHYCA_511409                                                          119        3e-32 
PPTG_17121                                                            117        2e-31 
PYVX_18176                                                            114        4e-30 
PYVX_18174                                                            112        2e-29 
PHYSO_499978                                                          110        3e-29 
PHYSO_501575                                                          110        3e-29 
PHYCA_510817                                                          109        1e-28 
PHYSO_343376                                                          108        2e-28 
PITG_13520                                                            108        3e-28 
PPTG_14254                                                            108        4e-28 
PHYKE_9185                                                            107        5e-27 
PPTG_08820                                                            105        2e-26 
PPTG_14255                                                            104        9e-26 
PHYSO_417649                                                          100        4e-25 
PHYKE_8390                                                            97.4       1e-24 
PHYSO_262732                                                          99.0       1e-24 
PHYCA_536934                                                          104        2e-24 
PHYSO_254168                                                          98.2       2e-24 
PITG_10499                                                            101        3e-24 
PHYSO_341596                                                          95.9       6e-23 
PYAP_18131                                                            95.1       1e-22 
PYU1_G007476                                                          94.0       2e-22 
PHYSO_527908                                                          92.8       2e-22 
PHYSO_342364                                                          92.0       7e-22 
PHYSO_340369                                                          92.4       7e-22 
PYAP_18711                                                            91.7       1e-21 
PYAP_24689                                                            92.0       2e-21 
PYIR_16435                                                            90.5       2e-20 
H310_06362                                                            87.8       3e-20 
PYU1_G005323                                                          87.8       1e-19 
PHYRA_74651                                                           89.0       1e-19 
PYIW_27477                                                            85.1       2e-19 
PYU1_G005324                                                          84.7       5e-19 
PYU1_G005326                                                          84.7       5e-19 
PYU1_G005328                                                          84.7       5e-19 
PHYRA_86016                                                           85.1       7e-19 
PHYRA_86752                                                           85.9       1e-18 
PYIR_16444                                                            83.2       1e-18 
PYU1_G005325                                                          84.0       1e-18 
PHYSO_533903                                                          83.6       1e-18 
PHYCA_69583                                                           84.0       1e-18 
PHYSO_255056                                                          84.7       2e-18 
PYVX_14662                                                            86.3       3e-18 
PHYRA_83499                                                           86.3       3e-18 
PYAP_18709                                                            83.6       3e-18 
PPTG_04622                                                            83.6       4e-18 
PHYRA_73607                                                           84.7       4e-18 
PHYCA_12942                                                           84.3       6e-18 
PYIW_19151                                                            82.8       6e-18 
PHYRA_79140                                                           84.7       7e-18 
PYAR_14260                                                            82.0       7e-18 
PYU1_G014690                                                          83.2       9e-18 
PHYRA_77971                                                           81.6       1e-17 
PHYRA_85794                                                           81.6       1e-17 
PITG_04948                                                            80.9       2e-17 
PHYSO_533682                                                          81.6       3e-17 
PHYRA_83500                                                           82.8       3e-17 
PYU1_G007364                                                          81.6       4e-17 
PHYRA_78175                                                           81.6       4e-17 
PPTG_03139                                                            81.6       4e-17 
PHYRA_83494                                                           80.1       5e-17 
PHYRA_73584                                                           81.3       5e-17 
PHYCA_534473                                                          82.8       5e-17 
PYIW_15526                                                            80.5       6e-17 
PPTG_07509                                                            80.9       6e-17 
PPTG_07507                                                            80.9       6e-17 
PHYSO_485524                                                          80.5       6e-17 
PYIR_16443                                                            79.7       1e-16 
PYAP_19707                                                            79.0       2e-16 
PHYRA_73606                                                           80.5       2e-16 
H257_13550                                                            79.3       2e-16 
PPTG_04619                                                            79.3       2e-16 
PYIR_19612                                                            78.6       2e-16 
PHYSO_459106                                                          77.8       3e-16 
PHYKE_10578                                                           78.2       3e-16 
PHYKE_2809                                                            79.0       3e-16 
PHYSO_340332                                                          79.0       3e-16 
PHYSO_340333                                                          78.2       4e-16 
PHYKE_6001                                                            78.6       5e-16 
PYIR_24743                                                            79.0       5e-16 
PHYCA_98479                                                           77.8       6e-16 
PHYCA_19611                                                           79.3       7e-16 
PHYCA_130365                                                          77.4       8e-16 
PHYKE_2937                                                            78.6       8e-16 
PITG_05271                                                            77.4       9e-16 
PITG_11936                                                            77.8       1e-15 
PHYCA_12943                                                           77.4       1e-15 
PHYCA_97965                                                           77.0       1e-15 
PHYRA_93650                                                           76.3       1e-15 
PPTG_04647                                                            77.4       1e-15 
PHYRA_73583                                                           78.6       1e-15 
PYAR_14256                                                            75.1       2e-15 
PYIW_24289                                                            75.1       2e-15 
PHYKE_3913                                                            77.0       2e-15 
PHYSO_483955                                                          77.0       2e-15 
PHYRA_86241                                                           74.7       3e-15 
PHYCA_534296                                                          76.3       3e-15 
PYAP_19712                                                            75.9       3e-15 
PHYCA_127270                                                          75.9       3e-15 
SDRG_17318                                                            75.1       3e-15 
PHYSO_533747                                                          74.7       3e-15 
PYIW_24288                                                            73.9       4e-15 
PHALS_05392                                                           76.3       5e-15 
PHYCA_18657                                                           75.5       5e-15 
SPRG_19917                                                            74.7       6e-15 
SPRG_19916                                                            75.5       6e-15 
PITG_04949                                                            75.5       7e-15 
PHYSO_438103                                                          73.9       9e-15 
PHYRA_78689                                                           74.7       9e-15 
PPTG_04618                                                            75.1       9e-15 
PHALS_03176                                                           73.2       1e-14 
PYAR_18165                                                            73.9       1e-14 
PHYKE_6002                                                            72.8       1e-14 
PPTG_07521                                                            73.9       2e-14 
PYIW_18792                                                            70.5       2e-14 
PHYKE_2454                                                            74.3       2e-14 
PHALS_03177                                                           73.2       2e-14 
PITG_04947                                                            73.6       3e-14 
PHALS_05394                                                           73.2       3e-14 
SDRG_08129                                                            72.0       3e-14 
PHYSO_324715                                                          72.8       4e-14 
PYAR_20617                                                            72.4       4e-14 
PHYSO_246676                                                          71.2       4e-14 
SDRG_08137                                                            72.8       4e-14 
PYU1_G001527                                                          72.8       5e-14 
PYU1_G001523                                                          72.8       5e-14 
PPTG_04620                                                            73.2       5e-14 
PHYRA_78174                                                           72.8       5e-14 
PYIR_23585                                                            72.0       6e-14 
PHYKE_5749                                                            72.8       6e-14 
PYAP_18713                                                            70.5       7e-14 
PYAP_23672                                                            71.6       7e-14 
PHYKE_1913                                                            72.0       7e-14 
PHYCA_531163                                                          72.4       8e-14 
PYVX_20789                                                            72.0       8e-14 
PYIR_16375                                                            71.6       9e-14 
PHALS_03179                                                           72.4       1e-13 
PHYKE_6077                                                            72.0       1e-13 
PHYSO_484051                                                          71.6       1e-13 
SDRG_08782                                                            72.4       2e-13 
PYAP_22257                                                            70.5       2e-13 
SPRG_22161                                                            71.2       2e-13 
SPRG_07795                                                            71.2       2e-13 
PHYSO_374518                                                          67.4       2e-13 
PYU1_G001526                                                          71.2       2e-13 
PHYRA_78176                                                           70.9       3e-13 
SDRG_07565                                                            70.5       3e-13 
PHYRA_73582                                                           70.9       3e-13 
PHYRA_78161                                                           71.2       3e-13 
PYIR_14463                                                            70.9       3e-13 
PPTG_14221                                                            70.1       4e-13 
PHYCA_132255                                                          67.0       4e-13 
PHYCA_14368                                                           68.6       6e-13 
PYVX_21297                                                            69.3       6e-13 
PHYRA_84947                                                           69.3       6e-13 
PYAP_24691                                                            67.0       7e-13 
PHYCA_112615                                                          68.2       7e-13 
PYVX_16138                                                            70.1       8e-13 
SPRG_07797                                                            69.3       9e-13 
PHYCA_120062                                                          68.2       9e-13 
PYIW_21964                                                            68.6       1e-12 
PPTG_07516                                                            68.9       1e-12 
PHYSO_524101                                                          68.9       1e-12 
PPTG_07520                                                            68.9       1e-12 
PPTG_06256                                                            68.9       1e-12 
SDRG_17317                                                            65.5       1e-12 
PHYRA_73581                                                           68.6       1e-12 
PYVX_20783                                                            68.2       2e-12 
PHYSO_488921                                                          68.6       2e-12 
H257_11265                                                            68.2       2e-12 
PYIR_20481                                                            68.2       2e-12 
PPTG_04803                                                            68.2       2e-12 
PHYSO_329293                                                          68.2       2e-12 
PHYKE_6079                                                            68.2       2e-12 
PHYCA_15124                                                           68.2       2e-12 
PYU1_G005868                                                          67.8       2e-12 
PHYCA_6388                                                            67.8       3e-12 
PYIR_22134                                                            67.8       3e-12 
PHYCA_122958                                                          67.4       3e-12 
PITG_08892                                                            67.8       4e-12 
H257_11264                                                            67.4       4e-12 
SPRG_07627                                                            68.2       4e-12 
SDRG_15426                                                            68.2       4e-12 
PPTG_18166                                                            67.8       5e-12 
PPTG_03138                                                            67.0       5e-12 
PHYKE_10295                                                           67.0       6e-12 
PYU1_G001528                                                          66.6       6e-12 
PHYKE_10296                                                           67.4       7e-12 
PYU1_G005871                                                          66.6       7e-12 
PYIW_16810                                                            65.5       7e-12 
H310_05432                                                            66.6       8e-12 
PHYSO_246481                                                          66.6       8e-12 
PYVX_24563                                                            65.9       8e-12 
PYU1_G001525                                                          66.6       8e-12 
PYU1_G005872                                                          66.6       8e-12 
CCA17179                                                              64.7       9e-12 
PYU1_G001524                                                          66.2       9e-12 
PHYCA_19598                                                           67.0       9e-12 
PYU1_G001475                                                          65.9       1e-11 
PYIR_22133                                                            66.6       1e-11 
PHYKE_2379                                                            65.9       1e-11 
PYAP_18138                                                            65.5       1e-11 
PYU1_G005878                                                          61.2       1e-11 
PHYSO_489485                                                          63.5       2e-11 
HYAP_11923                                                            66.2       2e-11 
PYIR_24867                                                            65.5       2e-11 
PHALS_10635                                                           65.5       2e-11 
SPRG_07799                                                            65.9       2e-11 
PPTG_10186                                                            65.1       2e-11 
PYIR_24421                                                            64.3       2e-11 
PHYSO_426658                                                          64.3       2e-11 
SPRG_07826                                                            65.9       2e-11 
CCI47381                                                              63.9       2e-11 
PITG_11937                                                            65.1       2e-11 
PHYSO_337515                                                          65.1       3e-11 
PHYRA_84732                                                           64.7       3e-11 
PHYKE_6076                                                            64.7       3e-11 
PHYRA_77290                                                           65.1       3e-11 
PYAP_18221                                                            63.9       3e-11 
PHYCA_103479                                                          64.7       4e-11 
PHYCA_123316                                                          64.7       4e-11 
PYIW_25463                                                            63.5       4e-11 
PYIR_25999                                                            64.7       4e-11 
PHYCA_15126                                                           64.7       4e-11 
PITG_08202                                                            62.8       5e-11 
PPTG_03156                                                            64.7       5e-11 
PHYSO_375794                                                          61.2       5e-11 
SDRG_00972                                                            64.3       6e-11 
PHYSO_255975                                                          62.4       6e-11 
PHYCA_14560                                                           63.9       6e-11 
PHYCA_18729                                                           64.3       6e-11 
HYAP_01683                                                            64.3       7e-11 
PITG_20312                                                            63.5       7e-11 
PITG_20631                                                            63.5       7e-11 
SDRG_16534                                                            63.9       7e-11 
PPTG_20376                                                            62.4       8e-11 
PYU1_G005985                                                          62.4       8e-11 
PHYRA_80750                                                           63.5       9e-11 
PYIR_15187                                                            62.4       9e-11 
PHYKE_6078                                                            63.5       9e-11 
PYVX_21174                                                            59.7       1e-10 
PHYCA_562062                                                          62.8       1e-10 
SDRG_00948                                                            63.5       1e-10 
PYU1_G006405                                                          63.5       1e-10 
PYU1_G001514                                                          63.9       1e-10 
PHYKE_9023                                                            63.2       1e-10 
PYIR_16437                                                            63.2       1e-10 
PYIR_26867                                                            61.2       1e-10 
SPRG_04679                                                            62.4       1e-10 
PPTG_06249                                                            63.2       1e-10 
PPTG_03153                                                            63.2       1e-10 
PITG_21641                                                            63.2       2e-10 
SPRG_07825                                                            63.2       2e-10 
PYIR_22634                                                            62.4       2e-10 
PHYCA_19612                                                           63.5       2e-10 
H310_05438                                                            62.8       2e-10 
PHYRA_78165                                                           62.4       2e-10 
PHYSO_525076                                                          62.4       3e-10 
PHYSO_476077                                                          61.6       3e-10 
PHYSO_472009                                                          61.6       3e-10 
PPTG_04617                                                            62.8       3e-10 
PYAP_23673                                                            62.0       3e-10 
PYVX_19277                                                            62.0       3e-10 
PHYKE_7445                                                            62.4       3e-10 
PYIW_18065                                                            62.0       3e-10 
PPTG_10073                                                            60.5       3e-10 
PHYKE_3912                                                            61.2       4e-10 
PHYRA_77293                                                           61.6       4e-10 
PPTG_01148                                                            61.2       5e-10 
PHYRA_80632                                                           61.2       6e-10 
PPTG_18176                                                            60.8       6e-10 
PYU1_G005869                                                          60.8       6e-10 
PHYSO_488139                                                          60.8       6e-10 
PYIW_24287                                                            61.2       6e-10 
PHYRA_78172                                                           61.2       7e-10 
H257_11258                                                            61.2       8e-10 
PYU1_G006404                                                          60.5       9e-10 
PHYKE_2539                                                            60.1       1e-09 
PITG_01966                                                            60.5       1e-09 
PPTG_03140                                                            60.8       1e-09 
PPTG_03143                                                            60.8       1e-09 
PYIW_18794                                                            60.1       1e-09 
PYIR_25334                                                            60.1       1e-09 
PPTG_04801                                                            60.1       1e-09 
SPRG_07796                                                            60.5       1e-09 
PYU1_G001519                                                          60.1       1e-09 
PYIR_20482                                                            58.2       1e-09 
PYIR_20483                                                            60.1       1e-09 
PPTG_06253                                                            60.1       1e-09 
PHALS_06480                                                           58.2       2e-09 
PYAR_16493                                                            59.7       2e-09 
PYVX_18175                                                            57.8       2e-09 
HYAP_14170                                                            59.7       2e-09 
PYU1_G005866                                                          58.5       2e-09 
PYAP_16338                                                            59.7       2e-09 
PITG_04404                                                            58.9       2e-09 
PHALS_04411                                                           59.7       2e-09 
PYU1_G001516                                                          59.7       2e-09 
PYIW_16208                                                            59.3       2e-09 
PYU1_G005873                                                          58.9       2e-09 
PYIR_17978                                                            59.3       2e-09 
PYU1_G001520                                                          60.1       2e-09 
PHALS_02296                                                           59.3       2e-09 
PYU1_G006403                                                          58.9       2e-09 
PHYSO_256017                                                          57.4       2e-09 
SDRG_17448                                                            58.9       3e-09 
PHALS_08575                                                           59.3       3e-09 
PHYCA_10471                                                           59.3       3e-09 
PHYRA_77291                                                           58.5       3e-09 
HYAP_01682                                                            59.3       3e-09 
PPTG_00483                                                            58.5       3e-09 
PHYRA_86201                                                           58.9       3e-09 
H257_11271                                                            59.3       3e-09 
PHYRA_78177                                                           58.9       3e-09 
PPTG_01153                                                            58.9       3e-09 
PHALS_01293                                                           59.3       4e-09 
PHYSO_262844                                                          58.5       4e-09 
PHYCA_558591                                                          55.8       4e-09 
PYVX_22508                                                            58.5       4e-09 
PYIW_19601                                                            58.2       4e-09 
PYIW_18790                                                            55.1       4e-09 
PHYRA_78169                                                           58.9       5e-09 
PYAR_17163                                                            55.5       5e-09 
PHYRA_78164                                                           58.5       5e-09 
PHYKE_7717                                                            58.9       5e-09 
PHALS_02044                                                           57.8       5e-09 
PHYRA_78162                                                           58.9       5e-09 
PYAP_18226                                                            57.8       5e-09 
PHYCA_14559                                                           58.2       5e-09 
PYVX_22510                                                            58.9       5e-09 
PYAP_24338                                                            58.2       6e-09 
PPTG_03160                                                            58.5       6e-09 
PPTG_03147                                                            58.2       6e-09 
PHYSO_318683                                                          58.5       6e-09 
PHYCA_15125                                                           58.2       7e-09 
PPTG_07511                                                            56.6       7e-09 
PPTG_03148                                                            57.8       7e-09 
PYAP_18584                                                            57.0       7e-09 
PYAP_14265                                                            57.8       8e-09 
PITG_11942                                                            57.4       1e-08 
PYAR_17166                                                            54.7       1e-08 
PPTG_01152                                                            57.4       1e-08 
PYAR_15391                                                            55.8       1e-08 
PHYRA_86751                                                           55.8       1e-08 
PPTG_01147                                                            57.0       1e-08 
PHYRA_78168                                                           57.0       1e-08 
PYU1_G007242                                                          57.0       1e-08 
PYAR_14261                                                            55.1       1e-08 
PYVX_23997                                                            55.8       2e-08 
PHYCA_123476                                                          57.0       2e-08 
PHYRA_80631                                                           57.0       2e-08 
H310_05433                                                            57.0       2e-08 
PYVX_18179                                                            54.7       2e-08 
PYIW_25573                                                            56.2       2e-08 
SDRG_16535                                                            56.6       2e-08 
PYAR_25093                                                            55.5       3e-08 
PYU1_G005867                                                          55.1       3e-08 
PHYCA_12944                                                           54.3       4e-08 
PYAP_16994                                                            55.5       5e-08 
PYAR_17307                                                            55.1       5e-08 
PYAP_20456                                                            55.5       6e-08 
PHYKE_9024                                                            55.5       6e-08 
PYIR_25571                                                            55.1       6e-08 
PHYRA_79881                                                           55.1       7e-08 
PYVX_16673                                                            55.8       7e-08 
PYU1_G006672                                                          50.4       8e-08 
PYU1_G007254                                                          53.5       8e-08 
PYAP_23455                                                            55.1       8e-08 
PITG_08895                                                            53.9       9e-08 
PYIW_23030                                                            54.3       9e-08 
PYVX_24274                                                            53.9       1e-07 
PITG_01969                                                            54.3       1e-07 
PYAR_24818                                                            53.5       1e-07 
PHALS_01460                                                           54.7       1e-07 
PYIR_24935                                                            54.3       1e-07 
PYU1_G001518                                                          54.7       1e-07 
PYU1_G007250                                                          53.1       1e-07 
PYIW_20715                                                            53.9       1e-07 
PPTG_03144                                                            54.3       1e-07 
PHYKE_6066                                                            53.9       2e-07 
PHALS_05110                                                           52.8       2e-07 
PHYRA_75781                                                           53.5       2e-07 
PHYSO_525121                                                          53.1       2e-07 
PHYSO_374025                                                          53.5       2e-07 
PHYCA_19599                                                           53.9       2e-07 
PYIW_26655                                                            53.5       2e-07 
PHYRA_78626                                                           53.9       2e-07 
PPTG_03145                                                            53.5       2e-07 
PYAR_15784                                                            52.4       2e-07 
PHYSO_454780                                                          52.0       3e-07 
PYIR_23622                                                            53.1       3e-07 
PHYRA_78625                                                           53.5       3e-07 
PYIR_23689                                                            52.4       3e-07 
PHYRA_78167                                                           53.1       3e-07 
PYU1_G001517                                                          53.1       3e-07 
PYVX_21438                                                            52.8       4e-07 
PYAP_20161                                                            52.4       4e-07 
PPTG_09880                                                            52.0       4e-07 
PHYSO_318693                                                          53.1       4e-07 
PHYCA_10470                                                           52.8       5e-07 
PHALS_02041                                                           52.4       5e-07 
PHYCA_19606                                                           52.4       6e-07 
PYAP_22462                                                            51.6       6e-07 
PPTG_00482                                                            50.8       6e-07 
PYIR_20304                                                            51.2       7e-07 
PYU1_G005862                                                          50.8       8e-07 
PYAR_24113                                                            50.8       8e-07 
PITG_11944                                                            52.0       9e-07 
PHYRA_77292                                                           50.8       9e-07 
PYVX_21644                                                            50.8       9e-07 
PYVX_21643                                                            51.6       1e-06 
PYIW_21963                                                            51.6       1e-06 
PYAR_21940                                                            51.2       1e-06 
PHYSO_525490                                                          51.6       1e-06 
PHYCA_538650                                                          51.2       1e-06 
PPTG_06106                                                            51.2       1e-06 
PHYKE_6067                                                            51.2       1e-06 
PHYCA_559281                                                          49.3       1e-06 
PYAP_20077                                                            50.8       1e-06 
PITG_11957                                                            51.2       2e-06 
PHYKE_9025                                                            51.2       2e-06 
PYIW_13243                                                            50.8       2e-06 
PYAR_21271                                                            50.4       2e-06 
PPTG_03161                                                            51.2       2e-06 
PYAP_16337                                                            50.4       2e-06 
PYAP_16347                                                            49.7       2e-06 
PPTG_13879                                                            50.8       2e-06 
PYIR_22549                                                            49.7       4e-06 
PHYKE_7443                                                            50.1       4e-06 
PPTG_22744                                                            48.1       5e-06 
PHYKE_6069                                                            49.7       5e-06 
PYIW_14252                                                            49.3       5e-06 
PHYCA_552912                                                          50.1       5e-06 
PYIW_15528                                                            49.7       5e-06 
PYIR_26312                                                            47.8       5e-06 
PYAR_22058                                                            48.5       6e-06 
PHYCA_122138                                                          48.5       6e-06 
PHYCA_97699                                                           48.9       6e-06 
PITG_11951                                                            47.8       7e-06 
PHYSO_257305                                                          48.1       9e-06 
PHALS_05395                                                           47.8       9e-06 
PHYSO_341657                                                          48.1       1e-05 
PITG_11943                                                            47.0       1e-05 
PYAR_23090                                                            46.6       2e-05 
PYAR_15390                                                            47.0       2e-05 
PYVX_22511                                                            47.8       2e-05 
PYIR_22135                                                            47.8       2e-05 
PHALS_02037                                                           47.8       2e-05 

>PYIW_18788
Length=244

 Score = 416 bits (1069),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/218 (100%), Positives = 218/218 (100%), Gaps = 0/218 (0%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD
Sbjct  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86

Query  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146
            VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT
Sbjct  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146

Query  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALsdeptatteapedtseALT  206
            STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTATTEAPEDTSEALT
Sbjct  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALSDEPTATTEAPEDTSEALT  206

Query  207  TVDNAAADTTHRRPSPVSQLSSKSGVAREPIGVASGAQ  244
            TVDNAAADTTHRRPSPVSQLSSKSGVAREPIGVASGAQ
Sbjct  207  TVDNAAADTTHRRPSPVSQLSSKSGVAREPIGVASGAQ  244

>PYU1_G001739
Length=266

 Score = 223 bits (567),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 1/161 (1%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            +  + +PEPFFL+DG       +A LE+Q V TSADVAGF+KQKGYA+LRA++DDE LY+
Sbjct  24   HQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYE  83

Query  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146
            VN D++FECGYTDPTYESQPIPT G +R TGY  DGPCE+W+DD+K++S  NC   FPG 
Sbjct  84   VNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK  143

Query  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +  LDYSSCKG CTLRWY L V +     YSW++YK CV+L
Sbjct  144  TFPLDYSSCKGSCTLRWYWLGV-RYLKKRYSWQIYKECVSL  183

>PYU1_G001738
Length=226

 Score = 213 bits (542),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 1/159 (1%)

Query  29   KVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88
            KV YPEPF+L+DGD   +A VA LE+Q + TSADV+ F+KQKGYA+LRAMLDD+ LY+VN
Sbjct  24   KVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYNVN  83

Query  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148
             D++ ECGYTDPT ESQPIP       TGY+ +GPCE+W+DDLK++S  NC   +PGT+ 
Sbjct  84   PDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGTNF  143

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             LDYSSCKG C LRWY L + +    +YSW+VYK CV+L
Sbjct  144  MLDYSSCKGSCMLRWYWLGI-QPVNETYSWQVYKVCVSL  181

>PHYRA_81105
Length=201

 Score = 177 bits (449),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 1/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V +P PFF++DG      ++A L++Q V TS +  G+++Q GYASLR+MLDDE+LY V  
Sbjct  39   VLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQVTE  98

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
            ++IF+CG T P  E+Q IPTN   + +GY  DGPCE+W+DD K  +  NC  +FP    +
Sbjct  99   EAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHGQHQ  158

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS+C   C LRWY L + K   G+YSW+VYKNC+AL
Sbjct  159  IDYSACGAACMLRWYWLGI-KYVEGAYSWQVYKNCIAL  195

>PPTG_17123
Length=201

 Score = 177 bits (449),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 106/158 (67%), Gaps = 1/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V +P PFF++DG      ++A L++Q V TS +   +++Q GY SLRAMLDDE+LY V  
Sbjct  39   VLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKVTE  98

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
            ++IFECG T P  E+QPIPTN   + +GY  DGPCE+W+DD K+ S  NC  +FP    +
Sbjct  99   EAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQHE  158

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL WY L + K   G YSW+VYKNCV L
Sbjct  159  VDYSSCGKACTLSWYWLGI-KYIEGIYSWQVYKNCVGL  195

>PHYCA_537323
Length=200

 Score = 177 bits (448),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 109/159 (69%), Gaps = 3/159 (2%)

Query  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88
            V +P PFF++DG D++  A +A L++Q V TS +   +++Q GY SLRAMLDDE+LY V 
Sbjct  38   VQHPPPFFIVDGLDFQGMA-LAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVT  96

Query  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148
             ++IFECG T P  E+QPIPTN   + +GY  DGPCE+W+DD K+ +  NC  +FP    
Sbjct  97   EEAIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQH  156

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            ++DYSSC   CTL WY L + K   G YSW+VYKNCV L
Sbjct  157  QVDYSSCGESCTLSWYWLGI-KYVEGIYSWQVYKNCVGL  194

>PITG_18452
Length=856

 Score = 181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 111/159 (70%), Gaps = 3/159 (2%)

Query  30   VTYPEPFFLLDG-DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88
            V +P PFF++DG D++  A +A L++Q + TS +   +++Q+GY+SLRAMLDDE+LY V 
Sbjct  694  VLHPPPFFVVDGLDFQGMA-LAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKVT  752

Query  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148
             ++IFECG T P  E+QPIPTN   + +GY  DGPCEIW+DD K+ S  NC  +FP    
Sbjct  753  EEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHGQH  812

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            ++DYSSC G C L WY L + K   G YSW+VYKNCV L
Sbjct  813  QVDYSSCGGSCHLSWYWLGI-KYVEGIYSWQVYKNCVGL  850

>PYU1_G001740
Length=206

 Score = 164 bits (415),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P F +    E  + +A LE+Q   T+AD   + K KGY SLRA +DD+  Y VN 
Sbjct  31   VILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYKVNS  90

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
            ++ FECGYT+     QPIP N   R TGY  DGPCE+W+D+ K+LS +NC KDFPG +  
Sbjct  91   NADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGKTHA  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            + Y++CKG CTLRWY + + +   G +SW+VYK CV L
Sbjct  149  MSYAACKGSCTLRWYWMGI-RFLKGKHSWQVYKECVPL  185

>HYAP_07096
Length=251

 Score = 164 bits (416),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V YP P F++D       ++A L++Q + TS +   + ++ GY SLRAMLDD++LY V+ 
Sbjct  88   VLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHVSK  147

Query  90   DSIFECGYTD-PTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148
            D+IF+CG+T  P+   Q IPTNG L  +GY  DGPCE+W DD ++ S  NC+ +FP    
Sbjct  148  DAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHGQH  207

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            ++DYSSC   CTLRWY L + +   G YSW+VYKNC+ L
Sbjct  208  QVDYSSCGDSCTLRWYWLGI-QYMDGIYSWQVYKNCIGL  245

>PHYSO_353401
Length=146

 Score = 160 bits (406),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 98/140 (70%), Gaps = 1/140 (1%)

Query  48   SVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPI  107
            ++A L++Q V TS +   ++++ GYASLRAMLDDE+LY V  +++F+CG T P  E+QPI
Sbjct  2    ALAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPI  61

Query  108  PTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALS  167
            P+N   + +GY  DGPCE+W+DD K+ +  NC   FP    ++DYS+C   CTL WY L 
Sbjct  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121

Query  168  VSKTTGGSYSWEVYKNCVAL  187
            + K   G+YSW+VYKNCVAL
Sbjct  122  I-KYVEGAYSWQVYKNCVAL  140

>PYIR_25089
Length=262

 Score = 159 bits (403),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 98/158 (62%), Gaps = 1/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P F +    E    +A LE+Q   T+AD   + K KGY +LRA +DD++ Y V  
Sbjct  31   VILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYKVAD  90

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + FECG+T      QPIP+   +R TGY  DGPCE+W+D  ++L   NC  +FPGT+ K
Sbjct  91   GADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGTTFK  150

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG C LRWY + + +   G YSW+VYKNCV +
Sbjct  151  IDYSSCKGSCVLRWYWMGI-RFLKGQYSWQVYKNCVPV  187

>PYU1_G001744
Length=213

 Score = 155 bits (391),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 98/158 (62%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P F +    E    +A LE+Q   T+AD   + K KGY SLRA +DD+  Y V  
Sbjct  31   VMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYKVAA  90

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CG+T    + QPIP  G +R TGY  DGPCE+W+D+  ++   NC  +FPGT+ K
Sbjct  91   GADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGTTHK  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            + Y+SCKG CTLRWY + + +   G YSW+VYKNCV +
Sbjct  150  ISYASCKGSCTLRWYWMGI-RFLKGKYSWQVYKNCVPI  186

>PYU1_G001742
Length=213

 Score = 154 bits (390),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 97/158 (61%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P F +    E    +A LE+Q   T+ D   + K KGY +LRA +DD   Y V  
Sbjct  31   VMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYKVAA  90

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CG+T    + QPIP  G +R TGY  DGPCE+W+D  +++   NC  +FPGT+ K
Sbjct  91   GADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGTTFK  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY + + +   G YSW+VYKNCV +
Sbjct  150  IDYSSCKGSCTLRWYWMGI-RFLKGKYSWQVYKNCVPI  186

>PYVX_18173
Length=500

 Score = 159 bits (403),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 1/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V YP PFF++DG     + VA LE Q V T+ +   +L ++GYA+LRA++DD+ LY V  
Sbjct  40   VLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSVTE  99

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
            + +F+CG T P  E+QPIPTNG    +GY  DGPCEIWID+   L+  NC  +FP     
Sbjct  100  EGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGHHT  159

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS C   C + W+ L + K  G  YSW+V+KNC+ L
Sbjct  160  IDYSVCGESCRVSWFWLGI-KYQGERYSWQVFKNCINL  196

 Score = 150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 97/158 (61%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P + ++G       +A LE QN +T+ D  G+L   G+ SLRA +DD++LY VN 
Sbjct  238  VILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYSVNA  297

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP +G +R TGY  DGPCE+W+DD ++L   NC +   G +  
Sbjct  298  SADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGKTYD  356

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYS+C G CTL WY L V +     YSW+VYK CV +
Sbjct  357  LDYSACNGSCTLYWYWLGV-RYLKQVYSWQVYKACVPI  393

>PYIW_18791
Length=194

 Score = 149 bits (377),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 103/159 (65%), Gaps = 3/159 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P+P + +       A ++ LE   V TS  V GF+K KGY++LRA++DD  LY  N 
Sbjct  25   VEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYKTNS  84

Query  90   DS-IFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTST  148
            ++  F CGYTDP+  SQ IP +  +R TGY   GPCE+WIDD ++++  NC +    T T
Sbjct  85   NADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSNT-T  143

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            K+DYS+CKGECT+RWY L + +     +SW+VYKNC+AL
Sbjct  144  KVDYSNCKGECTMRWYWLGL-RYLKKKWSWQVYKNCIAL  181

>PYIR_26626
Length=212

 Score = 150 bits (378),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 100/162 (62%), Gaps = 3/162 (2%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            +  V  P P F           +A LE+Q   T+AD  G++K KGY +LRA +DD+  Y 
Sbjct  28   HQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87

Query  87   VNI-DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145
            V+   + FECGYT+   + QPIP  G +R TGY  DGPCE+W+D+ K++S  NC KDFPG
Sbjct  88   VDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146

Query  146  TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             +  + Y+SCKG CTLRWY + + +     +SW+VYK CV +
Sbjct  147  KTHSISYASCKGSCTLRWYWMGL-RFLKNKWSWQVYKECVPI  187

>PYU1_G001741
Length=199

 Score = 149 bits (375),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 95/158 (60%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P F +    E    +A LE+Q   T+AD   + K KGY +LRA +DD+  Y V  
Sbjct  30   VMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYTVAS  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + FECG+T      Q IP  G +R TGY  DGPCE+W+D  +++   NC  +F GT+  
Sbjct  90   GADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGTTHT  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY + + +   G YSW+VYKNCV +
Sbjct  149  IDYSSCKGSCTLRWYWMGI-RFLKGEYSWQVYKNCVPI  185

>PHYSO_536424
Length=197

 Score = 147 bits (371),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 91/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE++  TT  D   + K+ GY SLR  +D    YDV  
Sbjct  26   VLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTS  84

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP   K+R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  85   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  144

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L V +     YSW+VYK C+ L
Sbjct  145  VDYSSCKGTCTLRWYWLGV-RFLKNDYSWQVYKACIPL  181

>PHYSO_507031
Length=197

 Score = 147 bits (371),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 91/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE++  TT  D   + K+ GY SLR  +D    YDV  
Sbjct  26   VLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMD-RAKYDVTS  84

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP   K+R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  85   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  144

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L V +     YSW+VYK C+ L
Sbjct  145  VDYSSCKGTCTLRWYWLGV-RFLKNDYSWQVYKACIPL  181

>PHYSO_341599
Length=185

 Score = 145 bits (367),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 90/158 (57%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   + K+ GY SLR  +D    YDV  
Sbjct  14   VLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMD-RAKYDVTS  72

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP   K+R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  73   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  132

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L V +     YSW+VYK C+ L
Sbjct  133  VDYSSCKGTCTLRWYWLGV-RFLKNDYSWQVYKACIPL  169

>PYAP_22279
Length=223

 Score = 146 bits (368),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 103/166 (62%), Gaps = 7/166 (4%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            + ++T P P    D +  +   +A LE+Q V  + D+ G+L+QKG  +LR  +D++  Y 
Sbjct  22   HQRITIPAPTLTTDRN-TATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   VNI-DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLL--SSANCKKDF  143
            V    + FECGYTDP    QPIP+NG +R TGY  DGPCE+W+D+ ++L  +S +C KD 
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  144  PG--TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                 S K+D+S CKG C LRWY L+  K  G  +SW+VYK CV L
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRK-IGSKWSWQVYKQCVPL  185

>PYAP_22273
Length=268

 Score = 147 bits (371),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 3/163 (2%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            + +V +PE  + L     +    A+LE+Q   T+ D   +L   GY +LR  +D    Y 
Sbjct  26   HQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYK  85

Query  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDF--P  144
             N  +  ECGYTDP    QPIPTNG+ R +GY  +GPCEIWIDD+ + S  NC  D    
Sbjct  86   ANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEK  145

Query  145  GTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              + K+DYS+CKG+C L+WY L + +  G  YSW++YK C+ L
Sbjct  146  AFTDKIDYSACKGKCMLKWYWLGI-RPMGKKYSWQIYKACIPL  187

>PHALS_03284
Length=188

 Score = 143 bits (360),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 92/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            +  PEP +  +        +A LE+QN  TSAD  G+LK+  Y SLR  L     Y V  
Sbjct  17   ILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFLKRAN-YTVTE  75

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +  +CG+TDP    QPIP    +RFTGY  DG CE+W+DD K+LS +NC  DFPG    
Sbjct  76   GADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGKDCP  135

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCK  C + WY L+V +     YSW+VYK C+ L
Sbjct  136  VDYSSCKDNCVMYWYWLAV-RLLKNEYSWQVYKACIPL  172

>PHYRA_85631
Length=228

 Score = 143 bits (361),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 91/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE++  TT  D A +  + GY SLR  +D+   Y+V  
Sbjct  31   VLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNAK-YNVAD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L + +     YSW+VYK C+ L
Sbjct  150  VDYSSCKGTCTLRWYWLGI-RFLKNDYSWQVYKECIPL  186

>PYAR_24096
Length=227

 Score = 142 bits (359),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (59%), Gaps = 3/163 (2%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            + +V  P+  + +     +    A+LE Q   T+AD   +LK   Y +LR  +D    Y 
Sbjct  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86

Query  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146
             N  + FECG+TDP   +QPIP +G  R +GY  +GPCEIWIDD+++    NC  D   T
Sbjct  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146

Query  147  --STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              + K+DYS+CKG C L+WY L + + TG SYSW++YK C+ L
Sbjct  147  AFTDKIDYSACKGTCMLKWYWLGI-RPTGKSYSWQIYKACIPL  188

>PPTG_10635
Length=199

 Score = 141 bits (355),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 89/158 (56%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   +  + GY SLR  +D    Y+V  
Sbjct  14   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMD-RAKYEVTS  72

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  73   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  132

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L V +    SYSW+VYK C+ L
Sbjct  133  VDYSSCKGSCTLRWYWLGV-RFLKNSYSWQVYKACIPL  169

>PHYRA_84190
Length=206

 Score = 140 bits (353),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 90/158 (57%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE++   T  D   +  + GY SLR  +D+   Y V  
Sbjct  14   VLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNAK-YSVTN  72

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP +  +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  73   GADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYT  132

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY + V +    +YSW+VYK C+ L
Sbjct  133  VDYSSCKGTCTLRWYWMGV-RFLKETYSWQVYKECIPL  169

>PYAP_22278
Length=289

 Score = 142 bits (358),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 97/166 (58%), Gaps = 5/166 (3%)

Query  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86
            + +VT P P F  +    +   +A LE+Q V    D+ GFL+ KG  +LR  +D++  Y 
Sbjct  25   HQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYK  84

Query  87   VNI-DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSS--ANCKKDF  143
            +    + FECGYT+P    QPIP NG +R TGY  DGPCE+W+D+ ++L S   NC +D 
Sbjct  85   IEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDV  144

Query  144  --PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                 S K+D+S CKG C LRWY L      G  +SW++YK CV L
Sbjct  145  GNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PPTG_10634
Length=208

 Score = 139 bits (350),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 90/158 (57%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE++  TT  D   + K+ GY SLR  LD+   Y V  
Sbjct  31   VLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNAK-YPVTD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTL WY L V +     YSW+VYK C+ L
Sbjct  150  VDYSSCKGTCTLYWYWLGV-RFLKNDYSWQVYKACIPL  186

>PHYCA_14369
Length=248

 Score = 140 bits (353),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 88/158 (56%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   +  + GY SLR  +D    Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVTN  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L V +    +YSW+VYK C+ L
Sbjct  150  VDYSSCKGTCTLRWYWLGV-RFLKNAYSWQVYKACIPL  186

>PPTG_10643
Length=250

 Score = 140 bits (352),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 91/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q      D A + K+ GY SLR  +D    Y+V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMD-RAKYEVTP  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+T+P    QPIP  G +R TGY  DGPCE+++DD  +L   NC + FPG    
Sbjct  90   GADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHEKFPGKDCP  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L + +    +YSW+VYK C+ L
Sbjct  150  IDYSSCKGTCTLRWYWLGI-RFLKNAYSWQVYKECIPL  186

>PHALS_00498
Length=199

 Score = 138 bits (347),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 92/158 (58%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+QN  T+ D   + KQ  + +LR  +D+   Y V  
Sbjct  31   VLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNAK-YTVVK  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +   CG+TDP    QPIP N  +R TGY  DGPCE+W+++ ++LS++NC + FPG    
Sbjct  90   GADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCK  C LRWY L V +     YSW+VYK C+ L
Sbjct  150  IDYSSCKDNCLLRWYWLGV-RFLKEKYSWQVYKACIPL  186

>PHYCA_102550
Length=268

 Score = 140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D        +A LE Q   T  D   +  + GY SLR  +D    Y V  
Sbjct  31   VLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMD-RAKYTVRN  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CGYTDP    QPIP    +R TGY  DGPCE+WIDD  ++   NC + FPG    
Sbjct  90   GADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKGYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS CKG+CTL WY L V +    SYSW+VYK C+ L
Sbjct  150  IDYSPCKGKCTLYWYWLGV-RFLKNSYSWQVYKECIPL  186

>PPTG_10636
Length=246

 Score = 139 bits (349),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   +  +  Y SLR  +D+   Y+V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAK-YEVTS  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L + +     YSW+VYK C+ L
Sbjct  150  VDYSSCKGTCTLRWYWLGI-RFLKNQYSWQVYKACIPL  186

>PHYKE_3446
Length=199

 Score = 137 bits (345),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 90/158 (57%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE+Q   T  D   + +  GY +LRA +D    Y V  
Sbjct  31   VLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMD-MAKYQVTE  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+TDP   +QPIP  G +R TGY  DGPCE+WID+ ++L S NC +   G    
Sbjct  90   GADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS+C+G C LRWY L V +    SYSW+VYK C+ L
Sbjct  150  IDYSACQGTCMLRWYWLGV-RFLKNSYSWQVYKACIPL  186

>PHYCA_102624
Length=195

 Score = 136 bits (343),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P+P +  D        +  LE     T AD   + K+ GY SLR  +D+   Y V+ 
Sbjct  31   VLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-YPVSE  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CG+TDP    QPIP    +R TGY  DGPCE+WIDD  ++   NC + FPG    
Sbjct  90   GADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS CKG+CTL WY L V +     YSW+VYK C+ L
Sbjct  150  IDYSPCKGKCTLYWYWLGV-RFLKNRYSWQVYKECIPL  186

>PHYCA_102852
Length=195

 Score = 135 bits (341),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 88/158 (56%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE++  TT  D   +  + GY SLR  +D    Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMD-RAKYPVTE  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F+CG+TDP    QPIP    +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGKGYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTL W+ L V +     YSW+VYK C+ L
Sbjct  150  IDYSSCKGTCTLYWFWLGV-RFLKNDYSWQVYKACIPL  186

>PHYSO_284086
Length=204

 Score = 134 bits (338),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 93/158 (59%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LE+Q   T  D   + + KGY +LRA +D  + Y V  
Sbjct  31   VLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDGAS-YTVAD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+TD    +QPIP +G +R TGY  DGPCE+W+D  ++L S NC + F G +  
Sbjct  90   GADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGKTYD  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYSSCKG CTLRWY L V +     YSW+VYK CV L
Sbjct  149  LDYSSCKGSCTLRWYWLGV-RFLKNEYSWQVYKACVPL  185

>PHYKE_7718
Length=220

 Score = 134 bits (338),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE +  T   D   +  + GY SLR  +D+   Y V  
Sbjct  35   VLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK-YSVTS  93

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +   CG+TDP    QPIP    +R TGY  DGPCE+WIDD   + + NC + FPG    
Sbjct  94   GADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGKDYT  153

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS+CKG CTLRWY L V +    SYSW+VYK C+ L
Sbjct  154  IDYSACKGTCTLRWYWLGV-RFLKNSYSWQVYKACIPL  190

>PPTG_15264
Length=194

 Score = 133 bits (335),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 88/160 (55%), Gaps = 4/160 (3%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE Q   T  D   + +  GY +LR  +D    Y V  
Sbjct  28   VLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTE  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+TDP    QPIP  G +R TGY  DGPCE+W+DD+++L   NC +  PG    
Sbjct  87   GADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYT  146

Query  150  LDYSSC--KGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC  KG C LRWY L V +    SYSW+VYK C+ L
Sbjct  147  IDYSSCEKKGGCVLRWYWLGV-RFLKNSYSWQVYKECIPL  185

>PPTG_17366
Length=194

 Score = 133 bits (335),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 88/160 (55%), Gaps = 4/160 (3%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE Q   T  D   + +  GY +LR  +D    Y V  
Sbjct  28   VLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMD-RAKYTVTE  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+TDP    QPIP  G +R TGY  DGPCE+W+DD+++L   NC +  PG    
Sbjct  87   GADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGKDYT  146

Query  150  LDYSSC--KGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC  KG C LRWY L V +    SYSW+VYK C+ L
Sbjct  147  IDYSSCEKKGGCVLRWYWLGV-RFLKNSYSWQVYKECIPL  185

>PYIR_26546
Length=239

 Score = 134 bits (337),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 97/161 (60%), Gaps = 4/161 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQ-NVTTSADVAGFLKQKGYASLRAMLDDETLYDVN  88
            V  P+P + ++G  +    +A LE Q   + + D  G+L  KG+ ++R  +D++ LY   
Sbjct  31   VVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLYRPV  90

Query  89   IDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG--T  146
             D+ F+CGYT    E QPIP N ++R TGY  +GPCEIW+DD+K+    NC  D      
Sbjct  91   SDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVASGMN  150

Query  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              KLD+SSC G+CT+ WY + + + +G S SW++YK C+ L
Sbjct  151  FQKLDFSSCVGKCTMYWYWMGI-RGSGKSVSWQIYKECIPL  190

>PHYCA_129425
Length=204

 Score = 133 bits (334),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 90/158 (57%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LE Q   T  D  G+ +  GY +LRA +D    Y V  
Sbjct  31   VLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGAK-YTVTD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+T+     QPIP +G +R TGY  DGPCE+W+D  ++L S NC + FPG +  
Sbjct  90   GADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGKTYN  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYSSCKG C LRWY L  ++     +SW+VYK C+ L
Sbjct  149  LDYSSCKGSCMLRWYWLG-TRFLKNEHSWQVYKACIPL  185

>PHYRA_82864
Length=193

 Score = 132 bits (332),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 88/158 (56%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  D        +A LE Q   T  D   + +  GY +LR  +D    Y V  
Sbjct  31   VLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMD-RAKYTVTE  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+TDP    QPIP  G +R TGY  DGPCE+W+D+ ++L   NC + FP     
Sbjct  90   GADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDKDYP  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTL WY + V +    SYSW+VYK C++L
Sbjct  149  IDYSSCKGTCTLHWYWIGV-RFLKNSYSWQVYKECISL  185

>PHYKE_8388
Length=205

 Score = 129 bits (325),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LEDQ  +T  D   +    GYASLRA  DD + Y V+ 
Sbjct  31   VLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDAS-YTVSD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TD    +QPIP +  +R TGY  DGPCE+W+DD  ++   NC     G    
Sbjct  90   GADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL W+ + V +     YSW+VYK CV L
Sbjct  150  IDYSSCTSTCTLYWFWMGV-RYLKNEYSWQVYKACVPL  186

>PPTG_17122
Length=204

 Score = 127 bits (320),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 89/158 (56%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LE+Q   T  D  G+ +  GY +LR  +D    Y V  
Sbjct  31   VLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMD-RAKYTVTD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+T+     QPIP +G +R TGY  DGPCE+W+D  ++L S NC +   G +  
Sbjct  90   GADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGKTYN  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYSSC G CTLRWY L V +    +YSW++YK C+ L
Sbjct  149  LDYSSCTGTCTLRWYWLGV-RYLKNAYSWQIYKACIPL  185

>PPTG_10048
Length=190

 Score = 127 bits (318),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 84/158 (53%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V +P P ++ D        +A LE Q   T  D   +  Q GY +LR  ++    Y V  
Sbjct  28   VLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAK-YTVTE  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+T+P    QPIP  G +R TGY  +GPCE+W+ D ++  + NC    PG    
Sbjct  87   GADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGKEYP  146

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS CKG C L WY L V +    SYSW+VYK C+ L
Sbjct  147  IDYSPCKGNCVLYWYWLGV-RFLKNSYSWQVYKECIPL  183

>PHYKE_8389
Length=204

 Score = 124 bits (312),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 85/158 (54%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LE+Q   T  D   + +  GY +LRA +D    Y V  
Sbjct  30   VLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGAK-YTVTD  88

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+T+     Q IP+   +R TGY  DGPCE+W+D  ++L+  NC +   G    
Sbjct  89   GADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC G CTLRWY L V +     YSW+VYK CV L
Sbjct  149  IDYSSCTGTCTLRWYWLGV-RFLKNEYSWQVYKACVPL  185

>PHYRA_81107
Length=202

 Score = 124 bits (311),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 86/158 (54%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LEDQ  +T  D   + ++ GY SLRA  DD   Y V+ 
Sbjct  28   VLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRA-FDDGASYTVSD  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TD   + Q IP    +R TGY  DGPCE+W+DD  ++   NC +   G    
Sbjct  87   GADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGKDYT  146

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL W+ + V +    +YSW+VYK CV L
Sbjct  147  IDYSSCTSTCTLYWFWMGV-RYLNNAYSWQVYKACVPL  183

>PHYSO_477820
Length=202

 Score = 124 bits (310),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 83/158 (53%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LEDQ   T  D   +    GY SLRA  +D   Y V  
Sbjct  28   VLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRA-FNDGASYTVAD  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+T+   E QPIP +  +R TGY  DGPCE+W+DD  ++   NC +   G    
Sbjct  87   GADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGKDYT  146

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL W+ L V +     YSW++YK CV L
Sbjct  147  IDYSSCTSTCTLYWFWLGV-RYLKNEYSWQIYKACVPL  183

>PITG_18450
Length=203

 Score = 121 bits (304),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 87/158 (55%), Gaps = 6/158 (4%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +  LE Q   T  D  G+ +  GY +LR  ++    Y V  
Sbjct  31   VLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YTVAD  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+T+     QP P +G +R TGY  DGPCE+W+D  ++L S NC +   G +  
Sbjct  87   GADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGKTYN  145

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYSSCKG CTLRWY L V +    +YSW++YK C+ L
Sbjct  146  LDYSSCKGTCTLRWYWLGV-RFLKNAYSWQIYKACIPL  182

>PHYRA_81106
Length=202

 Score = 120 bits (300),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 84/158 (53%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LE+Q   T  D   + +  GY +LRA +D    Y V  
Sbjct  31   VLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK-YTVAD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + + CG+T+     Q IP    +R TGY  DGPCE+W+D  ++L+  NC +   G    
Sbjct  90   GADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGKDYT  149

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC G CTL WY + V +    +YSW+VYK CV L
Sbjct  150  IDYSSCTGTCTLHWYWMGV-RYLKNAYSWQVYKACVPL  186

>PHYCA_511409
Length=204

 Score = 119 bits (298),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 83/158 (53%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LEDQ   T  D   + +  GY SLRA  +D   Y V+ 
Sbjct  30   VLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRA-FNDGASYTVSD  88

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+T+   + Q IP    +R TGY  DGPCE+W+DD  ++   NC +   G    
Sbjct  89   GADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKDYT  148

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL W+ L V +     YSW++YK CV L
Sbjct  149  IDYSSCTSTCTLYWFWLGV-RYLKNEYSWQIYKACVPL  185

>PPTG_17121
Length=202

 Score = 117 bits (292),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 82/158 (52%), Gaps = 2/158 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V    P +  D      A +A LEDQ   T  D   + K  GY SLRA  +D   Y V+ 
Sbjct  28   VLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRA-FNDGASYTVSD  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +   CG+T+   + QPIP    +R TGY  DGPCE+W+DD  ++   NC +   G    
Sbjct  87   GADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGKYYT  146

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSC   CTL W+ L V +     YSW++YK CV L
Sbjct  147  IDYSSCTSTCTLYWFWLGV-RYLKNEYSWQIYKACVPL  183

>PYVX_18176
Length=201

 Score = 114 bits (284),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 84/158 (53%), Gaps = 3/158 (2%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P P +  D      A +A LEDQ  +T  D   +    GY SLRA +D  + Y V  
Sbjct  28   VILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS-YTVTD  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +   CG+T+    +Q +P +G +R TGY   GPCE+W+DD  +L   NC     G +  
Sbjct  87   GADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGKTYD  145

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            LDYSSC   CTL W+ + V +     YSW+VYKNCV L
Sbjct  146  LDYSSCTSTCTLYWFWMGV-RYLNNEYSWQVYKNCVPL  182

>PYVX_18174
Length=204

 Score = 112 bits (280),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 85/159 (53%), Gaps = 5/159 (3%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +         A +A LEDQ   T  D   + +  GY +LRA +D  + Y V  
Sbjct  31   VILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQAS-YTVTD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             +   CG+T+     QPIP N   R TGY  DGPCEIW+D  ++ ++ NC +   G  T 
Sbjct  90   GADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGKDTA  147

Query  150  LDYS-SCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYS    G CTL WY + V +    +YSW+VYKNCV L
Sbjct  148  IDYSXXXXGTCTLYWYWMGV-RYLNNAYSWQVYKNCVPL  185

>PHYSO_499978
Length=174

 Score = 110 bits (276),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 72/135 (53%), Gaps = 1/135 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   +  + GY +LR  +D    Y V  
Sbjct  31   VLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTK  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+WID+ ++L   NC +        
Sbjct  90   GADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT  149

Query  150  LDYSSCKGECTLRWY  164
            +DYS+CKG CTLRWY
Sbjct  150  IDYSACKGTCTLRWY  164

>PHYSO_501575
Length=174

 Score = 110 bits (276),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 72/135 (53%), Gaps = 1/135 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D   +  + GY +LR  +D    Y V  
Sbjct  31   VLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMD-HGKYTVTK  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP    +R TGY  DGPCE+WID+ ++L   NC +        
Sbjct  90   GADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT  149

Query  150  LDYSSCKGECTLRWY  164
            +DYS+CKG CTLRWY
Sbjct  150  IDYSACKGTCTLRWY  164

>PHYCA_510817
Length=188

 Score = 109 bits (272),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 77/139 (55%), Gaps = 2/139 (1%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            ++ LE +   T  +   +    GY SLR  ++ +  Y V+  +   CG++DP    Q IP
Sbjct  50   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-KAKYKVSDGADQACGWSDPKGIPQQIP  108

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168
            ++G +R +GY  DGPCEIW+ D   LS  NC +  P  + KLDYS C   C L WY L V
Sbjct  109  SDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  169  SKTTGGSYSWEVYKNCVAL  187
             K   G YSW+VYK C+ L
Sbjct  169  RKLK-GKYSWQVYKECIPL  186

>PHYSO_343376
Length=172

 Score = 108 bits (271),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 66/116 (57%), Gaps = 1/116 (1%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            +A LE+Q   T  D   +  + GY +LR  +D    Y V   + F CG+TDP    QPIP
Sbjct  48   LAFLENQGFATQQDFRAWRTKNGYKTLRDFMD-HGKYTVTKGADFSCGWTDPKGTPQPIP  106

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWY  164
                +R TGY  DGPCE+WID+ ++L   NC +        +DYS+CKG CTLRWY
Sbjct  107  DGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDYSACKGTCTLRWY  162

>PITG_13520
Length=171

 Score = 108 bits (269),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 68/127 (54%), Gaps = 1/127 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +           +A LE+Q   T  D   +  + GY SLR  +D    YDV  
Sbjct  31   VLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMD-RAKYDVTS  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP    QPIP  G +R TGY  DGPCE+W+DD  +L   NC + FPG    
Sbjct  90   GADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGKDYT  149

Query  150  LDYSSCK  156
            +DYSSCK
Sbjct  150  VDYSSCK  156

>PPTG_14254
Length=188

 Score = 108 bits (269),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 74/139 (53%), Gaps = 2/139 (1%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            ++ LE +   T  +   F    GY SLR  +D    Y V   +   CG+TDP    Q IP
Sbjct  50   LSFLEKEGFKTQENFTQFQVDNGYKSLRDFMD-RAKYKVTEGADQACGWTDPKGIPQKIP  108

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168
             +G +R TGY  DGPCEI++ +   LS  NC +  P  + KLDYS C   C L WY L V
Sbjct  109  EDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHESIPEQTFKLDYSGCGDSCILYWYWLGV  168

Query  169  SKTTGGSYSWEVYKNCVAL  187
             K   G YSW+VYK C+ +
Sbjct  169  RKLK-GKYSWQVYKECIPI  186

>PHYKE_9185
Length=281

 Score = 107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 76/136 (56%), Gaps = 2/136 (1%)

Query  52   LEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNG  111
            LE + + T  +   +     YASLR  +D +  Y V+  +   CG+TDP    Q IP +G
Sbjct  55   LEKEGIKTQENFTQYQVDNNYASLRDFMD-KAKYKVSDGADQACGWTDPKGIPQQIPEDG  113

Query  112  KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKT  171
             +R +GY  DGPCEI++ D   LS  NC +     + KLDYS+C   C L WY L V K 
Sbjct  114  TMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSACGDSCILYWYWLGVRK-  172

Query  172  TGGSYSWEVYKNCVAL  187
              GSYSW++YK C+ L
Sbjct  173  LKGSYSWQIYKECIPL  188

>PPTG_08820
Length=250

 Score = 105 bits (262),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 79/142 (56%), Gaps = 4/142 (3%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDD-ETLYDVNIDSIFECGYTDPTYESQPI  107
            +A LE Q     AD  G+  Q GY +LR  +D  +    V   +   CG T+     +PI
Sbjct  52   LAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKYTTSVTPGADQTCGLTELKGPPRPI  111

Query  108  PTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSC--KGECTLRWYA  165
            P +G ++ TGY  DGPC +++DD  +L   NC +  PG S K+DYSSC  KG CTL W+ 
Sbjct  112  PKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKLPGKSYKIDYSSCEKKGGCTLYWFW  171

Query  166  LSVSKTTGGSYSWEVYKNCVAL  187
            L + +     +SW+VYK CV L
Sbjct  172  LGI-RFVKSRWSWQVYKECVPL  192

>PPTG_14255
Length=268

 Score = 104 bits (259),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 73/136 (54%), Gaps = 2/136 (1%)

Query  52   LEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNG  111
            LE +  TT  +   +    GY SLR  +D+   Y V   +   CG+TDP    Q IP +G
Sbjct  52   LEKEGYTTQENFTQYQVDNGYKSLRDFMDNAK-YSVTDGADQACGWTDPKGVPQQIPEDG  110

Query  112  KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKT  171
             +R +GY  DGPCEI++ D   LS  NC +     + KLDYS+C   C L WY L V + 
Sbjct  111  TMRTSGYTHDGPCEIYMGDTLALSYLNCHESITDQTFKLDYSACGDSCVLYWYWLGV-RY  169

Query  172  TGGSYSWEVYKNCVAL  187
                YSW+VYK C+ L
Sbjct  170  LKKKYSWQVYKECIPL  185

>PHYSO_417649
Length=185

 Score = 100 bits (249),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 73/139 (53%), Gaps = 2/139 (1%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            ++ LE +   T  +   +    GY SLR  ++    Y +   +   CG+TDP    Q IP
Sbjct  48   LSFLEKEGFKTQENFTQYQVDNGYKSLRDFME-RAKYKLTDGADQACGWTDPKGIPQQIP  106

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168
             +G +R +GY  DGPCEI++ D   LS  NC +     + KLDYS C   C L WY L V
Sbjct  107  EDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV  166

Query  169  SKTTGGSYSWEVYKNCVAL  187
             K   G +SW+VYK C+ L
Sbjct  167  RKLK-GKFSWQVYKECIPL  184

>PHYKE_8390
Length=130

 Score = 97.4 bits (241),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 61/95 (64%), Gaps = 0/95 (0%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  P PFF++DG      ++A L++Q V TS +  G++   GY SLRAMLDDE LY V  
Sbjct  33   VLQPPPFFIVDGLDFQGMALAYLQEQGVNTSIETQGWMNSHGYDSLRAMLDDEALYKVTE  92

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPC  124
            +++F+CG T P  E+Q IPTN   + +GY  DGPC
Sbjct  93   EALFDCGLTSPKTETQLIPTNSTFQTSGYTMDGPC  127

>PHYSO_262732
Length=188

 Score = 99.0 bits (245),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (59%), Gaps = 3/123 (2%)

Query  66   FLKQKGYAS-LRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPC  124
            FL+ +G+ + LR  +D+   Y V   +   CG+TDP   +Q IP++G +R +GY  DGPC
Sbjct  51   FLENQGFQTHLRDFMDNAK-YTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPC  109

Query  125  EIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNC  184
            EI++ D   LS  NC +     + KLDYS C   CTL WY L V +     YSW+VYK C
Sbjct  110  EIYMGDKLALSYLNCHESITDQTFKLDYSGCGDSCTLYWYWLGV-RFLNNKYSWQVYKEC  168

Query  185  VAL  187
            + +
Sbjct  169  IPI  171

>PHYCA_536934
Length=983

 Score = 104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 72/136 (53%), Gaps = 2/136 (1%)

Query  52   LEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNG  111
            LE +  TT  +   +    GY +LR  +D+   Y V   +   CG++DP    Q IP +G
Sbjct  69   LEKEGYTTQENFTQYQVDNGYKNLRDFMDNAK-YAVTDGADQACGWSDPNGIPQQIPEDG  127

Query  112  KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKT  171
             +R +GY  DGPCEIW+ D   LS  NC +     + KLDYS C   C L WY L V + 
Sbjct  128  TMRTSGYTHDGPCEIWMGDKLALSYLNCHESITDQTFKLDYSGCGDSCILYWYWLGV-RY  186

Query  172  TGGSYSWEVYKNCVAL  187
                YSW+VYK C+ L
Sbjct  187  LKKKYSWQVYKECIPL  202

>PHYSO_254168
Length=170

 Score = 98.2 bits (243),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 19/141 (13%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            +A LE Q   T        +  GY +LR  +D    Y V   + + CG+T+P    QPIP
Sbjct  38   LAFLEGQGFATQEGFDARRRDNGYKTLRDFMD-RGKYTVTQGADYFCGWTNPKGTPQPIP  96

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSC--KGECTLRWYAL  166
                 R TGY  DGPCEIW+DD+++L            S  +DYSSC  KG CT+ WY L
Sbjct  97   -----RSTGYTHDGPCEIWLDDVRVLER----------SPTIDYSSCEKKGGCTMHWYWL  141

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
             V +    SYSW+VYK C+ L
Sbjct  142  GV-RFLKNSYSWQVYKECIPL  161

>PITG_10499
Length=323

 Score = 101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 79/142 (56%), Gaps = 4/142 (3%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDD-ETLYDVNIDSIFECGYTDPTYESQPI  107
            +A LE Q      D  G+  + GY  LR  +D  + +  V   +   CG T+     +PI
Sbjct  22   LAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTELKGPPRPI  81

Query  108  PTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSC--KGECTLRWYA  165
            P +G +R TGY  DGPC I++DD  ++   NC +  PG + K+D+SSC  KG CTL W+ 
Sbjct  82   PKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKGGCTLYWFW  141

Query  166  LSVSKTTGGSYSWEVYKNCVAL  187
            L + +     +SW+VYK C++L
Sbjct  142  LGI-RFVKSRWSWQVYKECISL  162

>PHYSO_341596
Length=231

 Score = 95.9 bits (237),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 62/108 (57%), Gaps = 2/108 (2%)

Query  38   LLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGY  97
            LLD D +    +A LE+Q   T  D A +  + GY SLR  +D +  Y V   + F CG+
Sbjct  32   LLDKDTKYNP-LAFLENQGFETQEDFASWRDKNGYKSLRDFMD-KAKYTVTSGADFSCGF  89

Query  98   TDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG  145
            TDP    QPIP    +R TGY  DGPCE+W+DD K+L   NC + FPG
Sbjct  90   TDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHEKFPG  137

>PYAP_18131
Length=226

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 68/114 (60%), Gaps = 8/114 (7%)

Query  79   LDDETLYDVNI-DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSS-  136
            +DD+  Y V    + FECG TDP    QPIP NG +R TG+  DG   +WID+ ++L S 
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  137  -ANCKKDFPG--TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              NC K       S K+D+S CKG+C +RWY L + +  G  +SW+VYK C+ +
Sbjct  59   LGNCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGM-RLLGKKWSWQVYKACIPI  111

>PYU1_G007476
Length=195

 Score = 94.0 bits (232),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 70/132 (53%), Gaps = 18/132 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF----TG  117
            D A   KQKGY +LR+ L+++            CGYT+P    + IP +GK+ F     G
Sbjct  65   DFARISKQKGYKTLRSFLENKGA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVG  115

Query  118  YMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGS  175
            ++  GPCE+W+D+  +L   NC+K FPG    +  D+SSCKG C LR Y L         
Sbjct  116  FVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQDQ---G  172

Query  176  YSWEVYKNCVAL  187
              W+ YK CV +
Sbjct  173  QRWQTYKYCVPV  184

>PHYSO_527908
Length=174

 Score = 92.8 bits (229),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 65/125 (52%), Gaps = 1/125 (1%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            +A LE Q  TT A+   F+   GY SLR  +D+   Y V   +   CG+TDP    Q IP
Sbjct  49   LAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDNGN-YSVTKGADQACGWTDPNGIPQQIP  107

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168
             +G +R +G+  D PCEI++ D   LS  NC +       KLDYS+C   C L WY L V
Sbjct  108  EDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHESITSQPFKLDYSACGDSCVLYWYWLGV  167

Query  169  SKTTG  173
                G
Sbjct  168  RFIKG  172

>PHYSO_342364
Length=194

 Score = 92.0 bits (227),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 75/147 (51%), Gaps = 27/147 (18%)

Query  56   NVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLR  114
            N   S  V   LK    Y  LR +LD+  +Y  N      CGYT+P    QPIPTNGK  
Sbjct  58   NTQKSVQVFNSLKTSHNYKDLRTLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAI  111

Query  115  FT-GYMKDGPCEIWIDDLKLL-----------SSANCKKDFPGTSTKLDYSSC--KGECT  160
            F+ G +  GPCEIW+DD K++           S+ N K +FP     +DYS C  KG C 
Sbjct  112  FSRGLIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFP-----VDYSYCKAKGGCM  166

Query  161  LRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +R+Y L   +  G    W+ YKNC+ L
Sbjct  167  MRFYWLGF-QALGKKTVWQTYKNCIPL  192

>PHYSO_340369
Length=200

 Score = 92.4 bits (228),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 70/139 (50%), Gaps = 16/139 (12%)

Query  49   VARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
            +A  EDQ   TS++   +    G+ +LR  +D+   Y V          T P    Q IP
Sbjct  52   LAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDNGN-YSV----------TSP----QQIP  96

Query  109  TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSV  168
             +  +R  GY +DGPCEIW+D+    SS +C    P  +  LDYS C   C + WY L V
Sbjct  97   DDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLVSLPNMTYTLDYSGCGASCVMYWYTLGV  156

Query  169  SKTTGGSYSWEVYKNCVAL  187
            +K     YSWEVYK C+ L
Sbjct  157  AK-PDRVYSWEVYKECIPL  174

>PYAP_18711
Length=210

 Score = 91.7 bits (226),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 72/131 (55%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A      K++G  +LRA L+ +           ECG T+P  + +PIP++G ++F   
Sbjct  57   TGAQYDAERKKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFGSS  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            M+  GPCE+W D+  + S  +C+K F   T  K+DYS CKG C LR+Y L +     G  
Sbjct  108  MEHPGPCEVWFDNTLVFSEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNCV +
Sbjct  165  RWQSYKNCVPI  175

>PYAP_24689
Length=252

 Score = 92.0 bits (227),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 14/133 (11%)

Query  57   VTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT  116
            + T A      K+ G  +LRA L+ +            CG T+P  + +PIP +G ++F 
Sbjct  58   IRTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFG  108

Query  117  GYMKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGG  174
              M+  GPCEIW D+ ++   A+C K F   T  K+DYS C+G+C LR+Y L +     G
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQD---G  165

Query  175  SYSWEVYKNCVAL  187
               W+ YKNCV L
Sbjct  166  GKRWQSYKNCVPL  178

>PYIR_16435
Length=304

 Score = 90.5 bits (223),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 75/130 (58%), Gaps = 15/130 (12%)

Query  61   ADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYM  119
            A+ A   K+KGY++LR+ ++D+            CG T+P    + IP++  ++F+   +
Sbjct  65   ANFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIV  115

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGT--STKLDYSSCKGECTLRWYALSVSKTTGGSYS  177
              GPCE+W+DD +++   NC+  F     + K+D+SSCKG C LRW+ L +  +      
Sbjct  116  HPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDS---GER  172

Query  178  WEVYKNCVAL  187
            W+VYKNCV L
Sbjct  173  WQVYKNCVPL  182

>H310_06362
Length=197

 Score = 87.8 bits (216),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 78/149 (52%), Gaps = 31/149 (21%)

Query  56   NVTTSADVAGFLKQ------KGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT  109
            N + S++ A F K        G+ +LRAMLD             +CGYT     ++PIPT
Sbjct  30   NGSPSSNAAAFTKAFSDQMATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPT  80

Query  110  NGKLRFT------GYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE  158
            +GK+ +       G++    GPCEIW+D+ ++  + NC  +F   P     +D+SSC G 
Sbjct  81   DGKVVWQNPDTGEGFVPSHTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGS  140

Query  159  CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            CT+R+Y L++ +       W+VYKNC  L
Sbjct  141  CTIRFYWLALHEDL-----WQVYKNCAPL  164

>PYU1_G005323
Length=251

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A     KGY  L++ L+D+            CG + P  +++PIP++G ++    
Sbjct  56   TGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLAST  106

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            ++  GPCE+W DD++     +C+K F   TS K+D+S+CKG C LR+Y L +     G  
Sbjct  107  IEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQD---GGK  163

Query  177  SWEVYKNCVAL  187
             W+ YKNC+ L
Sbjct  164  RWQSYKNCIPL  174

>PHYRA_74651
Length=344

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 84/157 (54%), Gaps = 22/157 (14%)

Query  41   GDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLD-DETLYDVNIDSIFECGYTD  99
            GD++S +S     D N   +       +  GY+ +R +LD D +LY        +CG+TD
Sbjct  52   GDWDSCSS-----DDNECLTTLYTSLKESNGYSDIRTLLDSDTSLYGA------DCGFTD  100

Query  100  PTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLKLLSSANCKKDF-PGTSTK------LD  151
            P    +  P+ G   F+ G +  GPCEIW+DD K+LS+ NC   +  GT  K      +D
Sbjct  101  PNATPKDPPSTGDATFSRGMVHAGPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVD  160

Query  152  YSSC-KGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            YSSC  G CTLR+Y L+  +    S  W+VYKNCV L
Sbjct  161  YSSCPSGGCTLRFYWLAF-QGLDSSTVWQVYKNCVPL  196

>PYIW_27477
Length=180

 Score = 85.1 bits (209),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 74/124 (60%), Gaps = 15/124 (12%)

Query  61   ADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYM  119
            A+ A   K+KG+ +LR+ ++D+           +CG TDP  +++ IP++  ++F+   +
Sbjct  39   ANFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFSRAIV  89

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGT--STKLDYSSCKGECTLRWYALSVSKTTGGSYS  177
              GPCE+WIDD +++   NC+K F     + K+D+S+CKG+C LRW+ L +  +      
Sbjct  90   HPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDS---GKR  146

Query  178  WEVY  181
            W+VY
Sbjct  147  WQVY  150

>PYU1_G005324
Length=191

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A    +KGY  L++ LD +            CG T    +++ IP +G L+F   
Sbjct  57   TGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASS  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            M+  GPCEIW+ + +   + +C+K F   TS K+D+S+CKG C LR+Y L +     G  
Sbjct  108  MEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNCV L
Sbjct  165  RWQSYKNCVPL  175

>PYU1_G005326
Length=191

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A    +KGY  L++ LD +            CG T    +++ IP +G L+F   
Sbjct  57   TGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASS  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            M+  GPCEIW+ + +   + +C+K F   TS K+D+S+CKG C LR+Y L +     G  
Sbjct  108  MEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNCV L
Sbjct  165  RWQSYKNCVPL  175

>PYU1_G005328
Length=191

 Score = 84.7 bits (208),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A    +KGY  L++ LD +            CG T    +++ IP +G L+F   
Sbjct  57   TGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASS  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            M+  GPCEIW+ + +   + +C+K F   TS K+D+S+CKG C LR+Y L +     G  
Sbjct  108  MEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNCV L
Sbjct  165  RWQSYKNCVPL  175

>PHYRA_86016
Length=236

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 68/120 (57%), Gaps = 20/120 (17%)

Query  83   TLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLLS  135
            ++ DV +D + +  CGYT    + QPIPT+GK+++      G+   GPCEI+IDD  +L 
Sbjct  8    SVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLH  67

Query  136  SANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +C++++PG        +   +DYSSC GECTL  Y L+       +  W+ Y NCV L
Sbjct  68   GDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQ-----NAQWQAYVNCVPL  122

>PHYRA_86752
Length=300

 Score = 85.9 bits (211),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 72/141 (51%), Gaps = 20/141 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + QPIPT+GK+++    
Sbjct  51   DIGSGGDQVGKYKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNG  110

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCEI+IDD  +L   +C++++PG        +   +DYSSC GECTL  Y L
Sbjct  111  GGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWL  170

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
            +          W+ Y NCV L
Sbjct  171  AFQNA-----QWQAYVNCVPL  186

>PYIR_16444
Length=182

 Score = 83.2 bits (204),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 17/136 (13%)

Query  56   NVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF  115
            N     + A   KQKG+ +LR+ ++++            CG T+     +PIP++GK+ F
Sbjct  57   NWKDPKNFAKVAKQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHF  107

Query  116  T-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTST---KLDYSSCKGECTLRWYALSVSKT  171
            +   +  GPCE+W+D+ ++  + NC+  F G+     K+D+SSCKG C LR++ L +   
Sbjct  108  SRAIVHPGPCELWLDNKRVYQNDNCEGVF-GSKIPVWKIDWSSCKGNCMLRFFWLGLQDQ  166

Query  172  TGGSYSWEVYKNCVAL  187
                  W+VYKNCV +
Sbjct  167  ---GKRWQVYKNCVPV  179

>PYU1_G005325
Length=207

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A    +KGY  L++ LD +            CG T    +++ IP +G L+F   
Sbjct  57   TGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFASS  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            M+  GPCEIW+ + +   + +C+K F   TS K+D+S+CKG C LR+Y L +     G  
Sbjct  108  MEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNC+ L
Sbjct  165  RWQSYKNCIPL  175

>PHYSO_533903
Length=208

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 75/147 (51%), Gaps = 26/147 (18%)

Query  56   NVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLR  114
            N   S +V   LK    +  L+ MLDD +LY        +CG+TDP    QPIPT+GK  
Sbjct  59   NTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAV  112

Query  115  FT-GYMKDGPCEIWIDDLKLL-----------SSANCKKDFPGTSTKLDYSSCK-GEC-T  160
            F+ G +  GPCE W+DD K+L           S+ N K +FP     +DYSSC+ G C  
Sbjct  113  FSRGLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFP-----IDYSSCENGGCKM  167

Query  161  LRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +R+Y L           W+ YK+C+ L
Sbjct  168  MRFYWLGFQALDDKKTVWQTYKDCIPL  194

>PHYCA_69583
Length=224

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 18/132 (14%)

Query  68   KQKGYAS-LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
            K+ GYA+ +R +LD +T LY  N      CG+++P  +++  P++G   F  G    GPC
Sbjct  73   KEAGYANNIRKLLDSDTNLYGAN------CGFSNPDAKAKDPPSDGTATFERGLAHHGPC  126

Query  125  EIWIDDLKLLSSANCKKDF--------PGTSTKLDYSSCKGE-CTLRWYALSVSKTTGGS  175
            EIW+DD  +L + +C K F              +DYSSC    C  R+Y L+   +T G 
Sbjct  127  EIWLDDAMVLHNDDCAKAFSVPDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGK  186

Query  176  YSWEVYKNCVAL  187
            Y W++YK+C+ L
Sbjct  187  YVWQIYKDCIPL  198

>PHYSO_255056
Length=269

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 70/123 (57%), Gaps = 14/123 (11%)

Query  68   KQKGYAS-LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
            K+ GYA+ +R +LD +T LY        +CG+++P  + +  PT+G   F  G    GPC
Sbjct  74   KEAGYANNIRKLLDSDTNLYGA------DCGFSNPDAKPKDPPTDGTATFERGLAHHGPC  127

Query  125  EIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNC  184
            EIW+DD  +L + +C K F    +  DY S  G C  R+Y L+   +T G Y W++YKNC
Sbjct  128  EIWLDDTMVLHNDDCAKAF----SVEDYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNC  182

Query  185  VAL  187
            + L
Sbjct  183  IPL  185

>PYVX_14662
Length=540

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 72/128 (56%), Gaps = 16/128 (13%)

Query  69   QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIW  127
            +KG   +R++LDD ++Y  +      CG+TDP   +Q IPT+GK  F+ G +  GPCEIW
Sbjct  73   EKGVTEIRSLLDDTSIYGQD------CGFTDPDGTAQDIPTDGKATFSRGMVHVGPCEIW  126

Query  128  IDDLKLLSSANCKKDFPGTSTK------LDYSSCK-GEC-TLRWYALSVSKTTGGSYSWE  179
            +DD  +L   +C   + G          +DYSSC  G C  +R+Y L+     G +  W+
Sbjct  127  LDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRFYWLAFQGVDGDTV-WQ  185

Query  180  VYKNCVAL  187
            VYKNC+ L
Sbjct  186  VYKNCIPL  193

>PHYRA_83499
Length=473

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 92/189 (49%), Gaps = 25/189 (13%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + QPIPT+GK+++    
Sbjct  51   DIGSGGDQVGKYKTMAAEKKMSVRDVVLDMVKDKKCGYTRTDVDPQPIPTDGKVKWWGNG  110

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCEI+IDD  +L   +C++++PG        +   +DYSSC GECTL  Y L
Sbjct  111  GGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWL  170

Query  167  SVSKTTGGSYSWEVYKNCVALsdeptatteapedtseALTTVDNAAADTTHRRPSPVSQL  226
            +          W+ Y NCV+L    +AT    +      ++ +++A   T   PS  +Q 
Sbjct  171  AFQNA-----QWQAYVNCVSLKGSGSATQTQTQT-----SSAESSADQQTTEAPSTETQS  220

Query  227  SSKSGVARE  235
            ++ S    E
Sbjct  221  AAGSSTGNE  229

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (49%), Gaps = 13/68 (19%)

Query  122  GPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTG  173
            GPCEI++DD  +L   NC+ ++ G        +   +DYSSC G CTL  Y L       
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNE--  408

Query  174  GSYSWEVY  181
                W+ Y
Sbjct  409  ---QWQAY  413

>PYAP_18709
Length=235

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 70/131 (53%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A     KG+  LR+ L+D+            CG + P    +PIP++G ++    
Sbjct  56   TGAQYAAVAPGKGFKDLRSFLEDKGP---------TCGNSLPNASPKPIPSDGTIKLAST  106

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            ++  GPCE+W+D+ +   + +C+K F   TS K+D+ +CKG C LR+Y L +     G  
Sbjct  107  IEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQD---GGK  163

Query  177  SWEVYKNCVAL  187
             W+ YKNC+ L
Sbjct  164  RWQSYKNCIPL  174

>PPTG_04622
Length=273

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 72/130 (55%), Gaps = 17/130 (13%)

Query  68   KQKGYASLRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            +  GY+ +RA+LD +T LY  N      CG+TDP    +  PT G   F+ G +  GPCE
Sbjct  74   ESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRGMVHAGPCE  127

Query  126  IWIDDLKLLSSANCK-------KDFPGTSTKLDYSSCK-GECTLRWYALSVSKTTGGSYS  177
            IW+DD  +LS+ +C+       +D     T +DYSSC  G C LR+Y L+  +       
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAF-QGVDSKMV  186

Query  178  WEVYKNCVAL  187
            W+VYK+CV L
Sbjct  187  WQVYKDCVPL  196

>PHYRA_73607
Length=343

 Score = 84.7 bits (208),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 71/128 (55%), Gaps = 17/128 (13%)

Query  70   KGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIW  127
             GY+ +R +LD D +LY  +      CG+T+P   ++  PT G   F+ G +  GPCEIW
Sbjct  76   NGYSDIRTLLDSDTSLYGAD------CGFTNPDATAKDPPTTGDATFSRGMVHVGPCEIW  129

Query  128  IDDLKLLSSANC-------KKDFPGTSTKLDYSSCKGE-CTLRWYALSVSKTTGGSYSWE  179
            +DD K+LS+ NC        +D     T +DYSSC    C LR+Y L+  +    S  W+
Sbjct  130  LDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAF-QGVDSSMVWQ  188

Query  180  VYKNCVAL  187
            VYKNCV L
Sbjct  189  VYKNCVPL  196

>PHYCA_12942
Length=353

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 22/164 (13%)

Query  33   PEPFFLLDGDYESAASVARLED-QNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDS  91
            P+P F    D  SA  V  +++  ++ +  D  G  K K  A+ R M   + + D+  D 
Sbjct  29   PKPTF----DGSSAEWVTMIDNYWDIGSGGDQVG--KFKTMAAERGMSVKDVILDMVKDK  82

Query  92   IFECGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCEIWIDDLKLLSSANCKKDFPGT  146
              +CGYT      QPIP++G +++ G     +   GPCEI+IDD  +L   NC+++F G 
Sbjct  83   --KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGG  140

Query  147  ST---KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             T   K+DYSSC G C L  Y L           W+ Y NCV L
Sbjct  141  DTSDMKIDYSSCNGNCMLTIYWLGFQNA-----QWQAYVNCVPL  179

>PYIW_19151
Length=248

 Score = 82.8 bits (203),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 15/129 (12%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD  121
            + A   K+KG+++LR+ L+D+            CG+TDP    + IP +  +RF+  +  
Sbjct  60   NFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFSRDIPH  110

Query  122  -GPCEIWIDDLKLLSSANCKKDFPGT--STKLDYSSCKGECTLRWYALSVSKTTGGSYSW  178
             GPCE++IDD ++  + +C+  F G   S  +D+S CKGEC +R+Y L +  +      W
Sbjct  111  PGPCELYIDDTRVYQNDDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQAS---GTRW  167

Query  179  EVYKNCVAL  187
            +VYK+CV +
Sbjct  168  QVYKSCVPV  176

>PHYRA_79140
Length=424

 Score = 84.7 bits (208),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 20/120 (17%)

Query  83   TLYDVNIDSI--FECGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLLS  135
            T+ DV +D +   +CG TD +   QPIP++GK ++      G+   GPCEI++DD  +L 
Sbjct  72   TVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLH  131

Query  136  SANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            S NC+ D+PG        +   +DYSSC G+CTL  Y L+          W+ Y NCV L
Sbjct  132  SDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQN-----AQWQAYVNCVPL  186

>PYAR_14260
Length=212

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A     KG+ +LR+ L+ +            CG +  + + +PIP++G ++F   
Sbjct  33   TGAQYAAVAPGKGFKNLRSFLESKGP---------TCGNSLSSAKPKPIPSDGMVKFAST  83

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            ++  GPCEIW+D+     S +C+K F   TS K+++S+CKG C LR+Y L +  +     
Sbjct  84   LEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQDS---GT  140

Query  177  SWEVYKNCVAL  187
             W+ YKNCV L
Sbjct  141  RWQSYKNCVPL  151

>PYU1_G014690
Length=295

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 72/131 (55%), Gaps = 17/131 (13%)

Query  61   ADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYM  119
            A+ A   K+KG+ +LR+ ++D+            CG TDP    + IP++ K+ F+   +
Sbjct  61   ANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFSRPIV  111

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTST---KLDYSSCKGECTLRWYALSVSKTTGGSY  176
              GPCEIW+DD +++   +C+  F G       +D+SSCK  C LR++ L +  +     
Sbjct  112  HPGPCEIWLDDKRVMQDDDCEATF-GDEIPVWNIDFSSCKSNCMLRFFWLGLQDS---GT  167

Query  177  SWEVYKNCVAL  187
             W+VYKNCV L
Sbjct  168  RWQVYKNCVPL  178

>PHYRA_77971
Length=230

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 21/121 (17%)

Query  83   TLYDVNIDSIF---ECGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCEIWIDDLKLL  134
            ++ DV +D +    +CG+T    + QP+PTNGK  + G     Y   GPCE++IDD  +L
Sbjct  72   SVRDVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVL  131

Query  135  SSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVA  186
             S NC+ D+PG        +   +DYSSC G+CT   Y L           W+ Y NCV 
Sbjct  132  HSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNA-----QWQAYINCVP  186

Query  187  L  187
            L
Sbjct  187  L  187

>PHYRA_85794
Length=230

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 21/121 (17%)

Query  83   TLYDVNIDSIF---ECGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCEIWIDDLKLL  134
            ++ DV +D +    +CG+T    + QP+PTNGK  + G     Y   GPCE++IDD  +L
Sbjct  72   SVRDVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVL  131

Query  135  SSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVA  186
             S NC+ D+PG        +   +DYSSC G+CT   Y L           W+ Y NCV 
Sbjct  132  HSDNCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNA-----QWQAYINCVP  186

Query  187  L  187
            L
Sbjct  187  L  187

>PITG_04948
Length=232

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 72/124 (58%), Gaps = 19/124 (15%)

Query  75   LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R +LD D +LY        +CGYT+P    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  T+        +DYSSC  G C LR+Y L++ +  G +Y W+VYKN
Sbjct  133  VLQNDDCQSAY-GDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTY-WQVYKN  190

Query  184  CVAL  187
            C+ L
Sbjct  191  CIPL  194

>PHYSO_533682
Length=278

 Score = 81.6 bits (200),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 24/135 (18%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
            F     +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK  F+ G +  GPC
Sbjct  69   FKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHVGPC  122

Query  125  EIWIDDLKLLSSANCKKDFPG------TSTKLDYSSC-KGECT-LRWYALS----VSKTT  172
            EIW+DD K+LS  +C   +        T+  +DYSSC  G C  +R Y L     V KT 
Sbjct  123  EIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVDKTV  182

Query  173  GGSYSWEVYKNCVAL  187
                 W+ YKNC+ L
Sbjct  183  -----WQSYKNCIPL  192

>PHYRA_83500
Length=394

 Score = 82.8 bits (203),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 20/120 (17%)

Query  83   TLYDVNIDSI--FECGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLLS  135
            T+ DV +D +   +CG TD +   QPIP++GK ++      G+   GPCEI++DD  +L 
Sbjct  72   TVRDVVLDIVKGQKCGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLH  131

Query  136  SANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            S NC+ D+PG        +   +DYSSC G+CTL  Y L+          W+ Y NC  L
Sbjct  132  SDNCQDDYPGGDVGSTQTSDMPVDYSSCNGKCTLTIYWLAFQNA-----QWQAYVNCAPL  186

>PYU1_G007364
Length=316

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 68/132 (52%), Gaps = 24/132 (18%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM  119
            F     YASLR +L              +CG T      +PIP++G + +       G++
Sbjct  83   FQASGKYASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEGFV  133

Query  120  KD--GPCEIWIDDLKLLSSANCKKDFPGTST--KLDYSSCKGECTLRWYALSVSKTTGGS  175
                GPCEIW+DD  +L   NC   FPG     K+D+SSC G+C +R+Y L++ +     
Sbjct  134  PSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQEP----  189

Query  176  YSWEVYKNCVAL  187
             +W++YKNC+ L
Sbjct  190  -AWQIYKNCIPL  200

>PHYRA_78175
Length=319

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 15/131 (11%)

Query  65   GFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGY  118
            GF   K Y+SL+  + D+ L  VN +   ECGYT+P   +QP+P      ++G       
Sbjct  72   GFAASK-YSSLKEFMADK-LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTA  129

Query  119  MKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSY  176
              +GPCE+W DD ++    NC K+FP    KL Y   +C G   L  Y +++      S 
Sbjct  130  SHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH-----SA  184

Query  177  SWEVYKNCVAL  187
            SW+VY NC AL
Sbjct  185  SWQVYINCAAL  195

>PPTG_03139
Length=320

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 15/131 (11%)

Query  65   GFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGY  118
            GF   K Y+SL+  + D+ +  V+ D   ECGYT+P    QP+P      ++G       
Sbjct  72   GFAASK-YSSLKEFMTDKMVL-VSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTA  129

Query  119  MKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSY  176
              +GPCE+W DD ++    NC K+FP    KL  D+ +C G   L  Y +++      S 
Sbjct  130  SHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH-----SP  184

Query  177  SWEVYKNCVAL  187
            SW+VY NC AL
Sbjct  185  SWQVYINCAAL  195

>PHYRA_83494
Length=224

 Score = 80.1 bits (196),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (53%), Gaps = 21/121 (17%)

Query  83   TLYDVNIDSIFE---CGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLL  134
            ++ DV +D + E   CG TD +   Q +PT+GK ++      G+   GPCEI+IDD  +L
Sbjct  8    SVRDVVLDMVGEDKKCGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVL  67

Query  135  SSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVA  186
               NC+ D+PG        +   +DYSSC G+CT   Y L+       +  W+ Y NCV 
Sbjct  68   HGDNCEDDYPGGDVGSTVTSDMPVDYSSCNGDCTFTIYWLAFQ-----NAQWQAYVNCVP  122

Query  187  L  187
            L
Sbjct  123  L  123

>PHYRA_73584
Length=287

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 17/130 (13%)

Query  68   KQKGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            K  GY+ +R +LD D TLY  N      CG+T+P   ++  PT G   F+ G +  GPCE
Sbjct  71   KSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRGMVHAGPCE  124

Query  126  IWIDDLKLLSSANCKKDFPGTS-------TKLDYSSCKGE-CTLRWYALSVSKTTGGSYS  177
            IW+DD  +LS+ +C+  +   S       T +DYSSC    C LR+Y L+       +  
Sbjct  125  IWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSKTV-  183

Query  178  WEVYKNCVAL  187
            W+VYK+CV L
Sbjct  184  WQVYKDCVPL  193

>PHYCA_534473
Length=1050

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 17/134 (13%)

Query  64   AGFLKQKGYASLRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKD  121
            A   +  GY+ +R +LD +T LY  N      CG+TDP   ++  PT G   F+ G +  
Sbjct  842  ASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVHA  895

Query  122  GPCEIWIDDLKLLSSANCKKDF-PGTSTK------LDYSSCKGE-CTLRWYALSVSKTTG  173
            GPCEIW+DD K+LS+ +C+  +  GT  K      +DYSSC    C LR+Y L+  +   
Sbjct  896  GPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAF-QGVD  954

Query  174  GSYSWEVYKNCVAL  187
                W+VYK+CV L
Sbjct  955  SKIVWQVYKDCVPL  968

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 19/131 (15%)

Query  68   KQKGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            K      +R M+D D  LY  +      CG TDP  + +  P+ G   F+ G +  GPCE
Sbjct  541  KSNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGIVHAGPCE  594

Query  126  IWIDDLKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSY  176
            IW+DD  +L + +C+  + G  TK        +DYSSC  G C  R+Y L++ +    + 
Sbjct  595  IWLDDEMVLQNDDCQSAY-GDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTL  653

Query  177  SWEVYKNCVAL  187
             W+VYKNC+ L
Sbjct  654  -WQVYKNCIPL  663

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 63/114 (55%), Gaps = 18/114 (16%)

Query  75   LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R +LD +T LY  +      CGYT+P    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  285  IRTLLDSDTKLYGAD------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  338

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYS  177
            +LS+ +C+  + G  T+        +DYSSC  G C  R+Y L++ +  GG  S
Sbjct  339  VLSNDDCQSAY-GDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGGGAS  391

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 17/119 (14%)

Query  69   QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIW  127
            +  Y  +R ++D   +Y  +      CG+TDP       PT+G   F+ G +  GPCEIW
Sbjct  73   KNNYKDVRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIW  126

Query  128  IDDLKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYS  177
            +DD  +L + +C+  + G  T+        +DYSSC  G C LR+Y L++ +  GG  S
Sbjct  127  LDDKMVLQNDDCQAAY-GDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLKGGGAS  184

>PYIW_15526
Length=256

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 75/150 (50%), Gaps = 33/150 (22%)

Query  51   RLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN  110
            R  +QN   +A+      + GY SL+ MLD          S+  CGYT+P   + P+  +
Sbjct  59   RSPEQN---AAEFTAAWPKTGYTSLKEMLDK---------SVSGCGYTNP--NAAPVDVS  104

Query  111  G-----------KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPG--TSTKLDYSSCKG  157
            G           K  F G  + GPCE WID+ K+  + +C K +PG   +  +DYS CKG
Sbjct  105  GLKSMKYQNNEYKEGFLGSHR-GPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKG  163

Query  158  ECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             C L +Y L+V      S  W+VYK CVA+
Sbjct  164  TCRLTFYWLAVH-----SPKWQVYKGCVAI  188

>PPTG_07509
Length=299

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + +PIP +GK+++    
Sbjct  50   DIGSGGDQVGKFKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDPKPIPADGKVKWWGNG  109

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCE++IDD  +L   NC++DFPG        +   +D+SSC G+CTL  Y L
Sbjct  110  GGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWL  169

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
                    +  W+ Y NCV L
Sbjct  170  GFQ-----NAQWQAYVNCVPL  185

>PPTG_07507
Length=299

 Score = 80.9 bits (198),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + +PIP +GK+++    
Sbjct  50   DIGSGGDQVGKFKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDPKPIPADGKVKWWGNG  109

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCE++IDD  +L   NC++DFPG        +   +D+SSC G+CTL  Y L
Sbjct  110  GGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWL  169

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
                    +  W+ Y NCV L
Sbjct  170  GFQ-----NAQWQAYVNCVPL  185

>PHYSO_485524
Length=278

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 71/124 (57%), Gaps = 19/124 (15%)

Query  75   LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R +LD +T LY  N      CGYT+P    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  79   IRTLLDSDTKLYGAN------CGYTNPDATPEDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  T+        +DYSSC  G C  R+Y L++ +  G +Y W+VYKN
Sbjct  133  VLQNDDCQSAY-GDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTY-WQVYKN  190

Query  184  CVAL  187
            C+ L
Sbjct  191  CIPL  194

>PYIR_16443
Length=275

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 16/133 (12%)

Query  56   NVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF  115
            N     + A   KQKG+ +LR+ ++D+            CG T+P    + IP++  ++F
Sbjct  57   NWKDPKNFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKF  107

Query  116  T-GYMKDGPCEIWIDDLKLLSSANCKKDFPGT--STKLDYSSCKGECTLRWYALSVSKTT  172
            +   +  GPCEIW+DD +++   NC+  F     + K+D+SSCKG C LRW+ L +  + 
Sbjct  108  SRAIVHPGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDS-  166

Query  173  GGSYSWEVY-KNC  184
                 W+VY K+C
Sbjct  167  --GKRWQVYSKSC  177

>PYAP_19707
Length=241

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 7/96 (7%)

Query  94   ECGYTDPTYESQPIPTNGKLRF-TGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY  152
            +CG TD     QPIPT+G L F    +  GPCE+W+D+ K+ S+  C K+FP    K+D+
Sbjct  68   KCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEFPNKRIKVDF  127

Query  153  SSCK-GECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            + CK G C LRW  ++   +      WE + NCV +
Sbjct  128  AKCKSGSCQLRWVWMATHTS-----PWEFFDNCVRV  158

>PHYRA_73606
Length=366

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 22/157 (14%)

Query  41   GDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLD-DETLYDVNIDSIFECGYTD  99
            GD+++ +S    +D +  TS    G     GY+ +R +LD D +LY        +CGYT+
Sbjct  52   GDWDTCSS----DDSDCLTSV-YTGLKSSNGYSDIRTLLDSDTSLYGA------DCGYTN  100

Query  100  PTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLKLLSSANC-------KKDFPGTSTKLD  151
            P   ++  PT G   F+ G +  GPCEIW+DD  +LS+ +C        +D     T +D
Sbjct  101  PDATAKDPPTTGDATFSRGMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVD  160

Query  152  YSSCKGE-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            YSSC    C LR+Y L+  +       W+VYK+CV L
Sbjct  161  YSSCSTSGCMLRFYWLAF-QGVDSEIVWQVYKDCVPL  196

>H257_13550
Length=266

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 75/145 (52%), Gaps = 25/145 (17%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKL  113
            D+NV          +  G+ +LRAMLD +           +CGY+     ++PIP++G +
Sbjct  89   DKNVAAFNKAFRDQQATGFKTLRAMLDPQGP---------DCGYSKLDVPAKPIPSDGNV  139

Query  114  RFT------GYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGECTLR  162
             +       G++    GPCEIW+D+ ++  + +C  +F   P     +D++SC G CT+R
Sbjct  140  VWQNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAAHLPVDFASCVGSCTIR  199

Query  163  WYALSVSKTTGGSYSWEVYKNCVAL  187
            +Y +++ +       W+VYKNC  L
Sbjct  200  FYWIALHQDL-----WQVYKNCAPL  219

>PPTG_04619
Length=276

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 19/124 (15%)

Query  75   LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R +LD D +LY        +CGYT+P    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  79   IRTLLDSDTSLYGA------DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  132

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  T+        +DYSSC  G C  R+Y L++ +  G +Y W+VYKN
Sbjct  133  VLQNDDCQSAY-GDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTY-WQVYKN  190

Query  184  CVAL  187
            C+ L
Sbjct  191  CIPL  194

>PYIR_19612
Length=260

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 70/119 (59%), Gaps = 15/119 (13%)

Query  68   KQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD-GPCEI  126
            K+KG+A+LR+ L+D+            CG+TDP    + IP + K+RF+  +   GPCE+
Sbjct  68   KEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFSRDISHPGPCEL  118

Query  127  WIDDLKLLSSANCKKDFPGT--STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKN  183
            WIDD ++  + +C+  F G   S  +D++ C G+C +R+Y LS+  +      W+VY++
Sbjct  119  WIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQAS---GTRWQVYRS  174

>PHYSO_459106
Length=223

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 70/124 (56%), Gaps = 19/124 (15%)

Query  75   LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R M+D +T LY        +CG+TDP  + Q  PT G   F+ G +  GPCEIW+DD  
Sbjct  79   IRTMIDSDTKLYGE------DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEIWLDDKM  132

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  TK        +DYSSC  G C  R+Y L++ +    +Y W+VYKN
Sbjct  133  VLQNDDCQSAY-GDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTY-WQVYKN  190

Query  184  CVAL  187
            C+ L
Sbjct  191  CIPL  194

>PHYKE_10578
Length=239

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 83/173 (48%), Gaps = 33/173 (19%)

Query  33   PEPFFLLDGDYESAASVAR---LEDQ--NVTTSADVAGFLKQKGYASLRAMLDDETLYDV  87
            PEP F      E  AS +    L D   ++ +  D  G  K K  A+ + M   + + D+
Sbjct  29   PEPTF------EQGASHSNWVTLVDNYWDIGSGGDQVG--KFKTMATEKGMSVKDVILDM  80

Query  88   NIDSIFECGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLLSSANCKKD  142
              D   +CG+T    + QP+P++GKL +      G+   GPCE++IDD  +L   NC+ +
Sbjct  81   VKDK--KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDE  138

Query  143  FPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +PG        +   +DYSSC G+C L +Y L           W+ Y NCV L
Sbjct  139  YPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQNE-----QWQSYVNCVPL  186

>PHYKE_2809
Length=291

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 19/124 (15%)

Query  75   LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R MLD +T LY        +CG+TDP    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  66   IRTMLDSDTKLYGQ------DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIWLDDKM  119

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  TK        +DYSSC  G C  R+Y L++    G  + W+VYKN
Sbjct  120  VLQNDDCQSAY-GDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKF-WQVYKN  177

Query  184  CVAL  187
            CV L
Sbjct  178  CVPL  181

>PHYSO_340332
Length=295

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 75/149 (50%), Gaps = 27/149 (18%)

Query  54   DQNVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK
Sbjct  56   DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANC-----------KKDFPGTSTKLDYSSC-KGEC  159
              F+   +  GPCEIW+DD K+L   +C           K  FP     +DYSSC  G C
Sbjct  110  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFP-----VDYSSCDNGGC  164

Query  160  T-LRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +R+Y L+     G +  W+ YK+C+ L
Sbjct  165  KEMRFYWLAFQGVDGKTV-WQSYKDCIPL  192

>PHYSO_340333
Length=284

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 74/144 (51%), Gaps = 17/144 (12%)

Query  54   DQNVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK
Sbjct  56   DGNNAGSVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL------DYSSC-KGECT-LRW  163
              F+   +  GPCEIW+DD K+L   +C   +   +  +      DYSSC  G C  +R+
Sbjct  110  ATFSRAIVHVGPCEIWLDDKKVLYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRF  169

Query  164  YALSVSKTTGGSYSWEVYKNCVAL  187
            Y L+     G +  W+ YK+C+ L
Sbjct  170  YWLAFQGVDGKTV-WQSYKDCIPL  192

>PHYKE_6001
Length=289

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/147 (33%), Positives = 75/147 (51%), Gaps = 19/147 (13%)

Query  53   EDQNVTTSADVAGF---LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT  109
            ED +   +  V  F    K   Y  L+ ++DD ++Y        +CG+TDP    QPIP+
Sbjct  53   EDWDGNNAQSVTAFNALKKANNYVDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPS  106

Query  110  NGKLRFTGYMKD-GPCEIWIDDLKLLSSANCKKDFPGTSTK------LDYSSCK-GECT-  160
            +GK  ++  ++  GPCEIW+DD  + S  +C   +   +        +DYSSC  G C  
Sbjct  107  DGKATYSRAIQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKE  166

Query  161  LRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +R+Y L+     G +  W+ YKNC+ L
Sbjct  167  MRFYWLAFQGVDGKTV-WQSYKNCIPL  192

>PYIR_24743
Length=357

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 77/156 (49%), Gaps = 21/156 (13%)

Query  43   YESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTY  102
            Y +  S A     N    A+V  F K     + +   + +TL D+  D   +CG + P  
Sbjct  54   YTATMSPAFQGKFNDNPQANVDTFTK-----AFQGQSEFKTLRDLLKDHGADCGDSKPDA  108

Query  103  ESQPIPTNGKLRFT------GYM--KDGPCEIWIDDLKLLSSANCKKDF---PGTSTKLD  151
              + IP +GK+ +       G++    GPCEIW+DD ++ S  NC   F   P     +D
Sbjct  109  SRKAIPGDGKVVWQNPDTGEGFVPSHTGPCEIWLDDKRVFSDENCAGHFTSKPKAELPVD  168

Query  152  YSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +SSCK  C LR+Y L++ + T     W+VYKNCV L
Sbjct  169  FSSCKENCMLRFYWLALHEPT-----WQVYKNCVPL  199

>PHYCA_98479
Length=276

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 70/148 (47%), Gaps = 21/148 (14%)

Query  56   NVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIF---ECGYTDPTYESQPIPTNGK  112
            NV    D+     Q G     A     ++ DV +D +    ECG+T      QP+PT+G 
Sbjct  44   NVDNYWDIGSGGDQCGLFKTMAEEKGVSVKDVVLDMVGSGKECGHTLADGSRQPVPTDGL  103

Query  113  LRFTG-----YMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGEC  159
             ++ G     +   GPCEI+IDD  +L   NC+ ++PG        +   +DYSSCKG+C
Sbjct  104  AKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYPGGDVGSTVTSDMPVDYSSCKGDC  163

Query  160  TLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            TL  Y L           W+ Y NCV L
Sbjct  164  TLTIYWLGFQNA-----QWQAYINCVPL  186

>PHYCA_19611
Length=531

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 65/126 (52%), Gaps = 18/126 (14%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGYMKDGPCE  125
            Y SL+  ++D+ +  VN +   ECGYT+P    QP+P      ++G         +GPCE
Sbjct  285  YTSLKEFMNDKMVL-VNKEFTKECGYTNPKEAPQPVPKTYVEWSHGDGEGFTQSHEGPCE  343

Query  126  IWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKG--ECTLRWYALSVSKTTGGSYSWEVY  181
            +W DD ++    NC K+FP    K+ Y   +C G  + T+ W AL        S SW+VY
Sbjct  344  VWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH-------SPSWQVY  396

Query  182  KNCVAL  187
             NC AL
Sbjct  397  INCAAL  402

 Score = 37.7 bits (86),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (45%), Gaps = 7/76 (9%)

Query  114  RFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYS--SCKGECTLRWYALSVSKT  171
            RF     +GP  +      L    NC  ++P    K+ Y   +C G   L +Y L++  +
Sbjct  70   RFQRRTSNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALHSS  129

Query  172  TGGSYSWEVYKNCVAL  187
            T     W+VY NC AL
Sbjct  130  T-----WQVYTNCAAL  140

>PHYCA_130365
Length=266

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 69/126 (55%), Gaps = 18/126 (14%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            Y  +R+M+D  ++Y        +CG+TDP       PT+G   F+ G +  GPCEIW+DD
Sbjct  75   YKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIVHAGPCEIWLDD  128

Query  131  LKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVY  181
              +L + +C+  + G  T+        +DYSSC  G C LR+Y L + +  G +  W+ Y
Sbjct  129  KMVLQNDDCQSAY-GDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRLDGKTV-WQAY  186

Query  182  KNCVAL  187
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYKE_2937
Length=366

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 70/128 (55%), Gaps = 17/128 (13%)

Query  70   KGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIW  127
             GY+ +R +LD D +LY        +CGYT+P   ++  PT G   F+ G +  GPCEIW
Sbjct  80   NGYSDIRTLLDSDTSLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCEIW  133

Query  128  IDDLKLLSSANC-------KKDFPGTSTKLDYSSCKGE-CTLRWYALSVSKTTGGSYSWE  179
            +DD  +LS+ +C        +D     T +DYSSC    C LR+Y L+  +    S  W+
Sbjct  134  LDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAF-QGVDSSMVWQ  192

Query  180  VYKNCVAL  187
            VYK+CV L
Sbjct  193  VYKDCVPL  200

>PITG_05271
Length=278

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 70/130 (54%), Gaps = 26/130 (20%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            +  L+ ++DD ++Y        +CG+TDP  ++QPIP +GK  F+   +  GPCEIW+DD
Sbjct  75   FKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDD  128

Query  131  LKLLSSANC-----------KKDFPGTSTKLDYSSC-KGECT-LRWYALSVSKTTGGSYS  177
             K+L   +C           K  FP     +DYSSC  G C  +R+Y L+     G +  
Sbjct  129  TKVLYEDDCFSKYGNENQDIKSVFP-----VDYSSCDNGGCKEMRFYWLAFQGVDGKTV-  182

Query  178  WEVYKNCVAL  187
            W+ YK+C+ L
Sbjct  183  WQSYKDCIPL  192

>PITG_11936
Length=333

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 66/131 (50%), Gaps = 15/131 (11%)

Query  65   GFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGY  118
            GF   K Y SL+  ++D  +  VN D   ECGYT+P    QP+P      ++G       
Sbjct  72   GFAASK-YKSLKEFMNDNMVL-VNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTL  129

Query  119  MKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSY  176
              +GPCE++ D+ ++    NC K+FP    KL  D+ +C G   L  Y +++      S 
Sbjct  130  SHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH-----SP  184

Query  177  SWEVYKNCVAL  187
            SW+VY NC  L
Sbjct  185  SWQVYINCAPL  195

>PHYCA_12943
Length=287

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + QPIP++G +++    
Sbjct  53   DIGSGGDQVGKFKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDPQPIPSDGIVKWWGNG  112

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCEI+IDD  +L   +C+ +FPG        +   +D+SSC G+CTL  Y L
Sbjct  113  GGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWL  172

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
            +       +  W+ Y NCV L
Sbjct  173  AFQ-----NEQWQSYVNCVPL  188

>PHYCA_97965
Length=288

 Score = 77.0 bits (188),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D + +  CGYT    + QPIP++G +++    
Sbjct  53   DIGSGGDQVGKFKTMAKEKGMSVKDVVLDMVKDKKCGYTRTDVDPQPIPSDGIVKWWGNG  112

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYAL  166
              G+   GPCEI+IDD  +L   +C+ +FPG        +   +D+SSC G+CTL  Y L
Sbjct  113  GGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWL  172

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
            +       +  W+ Y NCV L
Sbjct  173  AFQ-----NEQWQSYVNCVPL  188

>PHYRA_93650
Length=231

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 66/117 (56%), Gaps = 14/117 (12%)

Query  69   QKGYAS-LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            + GYA+ +R +LD D +LY        +CG++DP  +++  P++G   F  G    GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  126  IWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYK  182
            IW+DD  +L + +C K F    +  DY S  G C  R+Y L+   +T G Y W++YK
Sbjct  128  IWLDDTMVLHNDDCAKAF----SVEDYMSING-CMFRFYWLAFQGSTSGKYVWQIYK  179

>PPTG_04647
Length=327

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 17/128 (13%)

Query  70   KGYASLRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIW  127
             GY+ +R +LD +T LY        +CGYT+P   ++  PT G   F+ G +  GPCEIW
Sbjct  75   NGYSDIRTLLDSDTDLYGA------DCGYTNPDATAKDPPTTGDATFSRGMVHVGPCEIW  128

Query  128  IDDLKLLSSANC-------KKDFPGTSTKLDYSSCKGE-CTLRWYALSVSKTTGGSYSWE  179
            +DD  +LS+ NC         D     T +DYSSC    C LR+Y L+  +       W+
Sbjct  129  LDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAF-QGVDSKMVWQ  187

Query  180  VYKNCVAL  187
            VYK+CV L
Sbjct  188  VYKDCVPL  195

>PHYRA_73583
Length=630

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 70/124 (56%), Gaps = 19/124 (15%)

Query  75   LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R +LD D TLY  N      CGYT+P    +  P+ G   F+ G +  GPCEIW+DD  
Sbjct  79   IRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGPCEIWLDDKM  132

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  T+        +DYSSC  G C  R+Y L++ +  G ++ W+VYKN
Sbjct  133  VLQNDDCQSAY-GDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTW-WQVYKN  190

Query  184  CVAL  187
            C+ L
Sbjct  191  CIPL  194

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 69/124 (56%), Gaps = 19/124 (15%)

Query  75   LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R M+D +T LY        +CG+TDP    +  P+ G   F+ G +  GPCE+W+DD  
Sbjct  380  IRTMIDSDTKLYGA------DCGFTDPKATPKDPPSTGDATFSRGMVHAGPCEVWLDDEM  433

Query  133  LLSSANCKKDFPGTSTK--------LDYSSCK-GECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  TK        +DYSSC  G C  R++ L++ +    ++ W+VYKN
Sbjct  434  VLQNDDCQSAY-GDGTKATLSVFKPIDYSSCPAGGCMFRFFWLALQRRDSKTW-WQVYKN  491

Query  184  CVAL  187
            CV L
Sbjct  492  CVPL  495

>PYAR_14256
Length=199

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 64/135 (47%), Gaps = 13/135 (10%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKL  113
            D    T A  A     KG+ +LRA L+D+            CG T P  + +P       
Sbjct  48   DGTFRTGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIK  98

Query  114  RFTGYMKDGPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTT  172
              +     GPCEIW+DD       +C+K F   TS K+D+S+CKG C LR+Y L +  + 
Sbjct  99   LASTIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNS-  157

Query  173  GGSYSWEVYKNCVAL  187
                 W+ YKNC+ L
Sbjct  158  --GKRWQSYKNCIPL  170

>PYIW_24289
Length=196

 Score = 75.1 bits (183),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 10/118 (8%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDL  131
            Y +LR ++D + ++    D   ECG+T+ T   QP+  +    FT     GPCEIW D +
Sbjct  87   YRNLRDLIDTKAVFSAGTDK--ECGFTNVTSAKQPLSAHATGGFTP-THQGPCEIWCDRV  143

Query  132  KLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             +  + NC K++P    +L Y  S C G   L++Y L+V      S  WE Y NC  L
Sbjct  144  LVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVH-----SIKWEAYINCAPL  196

>PHYKE_3913
Length=321

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 70/124 (56%), Gaps = 19/124 (15%)

Query  75   LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLK  132
            +R + D D +LY  N      CG+T+P    +  PT+G   F+ G +  GPCEIW+DD  
Sbjct  106  IRTLFDSDTSLYGEN------CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKM  159

Query  133  LLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +L + +C+  + G  T+        +DYSSC  G C  R+Y +++ +  G +Y W+VYKN
Sbjct  160  VLQNDDCQSAY-GDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTY-WQVYKN  217

Query  184  CVAL  187
            CV L
Sbjct  218  CVPL  221

>PHYSO_483955
Length=320

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 70/126 (56%), Gaps = 18/126 (14%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            Y  +R+++D   +Y        +CG+TDP  +    PT+G   F+ G +  GPCEIW+DD
Sbjct  76   YKDVRSLMDGNPVYGE------DCGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDD  129

Query  131  LKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVY  181
              +L + +C+  + G  T+        +DYSSC  G C LR+Y L++ +  G +  W+ Y
Sbjct  130  KMVLQNDDCQSAY-GDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTV-WQAY  187

Query  182  KNCVAL  187
            KNC+ L
Sbjct  188  KNCIPL  193

>PHYRA_86241
Length=195

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 66/125 (53%), Gaps = 18/125 (14%)

Query  69   QKGYAS-LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            + GYA+ +R +LD D +LY        +CG++DP  +++  P++G   F  G    GPCE
Sbjct  74   EAGYANNIRKLLDSDTSLYGA------DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCE  127

Query  126  IWIDDLKLLSSANCKKDFP--------GTSTKLDYSSCKGE-CTLRWYALSVSKTTGGSY  176
            IW+DD  +L + +C K F              +DYSSC    C  R+Y L+   +T G Y
Sbjct  128  IWLDDTMVLHNDDCAKAFSVEDYMSIKSVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKY  187

Query  177  SWEVY  181
             W++Y
Sbjct  188  VWQIY  192

>PHYCA_534296
Length=309

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 16/127 (13%)

Query  70   KGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWI  128
              +  L+ ++DD ++Y        +CG+T+P+  +QPIPT+GK  F+   +  GPCEIW+
Sbjct  47   NNFKDLKTLMDDTSVYGA------DCGFTNPSGTAQPIPTDGKATFSRALVHVGPCEIWL  100

Query  129  DDLKLLSSANCKKDFPGTSTKL------DYSSC-KGECT-LRWYALSVSKTTGGSYSWEV  180
            DD K+L   +C   +   +  +      DYSSC  G C  +R+Y L+     G +  W+ 
Sbjct  101  DDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTV-WQS  159

Query  181  YKNCVAL  187
            YK+C+ L
Sbjct  160  YKDCIPL  166

>PYAP_19712
Length=276

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 9/97 (9%)

Query  94   ECGYTDPTYESQPIPTNG--KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLD  151
            +CG TDP    QPIP +G  +L+ T     GPCE+W+D   + S+  C K++P    K+D
Sbjct  71   KCGKTDPNGAVQPIPADGYVQLQITA-AHIGPCELWLDGEMVASAKQCVKEYPDRKIKVD  129

Query  152  YSSCK-GECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +S CK  +C LRW  L+   +      WE+Y NCV +
Sbjct  130  FSKCKSSKCQLRWVWLATHNS-----PWEIYDNCVTV  161

>PHYCA_127270
Length=279

 Score = 75.9 bits (185),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 77/152 (51%), Gaps = 33/152 (22%)

Query  54   DQNVTTSADVAGFLKQ-KGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK
Sbjct  56   DGNNPQSVDTFKSLKAANNFKDLKTLMDDTSVYGA------DCGFTDPNGTPQPIPTDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANC-----------KKDFPGTSTKLDYSSC-KGEC  159
              F+   +  GPCEIW+DD K+L   +C           K  FP     +DYSSC  G C
Sbjct  110  ATFSRALVHVGPCEIWLDDKKVLYEDDCFSKYGNKNQDIKSVFP-----VDYSSCDNGGC  164

Query  160  -TLRWYALS---VSKTTGGSYSWEVYKNCVAL  187
              +R+Y L+   +SK T     W+ YK+C+ L
Sbjct  165  KQMRFYWLAFQGLSKKT----VWQSYKDCIPL  192

>SDRG_17318
Length=241

 Score = 75.1 bits (183),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 26/134 (19%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM  119
            F  Q  Y +LRAMLD             +CG T      + IP+NGK+ F       G++
Sbjct  67   FKAQSKYKTLRAMLDPHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEGFI  117

Query  120  --KDGPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE-CTLRWYALSVSKTTG  173
                GPCE+W+D+ ++  + +C  +F   P  +  +DYSSC  + C LR+Y +++     
Sbjct  118  PSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWIALH----  173

Query  174  GSYSWEVYKNCVAL  187
             S  W+VYKNCV L
Sbjct  174  -SPRWQVYKNCVPL  186

>PHYSO_533747
Length=206

 Score = 74.7 bits (182),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 70/141 (50%), Gaps = 26/141 (18%)

Query  56   NVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLR  114
            N   S +V   LK    +  L+ MLDD +LY        +CG+TDP    QPIPT+GK  
Sbjct  59   NTAKSVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAV  112

Query  115  FT-GYMKDGPCEIWIDDLKLL-----------SSANCKKDFPGTSTKLDYSSCK-GEC-T  160
            F+ G +  GPCE W+DD K+L           S+ N K +FP     +DYSSC+ G C  
Sbjct  113  FSRGLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFP-----IDYSSCENGGCKM  167

Query  161  LRWYALSVSKTTGGSYSWEVY  181
            +R+Y L           W+ Y
Sbjct  168  MRFYWLGFQALDDKKTVWQTY  188

>PYIW_24288
Length=201

 Score = 73.9 bits (180),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 60/130 (46%), Gaps = 15/130 (12%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGYM  119
            F  Q  Y +LR ++D   ++    D   ECG+T  T   QP+P       N   +     
Sbjct  79   FGNQNRYRNLRELVDFTAVFSAGADK--ECGFTSATGAKQPLPAQYVEWNNRVNQGLAPT  136

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYS  177
             +GPCE+W D        NC K+F G   KL Y  S C G   L++Y LS+      S  
Sbjct  137  HEGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSLD-----SRE  191

Query  178  WEVYKNCVAL  187
            WEVY NCV L
Sbjct  192  WEVYINCVPL  201

>PHALS_05392
Length=367

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (56%), Gaps = 18/126 (14%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            +  +R+++D   +Y        +CGYTDP       P+NG+  F+ G +  GPCEIW+DD
Sbjct  159  FKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHAGPCEIWLDD  212

Query  131  LKLLSSANCKKDFPGTSTK--------LDYSSCKGE-CTLRWYALSVSKTTGGSYSWEVY  181
              +L + +C+  + G  T+        +DYSSC  + C LR+Y L++ +  G +  W+ Y
Sbjct  213  KMVLQNDDCQAAY-GDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDGKTV-WQAY  270

Query  182  KNCVAL  187
            KNC+ L
Sbjct  271  KNCIPL  276

>PHYCA_18657
Length=295

 Score = 75.5 bits (184),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 18/107 (17%)

Query  94   ECGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCEIWIDDLKLLSSANCKKDFPG---  145
            +CG+T    + +P+PTNGK  + G     +   GPCE++IDD  +L S +C+ D+PG   
Sbjct  171  KCGFTRTDVDPKPVPTNGKAVWLGNDGGGFTHVGPCELYIDDKMVLHSDDCQADYPGGPN  230

Query  146  -----TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                 +   +DYSSC G+CT   Y L           W+ Y NCV L
Sbjct  231  DSGIMSEMPVDYSSCNGDCTFSIYWLGFQNA-----QWQAYINCVPL  272

>SPRG_19917
Length=241

 Score = 74.7 bits (182),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 26/134 (19%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM  119
            F  Q  Y +LRA+LD             +CG T      + IP+NGK+ F       G++
Sbjct  67   FKAQSKYKTLRALLDQHGP---------DCGNTLTNVARKEIPSNGKMTFQNPDTGEGFI  117

Query  120  --KDGPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE-CTLRWYALSVSKTTG  173
                GPCE+W+D+ ++  + +C  +F   P  +  +DYSSC  + C LR+Y +++     
Sbjct  118  LSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWIALH----  173

Query  174  GSYSWEVYKNCVAL  187
             S  W+VYKNCV L
Sbjct  174  -SPRWQVYKNCVPL  186

>SPRG_19916
Length=305

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (50%), Gaps = 27/151 (18%)

Query  50   ARLEDQNVTTSADV-AGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
             + +D   T  A+    F  Q  + +LR MLD +           +CG T      + IP
Sbjct  50   GKFDDSPQTNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIP  100

Query  109  TNGKLRFT------GYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKG  157
            TNG + +       G++    GPCE+WIDD ++  + +C  +F   P  +  +DYSSC G
Sbjct  101  TNGMMTWQNPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSG  160

Query  158  E-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            + C LR+Y L++ +       W+VYKNCV L
Sbjct  161  DGCMLRFYWLALHEPM-----WQVYKNCVPL  186

>PITG_04949
Length=337

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (56%), Gaps = 18/126 (14%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            +  +R+++D   ++        ECG+TDP  +    P++G   F+ G +  GPCEIW+DD
Sbjct  76   FKDVRSLMDGNPVFGE------ECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDD  129

Query  131  LKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVY  181
              +L + +C+  + G  T+        +DYSSC  G C LR+Y L++ +  G +  W+ Y
Sbjct  130  KMVLQNDDCQSAY-GDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTV-WQAY  187

Query  182  KNCVAL  187
            KNC+ L
Sbjct  188  KNCIPL  193

>PHYSO_438103
Length=238

 Score = 73.9 bits (180),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 76/148 (51%), Gaps = 25/148 (17%)

Query  54   DQNVTTSADVAGFLKQ-KGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S +V   LK    +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK
Sbjct  55   DGNNAGSVEVFKSLKSANNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGK  108

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL------DYSSC-KGECT-LRW  163
              F+   +  GPCEIW+D+ K+L   +C   +   +  +      DYSSC  G C  +R+
Sbjct  109  ATFSRALVHVGPCEIWLDNTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRF  168

Query  164  YALSV----SKTTGGSYSWEVYKNCVAL  187
            Y L+     SKT      W+ YK+C+ L
Sbjct  169  YWLAFQGLDSKTV-----WQSYKDCIPL  191

>PHYRA_78689
Length=296

 Score = 74.7 bits (182),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 75/148 (51%), Gaps = 25/148 (17%)

Query  54   DQNVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+TDP    QPIPT+GK
Sbjct  56   DGNNPQSVDTFKSLKTANNFKDLKTLMDDTSVYGA------DCGFTDPDGTPQPIPTDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL------DYSSCK-GEC-TLRW  163
              F+   +  GPCEIW+DD K+L   +C   +   +  +      DYSSC  G C  +R+
Sbjct  110  ATFSRALVHVGPCEIWLDDTKVLYEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRF  169

Query  164  YALSV----SKTTGGSYSWEVYKNCVAL  187
            Y L+     SKT      W+ YK+C+ L
Sbjct  170  YWLAFQGLDSKTV-----WQSYKDCIPL  192

>PPTG_04618
Length=326

 Score = 75.1 bits (183),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 16/125 (13%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            Y  +R+++D   +Y  +      CG+TDP       P++G   F+ G +  GPCEIW+DD
Sbjct  76   YKDVRSLMDGNPVYGED------CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDD  129

Query  131  LKLLSSANCKKDFPGTSTK-------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVYK  182
              +L + +C+  +   + K       +DYSSC  G C LR+Y L++ +  G +  W+ YK
Sbjct  130  KMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTV-WQAYK  188

Query  183  NCVAL  187
            NC+ L
Sbjct  189  NCIPL  193

>PHALS_03176
Length=207

 Score = 73.2 bits (178),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 71/143 (50%), Gaps = 14/143 (10%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKL  113
            D N  T   V  F K K     +   D +TL D +     +CG++DP  + QPIP +GK 
Sbjct  54   DWNGNTQKSVKTFQKLKAANKFK---DLKTLMDTSAFGA-KCGFSDPKGKPQPIPKDGKA  109

Query  114  RFT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL------DYSSC-KGECT-LRWY  164
             F+   +  GPCEIW+D+ K+L   +C   +      +      DYSSC  G C  +R+Y
Sbjct  110  TFSRAIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFY  169

Query  165  ALSVSKTTGGSYSWEVYKNCVAL  187
             L+     G +  W+ YKNC+ L
Sbjct  170  WLAFQGVNGKTV-WQSYKNCIPL  191

>PYAR_18165
Length=261

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 15/127 (12%)

Query  68   KQKGYASLRAMLDDETLYDVNIDSIFE------CGYTDPTYESQPIPTNGKLRFTGYMKD  121
            K    ASL  +    T  D  + S+ E      CG T+     QP P++G + F    + 
Sbjct  37   KNAPSASLPGLAGPYTGTD-EVKSLLEKAGGSKCGKTNANAAVQPAPSDGVVAFAISAQH  95

Query  122  -GPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSC--KGECTLRWYALSVSKTTGGSYSW  178
             GPCEIW+DD K++S+ +C K FP     +D+S C  K  C LRW  ++   +      W
Sbjct  96   IGPCEIWLDDTKVVSATDCWKQFPDKRIPVDFSKCANKASCELRWIWMATHTS-----PW  150

Query  179  EVYKNCV  185
            E Y NCV
Sbjct  151  EFYDNCV  157

>PHYKE_6002
Length=197

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 65/118 (55%), Gaps = 20/118 (17%)

Query  68   KQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD-GPCEI  126
            K   +  L+ ++DD ++Y        +CG+TDP+   QPIP++GK  F+  M+  GPCEI
Sbjct  71   KANNFVDLKTLMDDTSVYGA------DCGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEI  124

Query  127  WIDDLKLLSSANCK--KDFPGTSTKLDYSSCK-GECT-LRWYALSV----SKTTGGSY  176
            W+D  K  S  NC   + FP     +DYSSC  G C  +R+Y L+     SKT   SY
Sbjct  125  WLDSTKAFSKDNCADMETFP-----VDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSY  177

>PPTG_07521
Length=281

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (48%), Gaps = 21/148 (14%)

Query  56   NVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIF---ECGYTDPTYESQPIPTNGK  112
            NV    D+     Q G     A   + T+ DV +D +    ECG+T      QPIP++G 
Sbjct  44   NVDNYWDIGSGGDQCGLFKTMAEEKNVTVKDVVLDMVGAGKECGHTLADGTRQPIPSDGL  103

Query  113  LRFTG-----YMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGEC  159
             ++ G     +   GPCEI++DD  +L   NC+ ++PG        +   +DYSSC  +C
Sbjct  104  AKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYPGGDVGSTVTSDMPVDYSSCTEDC  163

Query  160  TLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            TL  Y L+         +W+ Y NCV L
Sbjct  164  TLTIYWLAFQNA-----NWQAYINCVPL  186

>PYIW_18792
Length=125

 Score = 70.5 bits (171),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 51/97 (53%), Gaps = 1/97 (1%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V+ P P + +    E    +A LE Q    +AD   + K KGY +LR  +DD+  Y V+ 
Sbjct  27   VSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYKVDG  86

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEI  126
             + FECG++      QPIP  G LR TGY  DGP  I
Sbjct  87   GN-FECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHYKE_2454
Length=374

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  62   DVAGF---LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT--  116
            +VA F    K   Y SL+A++DD+    V+  +   CG  DP+  +QP+P+  +   +  
Sbjct  63   NVASFTKAFKASSYKSLKALIDDKAKITVS-GATLTCGSADPSAAAQPLPSTLEWSHSDS  121

Query  117  -GYM--KDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKT  171
             G+    +GPCE W DD+++    NC  +FP    ++ Y  SS  G   L +Y +++   
Sbjct  122  EGFTPSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP  181

Query  172  TGGSYSWEVYKNCVAL  187
                 SW+VY NC AL
Sbjct  182  -----SWQVYVNCAAL  192

>PHALS_03177
Length=259

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 75/160 (47%), Gaps = 20/160 (13%)

Query  40   DGDYESAASVARLEDQNVTTSADVAGFLKQKG---YASLRAMLDDETLYDVNIDSIFECG  96
            DG       + +  D N  T   V  F   K    +  L+ ++D+  L         +CG
Sbjct  40   DGWIVQIEPLWKSSDWNGNTQKSVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCG  92

Query  97   YTDPTYESQPIPTNGKLRFTGYM-KDGPCEIWIDDLKLLSSANCKKDFPGTSTKL-----  150
            Y+DP  + QPIP +GK  F+  M   GPCE+W+D+ K+L   +C   +      +     
Sbjct  93   YSDPNGKPQPIPKDGKATFSRAMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFP  152

Query  151  -DYSSC-KGEC-TLRWYALSVSKTTGGSYSWEVYKNCVAL  187
             DYSSC  G C  +R+Y L+     G ++ W+ YK C+ L
Sbjct  153  VDYSSCANGGCKQMRFYWLAFQGINGKTF-WQSYKMCIPL  191

>PITG_04947
Length=298

 Score = 73.6 bits (179),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 19/131 (15%)

Query  68   KQKGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            K      +R M+D D  LY  +      CG TDP    +  PT G   F+ G +  GPCE
Sbjct  47   KSNNIKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPTTGDATFSRGIVHAGPCE  100

Query  126  IWIDDLKLLSSANCKKDFPGTSTK--------LDYSSCK-GECTLRWYALSVSKTTGGSY  176
            IW+DD  +L + +C+  + G  TK        +DYSSCK G C  R+Y L++ +    + 
Sbjct  101  IWLDDEMVLQNDDCQSAY-GDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQKTL  159

Query  177  SWEVYKNCVAL  187
             W+VYKNC+ L
Sbjct  160  -WQVYKNCIPL  169

>PHALS_05394
Length=288

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 68/125 (54%), Gaps = 16/125 (13%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD-GPCEIWIDD  130
            + S R+++D   +Y        +CGYTDP       P++G   F+  MK  G CEIWI+ 
Sbjct  78   FKSARSLMDGNPVYGA------DCGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINK  131

Query  131  LKLLSSANCKKDFPGTSTK-------LDYSSCKGE-CTLRWYALSVSKTTGGSYSWEVYK  182
              +L + +C+  +   + K       +DYSSCKG+ C LR+Y L++ +  G    W+ YK
Sbjct  132  KMVLQNDDCQSAYGDKAMKKKSVLKPIDYSSCKGDKCLLRFYWLALQRI-GDKTVWQAYK  190

Query  183  NCVAL  187
            NC+++
Sbjct  191  NCISI  195

>SDRG_08129
Length=218

 Score = 72.0 bits (175),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 71/142 (50%), Gaps = 26/142 (18%)

Query  58   TTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF--  115
              +A  + F  Q  + +LR ML+ +            CG + P    + IP++G + +  
Sbjct  57   NVAAFTSAFKVQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGAMTWRN  107

Query  116  ----TGYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE-CTLRWYA  165
                 G++    GPCE+W+DD ++  + +C  +F   P     +DYSSC G+ C LR+Y 
Sbjct  108  PDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYW  167

Query  166  LSVSKTTGGSYSWEVYKNCVAL  187
            L++ +       W+VYKNCV L
Sbjct  168  LALHQP-----QWQVYKNCVPL  184

>PHYSO_324715
Length=274

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 73/135 (54%), Gaps = 22/135 (16%)

Query  68   KQKGYAS-LRAMLDDET-LYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
            K +GY + +R +LD +T LY        +CGY+DP    +   T+G   F+ G    GPC
Sbjct  64   KAEGYENNIRKLLDGDTKLYGA------DCGYSDPNASPKDPSTDGTATFSRGIAHHGPC  117

Query  125  EIWIDDLKLLSSANCKKDFPGTS---------TKLDYSSCKGE-CTLRWYALSVS-KTTG  173
            EIW+DD  +L   +C++ F GTS           +DYSSC    C L +Y L+   +TTG
Sbjct  118  EIWLDDKMILHDDDCEETF-GTSDYEKIKTVFKPIDYSSCSANGCMLHFYWLAFQGRTTG  176

Query  174  GS-YSWEVYKNCVAL  187
             S Y W++YK  VAL
Sbjct  177  NSKYVWQIYKCYVAL  191

>PYAR_20617
Length=254

 Score = 72.4 bits (176),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 62/131 (47%), Gaps = 14/131 (11%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A   K +G   LR  L+D+            CG +      + IP +GK+     
Sbjct  57   TGAQYAAKAKAEGIPDLRTFLEDKGPV---------CGNSLKDATPKAIPASGKISLAST  107

Query  119  MKD-GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSY  176
            ++  GPCE+W DD+      +C+K F   TS  +D+S C G C LR+Y L +     G  
Sbjct  108  IEHAGPCEVWFDDVLAFHDDDCEKTFGSATSFAVDFSKCSGSCLLRFYWLGLQD---GGK  164

Query  177  SWEVYKNCVAL  187
             W+ YKNCV L
Sbjct  165  RWQSYKNCVPL  175

>PHYSO_246676
Length=187

 Score = 71.2 bits (173),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 65/160 (41%), Gaps = 44/160 (28%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D A + K+ GY +LR  +D +  YDV  
Sbjct  14   VLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMD-KAKYDVTS  72

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDG--PCEIWIDDLKLLSSANCKKDFPGTS  147
             + F CG+TDP    QPIP   K+R TGY  DG     + +D +K               
Sbjct  73   GADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASLVLDGMK---------------  117

Query  148  TKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                                       SYSW+VYK C+ L
Sbjct  118  --------------------------NSYSWKVYKACIPL  131

>SDRG_08137
Length=282

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 26/141 (18%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF---  115
             +A  + F  Q  + +LR ML+ +            CG + P    + IP++G + +   
Sbjct  122  VAAFTSAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWRNP  172

Query  116  ---TGYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE-CTLRWYAL  166
                G++    GPCE+W+DD ++  + +C  +F   P     +DYSSC G+ C LR+Y L
Sbjct  173  DTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGDGCMLRFYWL  232

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
            ++ +       W+VYKNCV L
Sbjct  233  ALHQP-----QWQVYKNCVPL  248

>PYU1_G001527
Length=278

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 15/127 (12%)

Query  69   QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN----GKLRFTGYMKD--G  122
            Q  Y S+RA++D + ++   ++   ECG T PT E QP+P            G+     G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  123  PCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            PCE+W D++   S+ NC  ++P    KL  D S C G+  L++Y L++  +T     W+ 
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHSST-----WQA  192

Query  181  YKNCVAL  187
            Y  C  L
Sbjct  193  YIACAPL  199

>PYU1_G001523
Length=278

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 15/127 (12%)

Query  69   QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN----GKLRFTGYMKD--G  122
            Q  Y S+RA++D + ++   ++   ECG T PT E QP+P            G+     G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  123  PCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            PCE+W D++   S+ NC  ++P    KL  D S C G+  L++Y L++  +T     W+ 
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHSST-----WQA  192

Query  181  YKNCVAL  187
            Y  C  L
Sbjct  193  YIACAPL  199

>PPTG_04620
Length=342

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 19/131 (15%)

Query  68   KQKGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCE  125
            K      +R M+D D  LY  +      CG TDP    +  P+ G   F+ G +  GPCE
Sbjct  74   KSNNVKDIRTMIDGDAKLYGED------CGNTDPKATPKDPPSTGDATFSRGIVHAGPCE  127

Query  126  IWIDDLKLLSSANCKKDFPGTSTK--------LDYSSCK-GECTLRWYALSVSKTTGGSY  176
            IW+DD  +L + +C+  + G  TK        +DYSSCK G C  R+Y L++ +    + 
Sbjct  128  IWLDDEMVLQNDDCQSAY-GDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDSKTL  186

Query  177  SWEVYKNCVAL  187
             W+VYKNC+ L
Sbjct  187  -WQVYKNCIPL  196

>PHYRA_78174
Length=279

 Score = 72.8 bits (177),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 69/138 (50%), Gaps = 17/138 (12%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDV-NIDSIFECGYTDPTYESQPIP------TNG  111
            T+A   GF   K Y SL+ M+ D  L  V + D   ECGYT+P   +QP+P       +G
Sbjct  65   TAAFAKGFEASK-YTSLKEMVSD--LGKVTSADFTMECGYTNPDETAQPLPKTYVEWAHG  121

Query  112  KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVS  169
                     +GPCE+W DD+++    +C   +     K+  D+ +C G   L +Y L++ 
Sbjct  122  SGEGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLALH  181

Query  170  KTTGGSYSWEVYKNCVAL  187
             +T     W+VY NC AL
Sbjct  182  SST-----WQVYTNCAAL  194

>PYIR_23585
Length=240

 Score = 72.0 bits (175),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 17/133 (13%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-G  117
            ++AD A     KG+A+ RA L+              CG T      +PIP++  ++F+  
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRGP---------TCGNTLANASPKPIPSDNTVKFSRA  108

Query  118  YMKDGPCEIWIDDLKLLSSANCKKDFPGTST---KLDYSSCKGECTLRWYALSVSKTTGG  174
             +  GPCE+WID+ ++  + +C+  F G+S    K+D+S+CKG C LR+Y L +     G
Sbjct  109  IVHPGPCELWIDNTRVYHNDDCEAAF-GSSIPTWKIDFSACKGSCMLRFYWLGLQD---G  164

Query  175  SYSWEVYKNCVAL  187
               ++ Y  C+AL
Sbjct  165  GARFQSYSKCLAL  177

>PHYKE_5749
Length=300

 Score = 72.8 bits (177),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 70/143 (49%), Gaps = 24/143 (17%)

Query  62   DVAGFLKQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF----  115
            D+     Q G     A     ++ DV +D +    CG T P  + QPIP++GK ++    
Sbjct  52   DIGSGGDQVGKFKTMAAEKGMSVKDVVLDMVGSQTCGNTLPDGDPQPIPSDGKAKWLGNE  111

Query  116  -TGYMKDGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGEC--TLRWY  164
              G+   GPCEI++DD  +L S +C+ +F G        +   +DYSSC G+C  T+ W 
Sbjct  112  GGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVGSTQTSDMPVDYSSCNGKCLFTIYWL  171

Query  165  ALSVSKTTGGSYSWEVYKNCVAL  187
            A   ++       W+ Y NCV L
Sbjct  172  AFQNAQ-------WQTYINCVPL  187

>PYAP_18713
Length=184

 Score = 70.5 bits (171),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 69/132 (52%), Gaps = 17/132 (13%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGY  118
            T A  A   K KG+  LR+ L+D+            CG T+P  + + +P++ K+ F+  
Sbjct  59   TGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFSRP  109

Query  119  M-KDGPCEIWIDDLKLLSSANCKKDFPGTST---KLDYSSCKGECTLRWYALSVSKTTGG  174
            M   GPCE+WIDD  +  + +C+ +F G       +D+SSCKG+C LR+Y L +  +   
Sbjct  110  MVHRGPCELWIDDTMVYHNDDCELEF-GKKVPVFPVDFSSCKGKCMLRFYWLGLQDS---  165

Query  175  SYSWEVYKNCVA  186
               W+ Y   +A
Sbjct  166  GKRWQSYSTYIA  177

>PYAP_23672
Length=257

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 58/99 (59%), Gaps = 6/99 (6%)

Query  91   SIFECGYTDPTYESQPIPTNGKLRF-TGYMKDGPCEIWIDDLKLL-SSANCKKDFPGTST  148
            S  ECGY+DP    QP+P   K++F TG+M  GPCE + D++ +   +A+CK  +PG + 
Sbjct  89   STPECGYSDPKGTPQPLPE--KIQFHTGFMHWGPCEAYCDNVLVTKHAADCKVAYPGGAV  146

Query  149  KLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              D + C G+   ++Y L +   +G S  W+ Y NCV L
Sbjct  147  PYDKAKCAGKKQFKFYWLGMD--SGNSAPWQAYVNCVPL  183

>PHYKE_1913
Length=280

 Score = 72.0 bits (175),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 70/135 (52%), Gaps = 24/135 (18%)

Query  68   KQKGYASLRAMLDDETLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF-----TGYMK  120
            K K  A+ + M    ++ DV +D + +  CGYT    + +P+P++GK  +      G+  
Sbjct  61   KYKTMAAEKGM----SVKDVVLDMVKDKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTH  116

Query  121  DGPCEIWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTT  172
             GPCE++I+D  +L   +C+ ++PG        +   +DYSSC G+CTL  Y L+     
Sbjct  117  TGPCEVYINDKMVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNA-  175

Query  173  GGSYSWEVYKNCVAL  187
                 W+ Y NCV L
Sbjct  176  ----QWQAYINCVPL  186

>PHYCA_531163
Length=314

 Score = 72.4 bits (176),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 80/157 (51%), Gaps = 22/157 (14%)

Query  41   GDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLD-DETLYDVNIDSIFECGYTD  99
            GD+++ +S    +D +  TS          GY+ +R +LD D +LY        +CGYT+
Sbjct  52   GDWDTCSS----DDSDCLTSV-YTSLKSSNGYSDIRTLLDSDTSLYGA------DCGYTN  100

Query  100  PTYESQPIPTNGKLRFT-GYMKDGPCEIWIDDLKLLSSANC-------KKDFPGTSTKLD  151
                ++  P+ G   F+ G +  GPCEIW+DD  +LS+ +C         D     T +D
Sbjct  101  ADATAKDPPSTGDATFSRGMVHVGPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVD  160

Query  152  YSSCKGE-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            YSSC    C LR+Y L+  +    +  W+VYK+CV L
Sbjct  161  YSSCSTSGCMLRFYWLAF-QGVDSAIVWQVYKDCVPL  196

>PYVX_20789
Length=290

 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 17/130 (13%)

Query  63   VAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF--TGYMK  120
            VA +  + G +SL+        Y     +I ECG T+    +QP+P++G       G   
Sbjct  66   VADWFTENGISSLKE-------YXXXXTNISECGNTEKDGTAQPVPSDGYAEHDTLGNSH  118

Query  121  DGPCEIWIDDLKLLSSANCKKDFPGTS---TKLDYSSCKGECTLRWYALSVSKTTGGSYS  177
             GPCEIW DD ++ +S NC  DF G S     +D ++C       +Y L++      +  
Sbjct  119  PGPCEIWCDDTRVFNSTNCVTDFSGQSPAMIPIDVATCTASSEFVFYWLALH-----AQP  173

Query  178  WEVYKNCVAL  187
            W+VY NCVAL
Sbjct  174  WQVYINCVAL  183

>PYIR_16375
Length=262

 Score = 71.6 bits (174),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 9/119 (8%)

Query  71   GYASLR-AMLDDETLYDVNIDSIFECGYTD-PTYESQPIPTNGKLRFTGYMKDGPCEIWI  128
            GY SLR  +L ++ +YD + D   ECG T     +   +P +G + F+G+   GPCE+W 
Sbjct  77   GYTSLRDLILANQDMYDESTDK--ECGLTTLDEAKRTTMPASGNITFSGFTHPGPCELWC  134

Query  129  DDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            DD K+  + NC   +P      D + C G    R + + V  +      W+VY NCV L
Sbjct  135  DDNKMTFANNCAATYPDGKVPFDAAKCVGANRFRIFWIGVHGS-----PWQVYTNCVYL  188

>PHALS_03179
Length=372

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 76/142 (54%), Gaps = 16/142 (11%)

Query  60   SADVAGFLKQ--KGYASLRA---MLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLR  114
            S+D  G  +Q  K Y SL+A     D +TL + +     ECG++DP  + QPIP +GK  
Sbjct  93   SSDWNGNTEQSVKAYQSLKAANNFKDLKTLMETHALGP-ECGFSDPKGKPQPIPKDGKAT  151

Query  115  FT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL------DYSSC-KGECT-LRWYA  165
             +   +  GPCE+W+D+ K+L   +C   +     K+      DYSSC  G C  +R+Y 
Sbjct  152  LSRAIVHRGPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYW  211

Query  166  LSVSKTTGGSYSWEVYKNCVAL  187
            L+     G ++ W+ YKNC+ L
Sbjct  212  LAFQGIKGITF-WQSYKNCIPL  232

>PHYKE_6077
Length=322

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 52/105 (50%), Gaps = 17/105 (16%)

Query  93   FECGYTDPTYESQPIP------TNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146
             ECGYT+P   +QP+P      ++G         +GPCE+W DD ++    NC  +FP  
Sbjct  98   LECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTA  157

Query  147  STKLDY--SSCKGEC--TLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              KL Y   +C G    TL W AL        S SW+VY NC AL
Sbjct  158  PAKLPYDREACLGSSVLTLYWIALH-------SPSWQVYINCAAL  195

>PHYSO_484051
Length=285

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 71/134 (53%), Gaps = 18/134 (13%)

Query  65   GFLKQ-KGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDG  122
              LK+  GY+ +R +LD D +LY        +CG+T+P    +  PT G   F+  M   
Sbjct  70   ALLKESNGYSDIRTLLDSDTSLYGA------DCGFTNPDASPKDPPTTGDPTFSRCMVHA  123

Query  123  -PCEIWIDDLKLLSSANCKKDF-PGTS------TKLDYSSCKGE-CTLRWYALSVSKTTG  173
             PCEIW+DD  +LS+ +C+  +  GT       T +DYSSC    C LR+Y L+  +   
Sbjct  124  SPCEIWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAF-QGVD  182

Query  174  GSYSWEVYKNCVAL  187
                W+VYK+CV L
Sbjct  183  SKMVWQVYKDCVPL  196

>SDRG_08782
Length=450

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (50%), Gaps = 27/151 (18%)

Query  50   ARLEDQNVTTSADV-AGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
             + +D   T  A+    F  Q  + +LR MLD             +CGYT    + + IP
Sbjct  49   GKFDDSPQTNVANFNKAFKAQSQFKTLRDMLDPHGP---------DCGYTLTNVDKKAIP  99

Query  109  TNGKLRFT------GYM--KDGPCEIWIDDLKLLSSANCKKDFPGT---STKLDYSSCKG  157
             NG++ +       G++    GPCE+WID+ ++  + +C  +FP +   +  +DYSSC  
Sbjct  100  GNGQMTWKNPDTGEGFIPSHKGPCEVWIDNERVFQNDDCATNFPQSPEVNLPVDYSSCGA  159

Query  158  E-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              C LR+Y L++ +       W+VYKNCV L
Sbjct  160  NGCMLRFYWLALHEPM-----WQVYKNCVPL  185

>PYAP_22257
Length=247

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 9/76 (12%)

Query  116  TGYM--KDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKT  171
            TG++    GPCEIWIDD +++   NC   F G   K+  +YS CKGEC LR+Y L++ + 
Sbjct  113  TGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLALHEP  172

Query  172  TGGSYSWEVYKNCVAL  187
                  W+VYKNCV +
Sbjct  173  -----EWQVYKNCVPI  183

>SPRG_22161
Length=300

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 27/151 (18%)

Query  50   ARLEDQNVTTSADV-AGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
             + +D   T  A+    F  Q  + +LR MLD +           +CG T      + IP
Sbjct  50   GKFDDSPQTNVANFNKAFKAQTQFKTLRDMLDPQGP---------DCGNTLTNGAKKAIP  100

Query  109  TNGKLRFT------GYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKG  157
            TNG + +       G++    GPCE+WID+ ++  + +C  +F   P  +  +DYSSC  
Sbjct  101  TNGMMTWQNPDTGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGA  160

Query  158  E-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              C LR+Y L++ +       W+VYKNCV L
Sbjct  161  NGCMLRFYWLALHEPM-----WQVYKNCVPL  186

>SPRG_07795
Length=335

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 62/128 (48%), Gaps = 22/128 (17%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT-----NGKLRFTGYMKD  121
             K   + +L+A LD          +  +CG TDP   +QP+P+     NG+L F    + 
Sbjct  71   FKASSFKTLKAFLDAHP-------TGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQ-  122

Query  122  GPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKG--ECTLRWYALSVSKTTGGSYSWE  179
            GPCE+W D+ ++    NC  ++P     +D S C G    T+ W AL   +       W+
Sbjct  123  GPCELWCDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE-------WQ  175

Query  180  VYKNCVAL  187
            VYKNCV L
Sbjct  176  VYKNCVNL  183

>PHYSO_374518
Length=116

 Score = 67.4 bits (163),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 55/101 (54%), Gaps = 10/101 (10%)

Query  92   IFECGYTDPTYESQPIPTNGKLRF--TGYMKDGPCEIWIDDLKLLSSANCKKDFPG---T  146
            I ECG T+    +QP+P++G  +    G    GPCEIW DD ++  + NC +++ G   T
Sbjct  5    ISECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPT  64

Query  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
               +D S+CK      +Y L++      +  W+VY NCVAL
Sbjct  65   KLPIDVSTCKASSEFVFYWLALH-----AQPWQVYINCVAL  100

>PYU1_G001526
Length=334

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 15/127 (12%)

Query  69   QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN----GKLRFTGYMKD--G  122
            Q  Y S+RA++D + ++   ++   ECG T PT E QP+P            G+     G
Sbjct  80   QSTYKSVRALVDAKGVFQPGMNK--ECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTG  137

Query  123  PCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            PCE+W D++   S+ NC  ++P    KL  D S C G+  L++Y L++  +T     W+ 
Sbjct  138  PCEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALHSST-----WQA  192

Query  181  YKNCVAL  187
            Y  C  L
Sbjct  193  YIACAPL  199

>PHYRA_78176
Length=312

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 63/130 (48%), Gaps = 16/130 (12%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT-------NGKLRFTGYM  119
             +   Y+SL+  +DD+    V  D+   CG  DP   +QP+P        +    FT   
Sbjct  74   FESSSYSSLKEFIDDKATITVT-DATLTCGACDPDETAQPLPETYVEWAHSDSEGFTA-S  131

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYS  177
             +GPCE+W DD+++    +C  DF     +L  D+ +C G   L +Y L++  +T     
Sbjct  132  HEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALHSST-----  186

Query  178  WEVYKNCVAL  187
            W+VY NC  L
Sbjct  187  WQVYVNCAPL  196

>SDRG_07565
Length=278

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 67/141 (48%), Gaps = 26/141 (18%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT--  116
             +A    F  Q  + +LR ML+ +            CG + P    + IP++G + +   
Sbjct  120  VAAFTTAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPSDGTMTWLNP  170

Query  117  ----GYMKD--GPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGE-CTLRWYAL  166
                G++    GPCE+W+DD ++    +C   F   P     +DYSSC G  C LR+Y L
Sbjct  171  DTGEGFISSHTGPCEVWLDDKRVFQDDDCPTHFPQKPAAHLPVDYSSCGGSGCMLRFYWL  230

Query  167  SVSKTTGGSYSWEVYKNCVAL  187
            ++ +       W+VYKNCV L
Sbjct  231  ALHQP-----QWQVYKNCVPL  246

>PHYRA_73582
Length=326

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 66/126 (52%), Gaps = 19/126 (15%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPCEIWIDD  130
            Y  L+ ++D     +       +CG+TDP       PT+G   F+ G +  GPCEIW+DD
Sbjct  76   YKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDD  128

Query  131  LKLLSSANCKKDFPGTSTK--------LDYSSC-KGECTLRWYALSVSKTTGGSYSWEVY  181
              +L + +C+  + G  T+        +DYS C  G C LR+Y L++ +  G +  W+ Y
Sbjct  129  KMVLQNDDCQSAY-GDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAV-WQSY  186

Query  182  KNCVAL  187
            KNC+ L
Sbjct  187  KNCIPL  192

>PHYRA_78161
Length=373

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 70/144 (49%), Gaps = 19/144 (13%)

Query  56   NVTTSADVAGFLKQKG---YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN--  110
            N   S +VA F K  G   Y+SL+  ++D+    V   +   CG  DP  E+QP+P +  
Sbjct  57   NGAPSDNVAAFTKAFGSSKYSSLKEFINDKATVTV-TGATLTCGSCDPKEEAQPMPKSTM  115

Query  111  -----GKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRW  163
                     FT    +GPCE+W DD++     +C  ++P    +L  D  +C G  TL +
Sbjct  116  EWSHSDSEGFTA-SHEGPCEVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTF  174

Query  164  YALSVSKTTGGSYSWEVYKNCVAL  187
            Y +++  +T     W+VY NC  L
Sbjct  175  YWMAMHSST-----WQVYVNCAPL  193

>PYIR_14463
Length=369

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 16/119 (13%)

Query  74   SLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM--KDGPCE  125
            +  A  + +TL D+  D   +CG + P    + IP +GK+ +       G++    GPCE
Sbjct  82   AFNAQSEFKTLRDLLKDHGADCGDSKPDASRKAIPGDGKVVWQNPDSGEGFVPSHTGPCE  141

Query  126  IWIDDLKLLSSANCKKDF---PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVY  181
            +W+DD ++ S  NC   F   P     +D+SSCKG+C LR+Y L++ + T     W+VY
Sbjct  142  VWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKGDCMLRFYWLALHEPT-----WQVY  195

>PPTG_14221
Length=275

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 72/149 (48%), Gaps = 27/149 (18%)

Query  54   DQNVTTSADVAGFLKQ-KGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+T+P    QPIPT+GK
Sbjct  56   DGNNPKSVDTFKSLKAANNFKDLKTLMDDTSVYGA------DCGFTNPNGTPQPIPTDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANC-----------KKDFPGTSTKLDYSSC-KGEC  159
              F+   +  GPC IW+DD  +L   +C           K  FP     +DYSSC  G C
Sbjct  110  ATFSRALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFP-----VDYSSCNNGGC  164

Query  160  -TLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +R+Y L+       +  W+ YK+C+ L
Sbjct  165  KQMRFYWLAFQGLNKKTV-WQSYKDCIPL  192

>PHYCA_132255
Length=128

 Score = 67.0 bits (162),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 52/101 (51%), Gaps = 10/101 (10%)

Query  92   IFECGYTDPTYESQPIPTNGKLRF--TGYMKDGPCEIWIDDLKLLSSANCKKDFPG---T  146
            I ECG T      QP+PT+G ++    G    GPCEIW DD ++  + NC  ++ G   T
Sbjct  5    IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPT  64

Query  147  STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            S  +D  +CK    L +Y LS+         W+VY NCV L
Sbjct  65   SLPIDLDTCKSSSELVFYWLSLQGA-----PWQVYINCVKL  100

>PHYCA_14368
Length=219

 Score = 68.6 bits (166),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 64/158 (41%), Gaps = 47/158 (30%)

Query  30   VTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNI  89
            V  PEP +  +        +A LE+Q   T  D A +  +  Y SLR  +D+   Y V  
Sbjct  31   VLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDNAK-YTVTD  89

Query  90   DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTK  149
             + F CG+TDP                                        KD+      
Sbjct  90   GADFSCGFTDP----------------------------------------KDY-----T  104

Query  150  LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +DYSSCKG CTLRWY L + +     YSW+VYK C+ L
Sbjct  105  VDYSSCKGTCTLRWYWLGI-RFLKNQYSWQVYKACIPL  141

>PYVX_21297
Length=263

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query  94   ECGYTDPTYESQPIPTNGKLRF-TGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY  152
             CG TD     QP+P++G + F    +  GPCE+W+DD K+ S+ +C   +   +  +DY
Sbjct  66   NCGNTDGNAAVQPVPSDGLVTFDISAVHIGPCEVWLDDTKVASANDCWSTYADKTIPIDY  125

Query  153  SSCKG-ECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            S C G  C LRW  L+          WE++ NCV +
Sbjct  126  SVCTGSSCQLRWVWLATHND-----PWEIFDNCVNV  156

>PHYRA_84947
Length=265

 Score = 69.3 bits (168),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 61/132 (46%), Gaps = 20/132 (15%)

Query  63   VAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF--TGYMK  120
            V  +  +   ASL+  +   T Y  +I    ECG T      QP+P++G  +    G   
Sbjct  66   VDSWFTKNNIASLKEYI---TTYGTDIS---ECGVTKKNGAPQPVPSDGYAQHDNLGNSH  119

Query  121  DGPCEIWIDDLKLLSSANCKKDFPGTS---TKLDYSSCK--GECTLRWYALSVSKTTGGS  175
             GPCEIW DD ++   +NC   F G S     +D S+CK   E    W AL +       
Sbjct  120  PGPCEIWCDDTRVFHDSNCVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHIQP-----  174

Query  176  YSWEVYKNCVAL  187
              W+VY NCVAL
Sbjct  175  --WQVYINCVAL  184

>PYAP_24691
Length=145

 Score = 67.0 bits (162),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 4/67 (6%)

Query  122  GPCEIWIDDLKLLSSANCKKDF-PGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            GPCEIW D+ ++   ++C+K F   T  K+DYS CKG C LR+Y L +     G   W+ 
Sbjct  5    GPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQD---GGKRWQS  61

Query  181  YKNCVAL  187
            YKNCV +
Sbjct  62   YKNCVPI  68

>PHYCA_112615
Length=196

 Score = 68.2 bits (165),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 69/132 (52%), Gaps = 21/132 (16%)

Query  54   DQNVTTSADVAGFLK-QKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGK  112
            D N   S D    LK    +  L+ ++DD ++Y        +CG+TDP  ++QPIP++GK
Sbjct  56   DGNKPGSVDAFKALKTANNFKDLKTLMDDTSVYGA------DCGFTDPNGKAQPIPSDGK  109

Query  113  LRFT-GYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSC-KGECT-LRWYALSVS  169
              F+   +  GPCEIW+DD K + S      FP     +DYSSC  G C  +R+Y L+  
Sbjct  110  ATFSRAIVHVGPCEIWLDDTKDIKSI-----FP-----VDYSSCDNGGCKEMRFYWLAFQ  159

Query  170  KTTGGSYSWEVY  181
               G +  W+ Y
Sbjct  160  GVDGKTV-WQSY  170

>PYVX_16138
Length=559

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 16/125 (13%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
              ++KG   +R++LDD ++Y        +CGYTDP   +Q IPT+    F+ G +  GPC
Sbjct  70   LAEEKGVTQIRSLLDDTSIYGA------DCGYTDPDGTAQDIPTDSTATFSRGMVHVGPC  123

Query  125  EIWIDDLKLLSSANCKKDFPGTSTK------LDYSSC--KGECTLRWYALSVSKTTGGSY  176
            EIW+DD  +L   +C   + G          +DYSSC   G   +R+Y L+       + 
Sbjct  124  EIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETV  183

Query  177  SWEVY  181
             W+VY
Sbjct  184  -WQVY  187

>SPRG_07797
Length=318

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 61/128 (48%), Gaps = 22/128 (17%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT-----NGKLRFTGYMKD  121
             K   + +L+A LD          S  +CG TD    +QP+P+     NG+  F    + 
Sbjct  71   FKASSFKTLKAFLDAHP-------SGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQ-  122

Query  122  GPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKG--ECTLRWYALSVSKTTGGSYSWE  179
            GPCE+W D++++    NC  ++P     +D S C G    T+ W AL        S  W+
Sbjct  123  GPCELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALH-------SPQWQ  175

Query  180  VYKNCVAL  187
            VYKNCV L
Sbjct  176  VYKNCVNL  183

>PHYCA_120062
Length=212

 Score = 68.2 bits (165),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 51/103 (50%), Gaps = 14/103 (14%)

Query  92   IFECGYTDPTYESQPIPTNGKLRF--TGYMKDGPCEIWIDDLKLLSSANCKKDFPG---T  146
            I ECG T      QP+PT+G ++    G    GPCEIW DD ++  + NC  ++ G   T
Sbjct  37   IPECGNTKKNGTPQPLPTDGFVKHDSIGSSHPGPCEIWCDDTRVFHNTNCAGEYAGQVPT  96

Query  147  STKLDYSSCK--GECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            S  +D  +CK   E    W AL V         W+VY NCV L
Sbjct  97   SLPIDLDTCKSSSELVFYWLALHVQP-------WQVYINCVTL  132

>PYIW_21964
Length=265

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 63/132 (48%), Gaps = 21/132 (16%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP-------TNGKLRFTGYM  119
            LK   Y S+RA++DD+ ++    +   ECG T PT   QP+P        +    FT   
Sbjct  77   LKASTYKSMRALVDDKAVFIKEANK--ECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSH  134

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLR--WYALSVSKTTGGS  175
            + GPCE+W DD    +  NC  D+     +L  D++ C G   L+  W AL        S
Sbjct  135  Q-GPCEVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH-------S  186

Query  176  YSWEVYKNCVAL  187
             +W++Y NC  L
Sbjct  187  STWQIYINCAPL  198

>PPTG_07516
Length=294

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 68/130 (52%), Gaps = 22/130 (17%)

Query  75   LRAMLDDE--TLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCE  125
             +AM  ++  ++ DV +D + +  CG T    + QPIP +GK+++ G     +   GPCE
Sbjct  60   FKAMAKEKGMSVKDVVLDMVKDQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCE  119

Query  126  IWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYS  177
            I++DD  +L   +C+ +F G        +   +D+SSC G+C L  Y L+       +  
Sbjct  120  IYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQ-----NAQ  174

Query  178  WEVYKNCVAL  187
            W+ Y NCV L
Sbjct  175  WQTYVNCVPL  184

>PHYSO_524101
Length=308

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 64/130 (49%), Gaps = 16/130 (12%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP-------TNGKLRFTGYM  119
             +   Y+SL+ +++D+    V  D+   CG  DP   +QP+P        +    FT   
Sbjct  73   FESSSYSSLKELINDKATITVT-DATLTCGMCDPDETAQPLPDTYVEWAHSDSEGFTA-S  130

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYS  177
             +GPCE+W DD+++    +C  D+     +L Y   +C G  TL +Y L++  +T     
Sbjct  131  HEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALHSST-----  185

Query  178  WEVYKNCVAL  187
            W+VY NC  L
Sbjct  186  WQVYVNCAPL  195

>PPTG_07520
Length=294

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 68/130 (52%), Gaps = 22/130 (17%)

Query  75   LRAMLDDE--TLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRFTG-----YMKDGPCE  125
             +AM  ++  ++ DV +D + +  CG T    + QPIP +GK+++ G     +   GPCE
Sbjct  60   FKAMAKEKGMSVKDVVLDMVKDQKCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCE  119

Query  126  IWIDDLKLLSSANCKKDFPG--------TSTKLDYSSCKGECTLRWYALSVSKTTGGSYS  177
            I++DD  +L   +C+ +F G        +   +D+SSC G+C L  Y L+       +  
Sbjct  120  IYLDDKMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQ-----NAQ  174

Query  178  WEVYKNCVAL  187
            W+ Y NCV L
Sbjct  175  WQTYVNCVPL  184

>PPTG_06256
Length=318

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 64/124 (52%), Gaps = 10/124 (8%)

Query  67   LKQKGYASLRAML-DDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCE  125
            L  KG  SL A++  ++ LY  ++D   +CG T     ++      +L +TG+   GPCE
Sbjct  74   LPTKGGGSLGALIAKNQKLYSSDVDP--DCGLTTFKESARSKLPASQLEYTGFTHPGPCE  131

Query  126  IWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +W DD K+L   +C+  FPG+ +K+ Y  S C     L  Y L+V         W+VY +
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPYDESKCANANRLTIYWLAVH-----GEQWQVYSD  186

Query  184  CVAL  187
            CV L
Sbjct  187  CVWL  190

>SDRG_17317
Length=122

 Score = 65.5 bits (158),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 17/106 (16%)

Query  94   ECGYTDPTYESQPIPTNGKLRFT------GYMKD--GPCEIWIDDLKLLSSANCKKDFPG  145
            +CG T  T   + IP++G + +       G++    GPCE+W+DD ++  + +C  +FP 
Sbjct  8    DCGNTLTTGAKKSIPSDGTMTWQNPDTGEGFVPSHTGPCEVWLDDKRVFQNDDCATNFPA  67

Query  146  TST---KLDYSSCKGE-CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                   +DYSSC G+ C LR+Y L++ +       W+VYKNCV L
Sbjct  68   KPAAHLPIDYSSCSGDGCMLRFYWLALHEPM-----WQVYKNCVPL  108

>PHYRA_73581
Length=293

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 72/133 (54%), Gaps = 21/133 (16%)

Query  68   KQKGYAS-LRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT-GYMKDGPC  124
            K+ GY + +R +LD D  LY  +      CGY+DP  + +  PT+G   F+ G    GPC
Sbjct  79   KESGYENDVRKLLDSDANLYGAD------CGYSDPDADPKDPPTDGTATFSRGIAHHGPC  132

Query  125  EIWIDDLKLLSSANCKKDFPGTS---------TKLDYSSCKGE-CTLRWYALSVSKTTGG  174
            EIW+DD  +L   +C K F GT+           +DYSSC    C LR+Y L+   +  G
Sbjct  133  EIWLDDTMVLHDDDCAKTF-GTADYATMKSVLKPIDYSSCSASGCMLRFYWLAFQGSNDG  191

Query  175  SYSWEVYKNCVAL  187
             Y W++YK+CV L
Sbjct  192  -YVWQIYKHCVPL  203

>PYVX_20783
Length=276

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 10/102 (10%)

Query  91   SIFECGYTDPTYESQPIPTNGKLRF--TGYMKDGPCEIWIDDLKLLSSANCKKDFPGTS-  147
            S  ECG T+     QP+P++G  +    G    GPCEIW DD ++ +S NC  +F G S 
Sbjct  87   SFDECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFTSTNCVTEFSGQSP  146

Query  148  --TKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
                +D ++C G     +Y L++      +  W+VY NCVAL
Sbjct  147  AKIPIDVATCTGSSEFVFYWLALH-----AQPWQVYINCVAL  183

>PHYSO_488921
Length=296

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 26/128 (20%)

Query  71   GYASLRAMLDD---------ETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD  121
            GY SLR MLD          +T   V++    E  + +  Y+   I ++           
Sbjct  75   GYKSLREMLDPIAPDYGHSLKTATPVDVTGYTEMWWQNDEYKEGFINSHS----------  124

Query  122  GPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWE  179
            GPCE WIDD+K+    NC  +F     K+  DYSSCKG+C L +Y L++ +      +W+
Sbjct  125  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP-----NWQ  179

Query  180  VYKNCVAL  187
            +YK CV +
Sbjct  180  IYKQCVPI  187

>H257_11265
Length=282

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 75/146 (51%), Gaps = 24/146 (16%)

Query  53   EDQNVTTSADVAGF---LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPT  109
            E+ N++   +   F   LK+  +ASLRA +D +       ++  ECG T      + +P+
Sbjct  57   ENYNLSPQDNTIAFTRQLKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPS  110

Query  110  NGKLRFT----GYM--KDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKG--ECTL  161
            + K+++     G++   +GPCE+W D  ++  + NC ++ P     ++ S C+G  +  +
Sbjct  111  DSKVKWAHGSEGFVLSHEGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIM  170

Query  162  RWYALSVSKTTGGSYSWEVYKNCVAL  187
             W AL  S+       W+VYKNCV L
Sbjct  171  LWLALHTSQ-------WQVYKNCVRL  189

>PYIR_20481
Length=277

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 67/130 (52%), Gaps = 30/130 (23%)

Query  71   GYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD---------  121
            GY SL+ MLD          S+  CG+T    +  P+  +G L+   +  D         
Sbjct  74   GYKSLKEMLDL---------SVPGCGFT--LTDGAPVDVSG-LKSMKWQNDQEQKGFIDS  121

Query  122  --GPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYS  177
              GPCE+WID+ K++ S +C+ D+     ++  DYS CKG+C L +Y L++ +      +
Sbjct  122  HHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLALHEP-----N  176

Query  178  WEVYKNCVAL  187
            W++YK CV +
Sbjct  177  WQIYKQCVPI  186

>PPTG_04803
Length=268

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 62/127 (49%), Gaps = 16/127 (13%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF--TGYMKDGP  123
            +  +   ASL+  +   T Y  +I    ECG T+    +QP+P++G  +    G    GP
Sbjct  69   WFTKNNVASLKEFI---TTYGTDIS---ECGNTEKKGTAQPVPSDGYAQHDTLGNSHPGP  122

Query  124  CEIWIDDLKLLSSANCKKDFPGTS---TKLDYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            CEIW DD ++    NC   F G S     +D S+CK      +Y L++      +  W+V
Sbjct  123  CEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVSTCKSSSEFVFYWLALH-----AQPWQV  177

Query  181  YKNCVAL  187
            Y NCVAL
Sbjct  178  YINCVAL  184

>PHYSO_329293
Length=310

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 26/128 (20%)

Query  71   GYASLRAMLDD---------ETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD  121
            GY SLR MLD          +T   V++    E  + +  Y+   I ++           
Sbjct  75   GYKSLREMLDPIAPDYGHSLKTATPVDVTGYTEMWWQNDEYKEGFINSHS----------  124

Query  122  GPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWE  179
            GPCE WIDD+K+    NC  +F     K+  DYSSCKG+C L +Y L++ +      +W+
Sbjct  125  GPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALHEP-----NWQ  179

Query  180  VYKNCVAL  187
            +YK CV +
Sbjct  180  IYKQCVPI  187

>PHYKE_6079
Length=302

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 67/138 (49%), Gaps = 17/138 (12%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP-------TNG  111
            T+A    F   K Y SL+ +++D     V  D+   CG  DP   +QP+P        + 
Sbjct  67   TAAFTTAFDSSK-YTSLKELINDLATITVT-DATLTCGSCDPDETAQPLPETYVEWSHSS  124

Query  112  KLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVS  169
               FT    +GPCE+W DD+++    +C  D+     +L  D+ +C G  TL +Y L++ 
Sbjct  125  SEGFTS-SHEGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH  183

Query  170  KTTGGSYSWEVYKNCVAL  187
             +T     W+VY NC  L
Sbjct  184  SST-----WQVYVNCAPL  196

>PHYCA_15124
Length=294

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 18/131 (14%)

Query  66   FLKQK----GYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMK  120
            F+K+K    G  SL+A++  ++ LY+  +D   ECG T     ++      +L FTG+  
Sbjct  69   FIKEKLPTTGGGSLKALISKNQKLYNDKVDP--ECGLTAFKDSARSKLPASQLEFTGFTH  126

Query  121  DGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKG--ECTLRWYALSVSKTTGGSY  176
             GPCE+W DD K+L   +C+  +P    K+ Y  S C G    T+ W A+          
Sbjct  127  PGPCEVWCDDTKVLFDYDCQAKYPDIPAKIPYDESKCSGANRLTIHWVAVH-------GE  179

Query  177  SWEVYKNCVAL  187
             W+VY +CV L
Sbjct  180  PWQVYTDCVYL  190

>PYU1_G005868
Length=267

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 30/129 (23%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD----------  121
            Y SLR MLD          ++ +CG+T    +  P+  +  L+   +  D          
Sbjct  75   YKSLREMLDS---------AVPDCGFT--LTDGTPVDVSS-LKSMKWQNDQEQKGFIDSH  122

Query  122  -GPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSW  178
             GPCE+WIDD K++ S +C+ D+     ++  DYS CKG+C L +Y L++ +      +W
Sbjct  123  HGPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLALHEP-----NW  177

Query  179  EVYKNCVAL  187
            ++YK CV +
Sbjct  178  QIYKQCVPI  186

>PHYCA_6388
Length=294

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query  67   LKQKGYASLRAMLD-DETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCE  125
            L   G  SL+A++  ++ LY+  +D   ECG T     ++      +L FTG+   GPCE
Sbjct  74   LSTTGGGSLKALISKNQKLYNDKVDP--ECGLTAFKDSARSKLPASQLEFTGFTHPGPCE  131

Query  126  IWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKG--ECTLRWYALSVSKTTGGSYSWEVY  181
            +W DD K+L   NC+  +P    K+ Y  S C G    T+ W A+           W+VY
Sbjct  132  VWCDDTKVLFDYNCQAKYPDIPAKIPYDESKCSGANRLTIHWIAVH-------GEPWQVY  184

Query  182  KNCVAL  187
             +CV L
Sbjct  185  TDCVYL  190

>PYIR_22134
Length=300

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 81/181 (45%), Gaps = 33/181 (18%)

Query  30   VTYPEPFFLLDGD-------------YESAASVARLEDQNVTTSADVAGFLKQKGYASLR  76
            ++ P+P F + GD               +   ++   D    T+A  A  LK   Y S+R
Sbjct  32   MSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAA-LKASTYDSVR  90

Query  77   AMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN----GKLRFTGYM--KDGPCEIWIDD  130
            A+++ + ++     +  ECG T  T  +QP+P            G+     GPCE+W D+
Sbjct  91   ALVEAKGVFISG--ATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVWCDN  148

Query  131  LKLLSSANCKKDFPGTSTKL--DYSSCKGECTLR--WYALSVSKTTGGSYSWEVYKNCVA  186
             K+ S  NC K++P    +L  D++ C G   L+  W AL        S +W++Y NC  
Sbjct  149  NKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH-------SSTWQIYINCAP  201

Query  187  L  187
            L
Sbjct  202  L  202

>PHYCA_122958
Length=260

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 72/163 (44%), Gaps = 31/163 (19%)

Query  39   LDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYT  98
            +  D   A    + +D  V  +A         GY+SLR MLD +         + +C  T
Sbjct  45   ITADVNGAFGGLKWDDNPVANAATFTSSFPNTGYSSLRNMLDQQ---------VSDCANT  95

Query  99   DPTYESQPIPTNGKLRFTGYMKD-----------GPCEIWIDDLKLLSSANCKKDFPGT-  146
                +  P+  +G L    +  D           GPCE+WIDD  +    +C   +  + 
Sbjct  96   KT--DVSPVDVSG-LTVMNWQNDQEQKGFIDSHHGPCEVWIDDTMVDHQDDCVATYGSSY  152

Query  147  --STKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              + K DYS C G+CTLR+Y L++ +      +W++YK CV +
Sbjct  153  PANVKADYSQCSGDCTLRFYWLALHEP-----NWQIYKQCVPI  190

>PITG_08892
Length=309

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 10/124 (8%)

Query  67   LKQKGYASLRAML-DDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCE  125
            L  KG  SL A++  ++ LY   +D   +CG T     ++      +L +TG+   GPCE
Sbjct  74   LATKGGGSLGALIAKNQKLYSSEVDP--DCGLTTFKDSARSKLPASQLEYTGFTHPGPCE  131

Query  126  IWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +W DD K+L   +C+  FPG+ +K+  D S C     L  Y L+V         W+VY +
Sbjct  132  VWCDDTKVLFDYDCQTKFPGSPSKIPFDESKCAKANRLTIYWLAVH-----GEQWQVYSD  186

Query  184  CVAL  187
            CV L
Sbjct  187  CVWL  190

>H257_11264
Length=282

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 68/129 (53%), Gaps = 21/129 (16%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT----GYM--K  120
            LK+  +ASLRA +D +       ++  ECG T      + +P++ K+++     G++   
Sbjct  74   LKKSSFASLRAFIDAQG------NTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSH  127

Query  121  DGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKG--ECTLRWYALSVSKTTGGSYSW  178
            +GPCE+W D  ++  + NC ++ P     ++ S C+G  +  + W AL  S+       W
Sbjct  128  EGPCELWCDATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ-------W  180

Query  179  EVYKNCVAL  187
            +VYKNCV L
Sbjct  181  QVYKNCVRL  189

>SPRG_07627
Length=536

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 26/134 (19%)

Query  66   FLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM  119
            F  Q  Y +LR +LD             +CG T P   ++ IP++GK+ +       G++
Sbjct  64   FAAQTQYKTLRDLLDLHGP---------DCGNTLPNVAAKAIPSDGKMTWKNPDTGEGFI  114

Query  120  --KDGPCEIWIDDLKLLSSANCKKDFPGTSTK---LDYSSC-KGECTLRWYALSVSKTTG  173
                GPCEIW+D  ++  + +C  +FP        +DY+ C    C LR+Y L++ +   
Sbjct  115  PSHTGPCEIWLDSTRVFQNNDCATNFPAAPEARLPVDYTKCGPNGCLLRFYWLALHQP--  172

Query  174  GSYSWEVYKNCVAL  187
                W+VYKNCV L
Sbjct  173  ---QWQVYKNCVPL  183

>SDRG_15426
Length=523

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 72/151 (48%), Gaps = 27/151 (18%)

Query  50   ARLEDQNVTTSADV-AGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP  108
             + +D   T  A+    F  Q  Y +LR +LD          S  +CG T      +PIP
Sbjct  23   GKFDDSPATNVANFNKAFAAQSQYKTLRDLLDL---------SGPDCGNTRTNVAPKPIP  73

Query  109  TNGKLRFT------GYM--KDGPCEIWIDDLKLLSSANCKKDF---PGTSTKLDYSSC-K  156
            ++G + +       G++    GPCEIW+D+ ++  + NC  +F   P     +DY+ C  
Sbjct  74   SDGMMTWQNPDTGEGFIPSHTGPCEIWLDNNRVFQNDNCATNFPTAPAARLPVDYTKCGP  133

Query  157  GECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              C LR+Y L++ +       W+VYKNCV L
Sbjct  134  NGCMLRFYWLALHQP-----QWQVYKNCVPL  159

>PPTG_18166
Length=445

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 20/120 (17%)

Query  83   TLYDVNIDSIFE--CGYTDPTYESQPIPTNGKLRF-----TGYMKDGPCEIWIDDLKLLS  135
            ++ DV +D + +  CG T      +PIP++GK+++      G+   GPCEI++DD  +L 
Sbjct  70   SVKDVVLDMVKDQKCGNTVENGSPKPIPSDGKVKWFGHRGGGFTHVGPCEIYLDDKMVLH  129

Query  136  SANCKKDFPGTSTK--------LDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +C++++PG S          +D+SSC G+CTL  Y L+          W+ Y NCV L
Sbjct  130  GDDCEEEYPGGSDGSSSGSEMPVDFSSCNGKCTLTIYWLAFQNA-----QWQTYVNCVPL  184

>PPTG_03138
Length=294

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 16/130 (12%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP-------TNGKLRFTGYM  119
             +   ++SL+ +++++    V+ D+   CG  DP   +QP+P        +    FT   
Sbjct  73   FESSSFSSLKELINEKATLTVS-DATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTA-S  130

Query  120  KDGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYS  177
             +GPCEIW DD+++    +C  D+     KL  D+ +C G   L +Y L++  +T     
Sbjct  131  HEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALHSST-----  185

Query  178  WEVYKNCVAL  187
            W+VY NC  L
Sbjct  186  WQVYVNCAPL  195

>PHYKE_10295
Length=292

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 24/160 (15%)

Query  38   LLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGY  97
            LL  D + A S  + +D     +A       +  + +LRA++D             +CG 
Sbjct  41   LLTADSDPAFSGLKWDDSPEKNTATFTSSFPKSQFKTLRALMDTVAP---------DCGN  91

Query  98   TDPTYESQPIPTNGKLRFT------GYM--KDGPCEIWIDDLKLLSSANCKKDFPG--TS  147
            T  T     +     +++       G++    GPCE WIDD +++ S +C+ D+P     
Sbjct  92   TALTGSPVDVSALSSMKWQNDQEQKGFIDSHHGPCEAWIDDTRVMQSDDCRADYPNYPAE  151

Query  148  TKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +DYSSC G+CT  +Y +++ +      +W+VYK C  +
Sbjct  152  IPIDYSSCSGDCTFTFYWMALHEP-----NWQVYKQCAPI  186

>PYU1_G001528
Length=274

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 81/180 (45%), Gaps = 31/180 (17%)

Query  30   VTYPEPFFLLDGD------------YESAASVARLEDQNVTTSADVAGFLKQKGYASLRA  77
            ++ P+P F ++GD              + A ++   D    T+A  A  LK   Y S+R 
Sbjct  30   MSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAA-LKTSSYKSVRD  88

Query  78   MLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGYMKDGPCEIWIDDL  131
            + + + +  V   +  +CGYT  T  +QP+P      ++G          GPCE+W D++
Sbjct  89   LWNAKGVLGVT-GATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCEVWCDNV  147

Query  132  KLLSSANCKKDFPGTSTKL--DYSSCKGE--CTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
               +  NC K++P    KL  D++ C G+   T+ W AL        S  W+ Y NC  L
Sbjct  148  LAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALH-------SPQWQAYINCAPL  200

>PHYKE_10296
Length=512

 Score = 67.4 bits (163),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 60/128 (47%), Gaps = 26/128 (20%)

Query  71   GYASLRAMLDD---------ETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKD  121
            GY SLR MLD          ET   VN+    E  + +  Y+   I ++          +
Sbjct  75   GYKSLRDMLDPIAPGYGFSLETADPVNVAGYTEMWWQNDEYKEGFIASH----------E  124

Query  122  GPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWE  179
            GPCE WIDD+ +    NC   F     K+  DYSSCKG+C   +Y L++ +       W+
Sbjct  125  GPCEGWIDDIMVFHHDNCAAQFKSYPAKIPTDYSSCKGDCLFVFYWLALHQA-----EWQ  179

Query  180  VYKNCVAL  187
            +YK CV +
Sbjct  180  IYKQCVPI  187

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (46%), Gaps = 33/147 (22%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDD---------ETLYDVNIDSIFECGYTDPTYES  104
            +QNV    D     K  GY SLR MLD          ET   V++ +I E  + +  Y+ 
Sbjct  341  EQNVQAFTD---HWKATGYKSLRDMLDPLSPGYGFSLETADPVDVSNIKEMWWQNDEYKE  397

Query  105  QPIPTNGKLRFTGYMK--DGPCEIWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECT  160
                        G+++   GPCE WID   +    +C   FP    K+  DYSSCKG+C 
Sbjct  398  ------------GFLESHHGPCEGWIDGKMVFHYDDCVAKFPSYPAKIPTDYSSCKGDCL  445

Query  161  LRWYALSVSKTTGGSYSWEVYKNCVAL  187
              +Y L++ +       W++YK CV +
Sbjct  446  FVFYWLALHQA-----DWQIYKQCVPI  467

>PYU1_G005871
Length=284

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 24/127 (19%)

Query  71   GYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM--KDG  122
            GY SL+ M+D          ++  CGY++P      +     ++F       G++    G
Sbjct  79   GYKSLKQMMDK---------AVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  129

Query  123  PCEIWIDDLKLLSSANCKKDFPG--TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            PCE WID+ ++    +C   FPG   +  + Y SCKG C L +Y L++      S  W+ 
Sbjct  130  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH-----SPKWQA  184

Query  181  YKNCVAL  187
            YK+CVA+
Sbjct  185  YKSCVAI  191

>PYIW_16810
Length=216

 Score = 65.5 bits (158),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 84/171 (49%), Gaps = 19/171 (11%)

Query  29   KVTYPEPFFLLDGDYES---AASVARLEDQNVTTSADVAGFLKQKGYASLRA-MLDDETL  84
            ++  P P F+     +    A  V   ++    T+A  A   K+ G+ SLRA ++D++T 
Sbjct  28   RLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIMDNQTP  87

Query  85   --YDVNIDS-IFECGYTDPTYESQPIPTNGKLRFTG--YMKDGPCEIWIDDLKLLS-SAN  138
              YD        ECG+TDP    QP+P   KL + G  +  +GPCE W DD+ ++  +A+
Sbjct  88   GKYDGKPSGGTPECGFTDPNGTPQPLPD--KLGWPGPTFQHEGPCEAWCDDVLVMPFTAS  145

Query  139  CKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            CK    G   ++ Y  + C G+  L +Y L+   +      ++ Y NCV +
Sbjct  146  CKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFVS-----PFQAYTNCVPI  191

>H310_05432
Length=301

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (52%), Gaps = 22/137 (16%)

Query  59   TSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF---  115
            T+A V  F K+  + SL+A++  +        +  ECG T      QP+P +G +++   
Sbjct  64   TNAFVRQF-KKSSFTSLKALVHSQPT------TCGECGITRDDGTPQPMPLDGIVKWGHG  116

Query  116  -TGYM--KDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDYSSCKGECTLR--WYALSVSK  170
              GY+   +GPCE+W D  ++ S+ NC ++ P  +  ++ ++CKG   L   W A+  S 
Sbjct  117  NEGYVSSHEGPCEVWCDATRVYSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAMHTS-  175

Query  171  TTGGSYSWEVYKNCVAL  187
                  SW+VY NCV L
Sbjct  176  ------SWQVYINCVPL  186

>PHYSO_246481
Length=318

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 61/129 (47%), Gaps = 14/129 (11%)

Query  67   LKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIP------TNGKLRFTGYMK  120
             +   Y SL+ +++D+    V  D+   CG  DP   +QP+P      ++          
Sbjct  74   FEASSYTSLKELINDKATITVT-DATLTCGSCDPDETAQPLPDTYVEWSHSSTEGFSSSH  132

Query  121  DGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLRWYALSVSKTTGGSYSW  178
             GPCE+W DD+++    +C  D+     +L Y   +C G  TL +Y L++  +T     W
Sbjct  133  AGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALHSST-----W  187

Query  179  EVYKNCVAL  187
            +VY NC  L
Sbjct  188  QVYINCAPL  196

>PYVX_24563
Length=254

 Score = 65.9 bits (159),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 28/129 (22%)

Query  71   GYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRF--------TGYM--K  120
            GY SLRAM+D+         S+ +CG T    +  P+   GK            G++   
Sbjct  77   GYTSLRAMIDE---------SVSDCGNTRT--DVSPVDMTGKKVLHWQNDQEGVGFVSSH  125

Query  121  DGPCEIWIDDLKLLSSANCKKDFPG--TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSW  178
             GPCE+WIDD+ +    +C+  +     +   D+S C G CTLR+Y L++ +      +W
Sbjct  126  HGPCEVWIDDVMVTHQDDCRAVYTSYPANVDADFSKCSGSCTLRFYWLALHEP-----NW  180

Query  179  EVYKNCVAL  187
            ++YK C  +
Sbjct  181  QIYKQCAPI  189

>PYU1_G001525
Length=312

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 62/138 (45%), Gaps = 13/138 (9%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKL  113
            D    T A  A F  Q  Y SL+ ++       V   +  ECG++  +   QP+P   + 
Sbjct  60   DPTSNTKAFTAAFKAQTKYKSLKDLV--FATQTVESGTTKECGFSLVSGTPQPLPDVVEW  117

Query  114  RFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLR--WYALSVS  169
                   +GPCEIW D+    S+ NC K++PGT  KL Y  S C G   L   W AL   
Sbjct  118  DELTPSHEGPCEIWCDNKLAFSNENCAKNYPGTPAKLPYDKSKCTGAKMLTSIWLALHTP  177

Query  170  KTTGGSYSWEVYKNCVAL  187
                   +W+VY NC  L
Sbjct  178  -------TWQVYTNCAPL  188

>PYU1_G005872
Length=297

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 24/127 (19%)

Query  71   GYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKLRFT------GYM--KDG  122
            GY SL+ M+D          ++  CGY++P      +     ++F       G++    G
Sbjct  79   GYKSLKQMMDK---------AVPGCGYSNPNAAPVDVSKMSAMKFQNNEYKEGFLGSHHG  129

Query  123  PCEIWIDDLKLLSSANCKKDFPG--TSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEV  180
            PCE WID+ ++    +C   FPG   +  + Y SCKG C L +Y L++      S  W+ 
Sbjct  130  PCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALH-----SPKWQA  184

Query  181  YKNCVAL  187
            YK+CVA+
Sbjct  185  YKSCVAI  191

>CCA17179
Length=185

 Score = 64.7 bits (156),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 72/156 (46%), Gaps = 24/156 (15%)

Query  42   DYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPT  101
            D  S     + +   +  +A          + +LR  L D+  Y         CG T+P 
Sbjct  16   DRFSPTFSGKFDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPN  66

Query  102  YESQPIPTNGKLRFT------GYMKD--GPCEIWIDDLKLLSSANCKKDFPGTSTK--LD  151
             + +PIP +  + +       G++    GPCE+W+++ ++    NC + F  +  +  +D
Sbjct  67   AQPKPIPADHAIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPID  126

Query  152  YSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187
            +S+C   C L+++ L++ +       W+VYKNC+ +
Sbjct  127  FSTCTNGCLLQFFWLALHEP-----QWQVYKNCIPI  157

>PYU1_G001524
Length=300

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 44/138 (32%), Positives = 61/138 (44%), Gaps = 13/138 (9%)

Query  54   DQNVTTSADVAGFLKQKGYASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTNGKL  113
            D    T A  A F  Q  Y S++ M+D      +   +  ECG++     +QP+P   + 
Sbjct  62   DPASNTKAYTAAFKAQTKYTSMKQMVD--ATQKLESGASKECGFSLVNGAAQPLPDQVEW  119

Query  114  RFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGTSTKLDY--SSCKGECTLR--WYALSVS  169
                   +GPCE+W DD    S  NC  ++P +  KL Y  S C G   L   W AL V 
Sbjct  120  DQLPASHEGPCEVWCDDKLAFSDENCAINYPDSPAKLPYDKSKCTGAKMLTSVWLALHVP  179

Query  170  KTTGGSYSWEVYKNCVAL  187
                   +W+VY NC  L
Sbjct  180  -------TWQVYYNCAPL  190

>PHYCA_19598
Length=390

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (48%), Gaps = 14/124 (11%)

Query  72   YASLRAMLDDETLYDVNIDSIFECGYTDPTYESQPIPTN----GKLRFTGYM--KDGPCE  125
            Y SL+ +  D+    V+  +   CG  DP  E QP+P +          G+    +GPCE
Sbjct  76   YKSLKDLFTDKAKITVS-GATLTCGSCDPKEEPQPMPESIVEWSHSDSEGFTPSHEGPCE  134

Query  126  IWIDDLKLLSSANCKKDFPGTSTKL--DYSSCKGECTLRWYALSVSKTTGGSYSWEVYKN  183
            +W DD++     NC  +FP    K+  D  +C G  TL +Y +++   T     W+VY N
Sbjct  135  VWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMHSDT-----WQVYVN  189

Query  184  CVAL  187
            C  L
Sbjct  190  CAPL  193

Lambda      K        H        a         alpha
   0.314    0.130    0.390    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 13029669768

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40