Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_26626147522122129572e-132
PYU1_G001740147522061887306e-98
PYU1_G001744568762131667151e-95
PYU1_G001742932042131666933e-92
PYU1_G001741854041991666854e-91
PYIR_25089854042621676697e-88
PHYSO_284086147522041665961e-77
PHYCA_129425147522041665864e-76
PYAP_22278932042891715822e-74
PYU1_G001739932032661645803e-74
PPTG_17122147522041895664e-73
PHYRA_85631109792281655624e-72
PPTG_10635528561991645594e-72
PHYSO_341599109791851675567e-72
PHYRA_82864231281931665542e-71
PHYKE_8389147522041675552e-71
PHYCA_14369109792481665583e-71
PPTG_10636109792461645567e-71
PPTG_10643457052501655532e-70
PHYRA_84190720132061655492e-70
PPTG_10634720132081655475e-70
PITG_18450147522031895457e-70
PHYCA_102852242061951655431e-69
PYAP_22279854042231655432e-69
PHYSO_536424606911971665361e-68
PHYSO_507031586531971665361e-68
PHYRA_81106147522021665352e-68
PHYCA_102550457052681625378e-68
PHYCA_102624720131951645301e-67
PHALS_00498109791991665282e-67
PPTG_15264231281941675255e-67
PPTG_17366239131941675255e-67
PHYKE_3446231281991655231e-66
PHYKE_7718109792201645223e-66
PYVX_18173449665001615435e-66
PHYRA_81107568762021655134e-65
PHYKE_8388568762051655111e-64
PPTG_17121568762021655092e-64
PHYSO_477820568762021645074e-64
PHYCA_511409568762041665022e-63
PYVX_18174854042041665013e-63
PHALS_03284309411881654961e-62
PYVX_18176568762011654944e-62
PYIW_18791854041941634883e-61
PPTG_10048213141901634831e-60
PYAP_22273932032681674821e-59
PPTG_0882086622501694663e-57
PYIR_26546866052391704626e-57
PYAR_24096932032271654618e-57
PHYCA_510817445761881704343e-53
PHYSO_499978231281741534255e-52
PHYSO_501575820771741534255e-52
PPTG_14255469372681694326e-52
PPTG_14254445761881704222e-51
PITG_1049986623231494262e-50
PHYSO_417649445761851704126e-50
PITG_13520109791711354099e-50
PYU1_G001738534612261654086e-49
PHYKE_9185445762811714102e-48
PHYCA_53693413059831684325e-48
PHYSO_254168462841701483951e-47
HYAP_07096534612511684012e-47
PPTG_17123147532011693963e-47
PHYCA_537323449662001693937e-47
PHYSO_343376532371721333882e-46
PHYSO_262732469371881713892e-46
PHYRA_81105534612011683884e-46
PYIW_18788932032441673854e-45
PHYSO_353401534611461393722e-44
PITG_18452147538561674017e-44
PYIW_18792932041251043493e-41
PHYSO_341596528562311293574e-41
PHYSO_527908600641741563422e-39
PYAP_18131991722261143392e-38
PHYCA_14368528562191663382e-38
PHYSO_340369526762001663041e-33
PHYSO_246676457051871652988e-33
PYVX_18179534611471642732e-29
PYAP_18711943562101752772e-29
PYIW_187905687686802542e-27
PYAP_246891014392521342654e-27
PHYSO_342364529831941792543e-26
PYU1_G007476539131951322492e-25
PYIR_1644442341821722456e-25
PYIR_1643542333041302511e-24
PYIR_2213497753001862482e-24
PYIW_27477823991801282387e-24
PYAP_18709943552351332364e-23
PYIR_16443823992751812385e-23
PYAR_14260845342121342311e-22
PYAR_14256943551991332283e-22
H310_0636217301971302273e-22
H257_1355017302661602314e-22
PYIR_24421899032131332266e-22
PYU1_G01469042342951712317e-22
PYVX_18175147521471642217e-22
PYIW_242891643031961832258e-22
PYIW_19151831912481742271e-21
PYU1_G005323943552511332252e-21
PYU1_G005324845341911352212e-21
PYU1_G005326463491911352212e-21
PYU1_G00532842331911352212e-21
PYIW_242881643022011882196e-21
PHYRA_74651699693441852258e-21
PHYCA_98479819502761182228e-21
PYU1_G005325943562071332189e-21
PPTG_0750738072991832239e-21
PHYSO_438103557212381802201e-20
PPTG_07509718142991822221e-20
PHYKE_10578778802391842191e-20
PYU1_G001528861322741832202e-20
PHYRA_78625541464341692252e-20
PHYRA_78626578954731692252e-20
PITG_0527144782781812192e-20
PPTG_04622696962731292192e-20
PYIW_168101650732161752153e-20
PHYKE_6077188563221342204e-20
PHYCA_13036542352661362166e-20
PYAP_1871342341841602116e-20
PYIR_22133839874411802209e-20
PHYCA_12727044782791802141e-19
PHYCA_12942213313531782152e-19
PHYCA_534473423310501292192e-19
PHYSO_533903604652081812082e-19
PHYKE_600144782891802132e-19
PYIW_2196497752651842113e-19
PHYRA_7358442332871352113e-19
PHYRA_73607194343431352133e-19
PHYKE_1029517292921422124e-19
PHYRA_73606571983661382144e-19
PPTG_07521450302811182114e-19
PITG_1193697753331382125e-19
PHYCA_97965401872881822106e-19
PPTG_04647194343271302116e-19
PHALS_03179308833721802126e-19
PPTG_0461842353261802116e-19
CCI4738117292111402067e-19
PHYRA_7868968382961802107e-19
PPTG_0315697874451862137e-19
PHYSO_533682604462781352097e-19
PHYCA_12943369712871822098e-19
PYAR_2411397811921752049e-19
PITG_0494942353371802101e-18
PHYCA_534296526713091342091e-18
PPTG_0313997753201382091e-18
PHYRA_7358242353261822091e-18
PYU1_G001514188574691242112e-18
PYIR_25999861323441832092e-18
PHYSO_48395542353201802082e-18
SPRG_0782697753711852082e-18
PYU1_G00152797792781252053e-18
PYU1_G00152397762781252053e-18
PHYSO_340333526712841812053e-18
SPRG_078251259983371852073e-18
PHYRA_78176597733121382063e-18
PHYRA_77971705552301772023e-18
PHYRA_86752732363001842053e-18
PHYSO_34033244782951812053e-18
PHYRA_85794726192301772023e-18
PYAP_22462820772101872004e-18
PHYRA_78175764333191382054e-18
PHYKE_2937571983661302064e-18
SDRG_009721259983331852055e-18
PYU1_G007364851643161862045e-18
SDRG_165341259793201772045e-18
PYAR_18165995792611132026e-18
PYAR_206171040482541682016e-18
SPRG_077971259813181802046e-18
PPTG_1422144782751812017e-18
PYAP_19707995792411042008e-18
PITG_0494842342321291998e-18
PHYCA_531163194343141382039e-18
PYU1_G001520839873791812049e-18
SDRG_165351259803131782021e-17
SPRG_077951259793351772031e-17
PYIW_254631650392161221981e-17
PYU1_G00152697803341242031e-17
CCA1717917291851401951e-17
PYU1_G00586817292671371991e-17
PHYSO_484051571982851302001e-17
PHYKE_771752856568442042e-17
PYIR_23585845342401321972e-17
PHYCA_1961197755311382032e-17
PHALS_0539242353671342012e-17
PHYRA_78161375713731872012e-17
PHYKE_6002526711971681942e-17
PHYRA_86016727462361051972e-17
PPTG_07516464352941841992e-17
PPTG_0752038142941841992e-17
PYVX_14662510865401432032e-17
PYAP_24691101441145701903e-17
PHYKE_1913732362801841973e-17
PYIR_15187820772071851943e-17
PYIR_19612831912601791963e-17
SPRG_199171339462411401954e-17
HYAP_0168373983361281984e-17
PHYRA_84732161732651821964e-17
SPRG_077961259803221781984e-17
PYIR_26867868821631301904e-17
PHYKE_2454751493741351994e-17
PPTG_03153597733141341974e-17
H257_112641259792821801964e-17
PHYRA_7817297763851851995e-17
PYAP_222571003612471461945e-17
PYVX_20783375052761781955e-17
PYU1_G005985820772001821916e-17
PYIW_1552617302561421946e-17
PPTG_0461942342761291956e-17
PHALS_0317644782071801926e-17
SPRG_19916161733051411966e-17
PHYSO_48552442342781291956e-17
PHYKE_2539161732581841946e-17
SPRG_077991259833451791977e-17
PYU1_G00151997822651831931e-16
PHYRA_83499204334731841971e-16
PHYSO_459106194342231301911e-16
PYIR_2048117292771371931e-16
SPRG_2216117303001401931e-16
H257_112651431862821801931e-16
PHYSO_524101597733081361941e-16
H310_054321431863011731932e-16
PHYSO_31868397763521851942e-16
PYIR_24743851643571841942e-16
PHYSO_426658554392101891892e-16
PYAP_236721009052571701902e-16
PHALS_03177526712591791902e-16
PHYSO_488921574612961361913e-16
PYAR_2481897821981781873e-16
PHYSO_329293510323101361923e-16
PYU1_G005871944962841941913e-16
PHYCA_122958161732601831893e-16
HYAP_14170161732661841903e-16
PHYSO_476077161732681851903e-16
PHYSO_472009159812681851903e-16
SDRG_009481259833521791924e-16
PYAP_1858417292101831864e-16
PYU1_G005872161732971941904e-16
PPTG_03138188562941871895e-16
PHYCA_19612188566101381926e-16
PHYRA_84947539132651711876e-16
PITG_1981815643147641817e-16
PITG_1193797763051851887e-16
PYAP_18221944962261431858e-16
PYVX_16138786195591781919e-16
PYIW_2557397812791751879e-16
PHYKE_391342343211281889e-16
PHYCA_19598375713901351891e-15
SDRG_173181339462411401851e-15
PYU1_G005873510322141941831e-15
PHYRA_7729317293021391871e-15
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_26626

Length=212
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_26626                                                            373        2e-132
PYU1_G001740                                                          285        6e-98 
PYU1_G001744                                                          280        1e-95 
PYU1_G001742                                                          271        3e-92 
PYU1_G001741                                                          268        4e-91 
PYIR_25089                                                            262        7e-88 
PHYSO_284086                                                          234        1e-77 
PHYCA_129425                                                          230        4e-76 
PYAP_22278                                                            228        2e-74 
PYU1_G001739                                                          228        3e-74 
PPTG_17122                                                            222        4e-73 
PHYRA_85631                                                           221        4e-72 
PPTG_10635                                                            219        4e-72 
PHYSO_341599                                                          218        7e-72 
PHYRA_82864                                                           218        2e-71 
PHYKE_8389                                                            218        2e-71 
PHYCA_14369                                                           219        3e-71 
PPTG_10636                                                            218        7e-71 
PPTG_10643                                                            217        2e-70 
PHYRA_84190                                                           216        2e-70 
PPTG_10634                                                            215        5e-70 
PITG_18450                                                            214        7e-70 
PHYCA_102852                                                          213        1e-69 
PYAP_22279                                                            213        2e-69 
PHYSO_536424                                                          211        1e-68 
PHYSO_507031                                                          211        1e-68 
PHYRA_81106                                                           210        2e-68 
PHYCA_102550                                                          211        8e-68 
PHYCA_102624                                                          208        1e-67 
PHALS_00498                                                           207        2e-67 
PPTG_15264                                                            206        5e-67 
PPTG_17366                                                            206        5e-67 
PHYKE_3446                                                            206        1e-66 
PHYKE_7718                                                            205        3e-66 
PYVX_18173                                                            213        5e-66 
PHYRA_81107                                                           202        4e-65 
PHYKE_8388                                                            201        1e-64 
PPTG_17121                                                            200        2e-64 
PHYSO_477820                                                          199        4e-64 
PHYCA_511409                                                          197        2e-63 
PYVX_18174                                                            197        3e-63 
PHALS_03284                                                           195        1e-62 
PYVX_18176                                                            194        4e-62 
PYIW_18791                                                            192        3e-61 
PPTG_10048                                                            190        1e-60 
PYAP_22273                                                            190        1e-59 
PPTG_08820                                                            184        3e-57 
PYIR_26546                                                            182        6e-57 
PYAR_24096                                                            182        8e-57 
PHYCA_510817                                                          171        3e-53 
PHYSO_499978                                                          168        5e-52 
PHYSO_501575                                                          168        5e-52 
PPTG_14255                                                            171        6e-52 
PPTG_14254                                                            167        2e-51 
PITG_10499                                                            168        2e-50 
PHYSO_417649                                                          163        6e-50 
PITG_13520                                                            162        9e-50 
PYU1_G001738                                                          161        6e-49 
PHYKE_9185                                                            162        2e-48 
PHYCA_536934                                                          171        5e-48 
PHYSO_254168                                                          156        1e-47 
HYAP_07096                                                            159        2e-47 
PPTG_17123                                                            157        3e-47 
PHYCA_537323                                                          155        7e-47 
PHYSO_343376                                                          154        2e-46 
PHYSO_262732                                                          154        2e-46 
PHYRA_81105                                                           154        4e-46 
PYIW_18788                                                            152        4e-45 
PHYSO_353401                                                          147        2e-44 
PITG_18452                                                            159        7e-44 
PYIW_18792                                                            139        3e-41 
PHYSO_341596                                                          142        4e-41 
PHYSO_527908                                                          136        2e-39 
PYAP_18131                                                            135        2e-38 
PHYCA_14368                                                           134        2e-38 
PHYSO_340369                                                          121        1e-33 
PHYSO_246676                                                          119        8e-33 
PYVX_18179                                                            109        2e-29 
PYAP_18711                                                            111        2e-29 
PYIW_18790                                                            102        2e-27 
PYAP_24689                                                            106        4e-27 
PHYSO_342364                                                          102        3e-26 
PYU1_G007476                                                          100        2e-25 
PYIR_16444                                                            99.0       6e-25 
PYIR_16435                                                            101        1e-24 
PYIR_22134                                                            100        2e-24 
PYIW_27477                                                            96.3       7e-24 
PYAP_18709                                                            95.5       4e-23 
PYIR_16443                                                            96.3       5e-23 
PYAR_14260                                                            93.6       1e-22 
PYAR_14256                                                            92.4       3e-22 
H310_06362                                                            92.0       3e-22 
H257_13550                                                            93.6       4e-22 
PYIR_24421                                                            91.7       6e-22 
PYU1_G014690                                                          93.6       7e-22 
PYVX_18175                                                            89.7       7e-22 
PYIW_24289                                                            91.3       8e-22 
PYIW_19151                                                            92.0       1e-21 
PYU1_G005323                                                          91.3       2e-21 
PYU1_G005324                                                          89.7       2e-21 
PYU1_G005326                                                          89.7       2e-21 
PYU1_G005328                                                          89.7       2e-21 
PYIW_24288                                                            89.0       6e-21 
PHYRA_74651                                                           91.3       8e-21 
PHYCA_98479                                                           90.1       8e-21 
PYU1_G005325                                                          88.6       9e-21 
PPTG_07507                                                            90.5       9e-21 
PHYSO_438103                                                          89.4       1e-20 
PPTG_07509                                                            90.1       1e-20 
PHYKE_10578                                                           89.0       1e-20 
PYU1_G001528                                                          89.4       2e-20 
PHYRA_78625                                                           91.3       2e-20 
PHYRA_78626                                                           91.3       2e-20 
PITG_05271                                                            89.0       2e-20 
PPTG_04622                                                            89.0       2e-20 
PYIW_16810                                                            87.4       3e-20 
PHYKE_6077                                                            89.4       4e-20 
PHYCA_130365                                                          87.8       6e-20 
PYAP_18713                                                            85.9       6e-20 
PYIR_22133                                                            89.4       9e-20 
PHYCA_127270                                                          87.0       1e-19 
PHYCA_12942                                                           87.4       2e-19 
PHYCA_534473                                                          89.0       2e-19 
PHYSO_533903                                                          84.7       2e-19 
PHYKE_6001                                                            86.7       2e-19 
PYIW_21964                                                            85.9       3e-19 
PHYRA_73584                                                           85.9       3e-19 
PHYRA_73607                                                           86.7       3e-19 
PHYKE_10295                                                           86.3       4e-19 
PHYRA_73606                                                           87.0       4e-19 
PPTG_07521                                                            85.9       4e-19 
PITG_11936                                                            86.3       5e-19 
PHYCA_97965                                                           85.5       6e-19 
PPTG_04647                                                            85.9       6e-19 
PHALS_03179                                                           86.3       6e-19 
PPTG_04618                                                            85.9       6e-19 
CCI47381                                                              84.0       7e-19 
PHYRA_78689                                                           85.5       7e-19 
PPTG_03156                                                            86.7       7e-19 
PHYSO_533682                                                          85.1       7e-19 
PHYCA_12943                                                           85.1       8e-19 
PYAR_24113                                                            83.2       9e-19 
PITG_04949                                                            85.5       1e-18 
PHYCA_534296                                                          85.1       1e-18 
PPTG_03139                                                            85.1       1e-18 
PHYRA_73582                                                           85.1       1e-18 
PYU1_G001514                                                          85.9       2e-18 
PYIR_25999                                                            85.1       2e-18 
PHYSO_483955                                                          84.7       2e-18 
SPRG_07826                                                            84.7       2e-18 
PYU1_G001527                                                          83.6       3e-18 
PYU1_G001523                                                          83.6       3e-18 
PHYSO_340333                                                          83.6       3e-18 
SPRG_07825                                                            84.3       3e-18 
PHYRA_78176                                                           84.0       3e-18 
PHYRA_77971                                                           82.4       3e-18 
PHYRA_86752                                                           83.6       3e-18 
PHYSO_340332                                                          83.6       3e-18 
PHYRA_85794                                                           82.4       3e-18 
PYAP_22462                                                            81.6       4e-18 
PHYRA_78175                                                           83.6       4e-18 
PHYKE_2937                                                            84.0       4e-18 
SDRG_00972                                                            83.6       5e-18 
PYU1_G007364                                                          83.2       5e-18 
SDRG_16534                                                            83.2       5e-18 
PYAR_18165                                                            82.4       6e-18 
PYAR_20617                                                            82.0       6e-18 
SPRG_07797                                                            83.2       6e-18 
PPTG_14221                                                            82.0       7e-18 
PYAP_19707                                                            81.6       8e-18 
PITG_04948                                                            81.3       8e-18 
PHYCA_531163                                                          82.8       9e-18 
PYU1_G001520                                                          83.2       9e-18 
SDRG_16535                                                            82.4       1e-17 
SPRG_07795                                                            82.8       1e-17 
PYIW_25463                                                            80.9       1e-17 
PYU1_G001526                                                          82.8       1e-17 
CCA17179                                                              79.7       1e-17 
PYU1_G005868                                                          81.3       1e-17 
PHYSO_484051                                                          81.6       1e-17 
PHYKE_7717                                                            83.2       2e-17 
PYIR_23585                                                            80.5       2e-17 
PHYCA_19611                                                           82.8       2e-17 
PHALS_05392                                                           82.0       2e-17 
PHYRA_78161                                                           82.0       2e-17 
PHYKE_6002                                                            79.3       2e-17 
PHYRA_86016                                                           80.5       2e-17 
PPTG_07516                                                            81.3       2e-17 
PPTG_07520                                                            81.3       2e-17 
PYVX_14662                                                            82.8       2e-17 
PYAP_24691                                                            77.8       3e-17 
PHYKE_1913                                                            80.5       3e-17 
PYIR_15187                                                            79.3       3e-17 
PYIR_19612                                                            80.1       3e-17 
SPRG_19917                                                            79.7       4e-17 
HYAP_01683                                                            80.9       4e-17 
PHYRA_84732                                                           80.1       4e-17 
SPRG_07796                                                            80.9       4e-17 
PYIR_26867                                                            77.8       4e-17 
PHYKE_2454                                                            81.3       4e-17 
PPTG_03153                                                            80.5       4e-17 
H257_11264                                                            80.1       4e-17 
PHYRA_78172                                                           81.3       5e-17 
PYAP_22257                                                            79.3       5e-17 
PYVX_20783                                                            79.7       5e-17 
PYU1_G005985                                                          78.2       6e-17 
PYIW_15526                                                            79.3       6e-17 
PPTG_04619                                                            79.7       6e-17 
PHALS_03176                                                           78.6       6e-17 
SPRG_19916                                                            80.1       6e-17 
PHYSO_485524                                                          79.7       6e-17 
PHYKE_2539                                                            79.3       6e-17 
SPRG_07799                                                            80.5       7e-17 
PYU1_G001519                                                          79.0       1e-16 
PHYRA_83499                                                           80.5       1e-16 
PHYSO_459106                                                          78.2       1e-16 
PYIR_20481                                                            79.0       1e-16 
SPRG_22161                                                            79.0       1e-16 
H257_11265                                                            79.0       1e-16 
PHYSO_524101                                                          79.3       1e-16 
H310_05432                                                            79.0       2e-16 
PHYSO_318683                                                          79.3       2e-16 
PYIR_24743                                                            79.3       2e-16 
PHYSO_426658                                                          77.4       2e-16 
PYAP_23672                                                            77.8       2e-16 
PHALS_03177                                                           77.8       2e-16 
PHYSO_488921                                                          78.2       3e-16 
PYAR_24818                                                            76.6       3e-16 
PHYSO_329293                                                          78.6       3e-16 
PYU1_G005871                                                          78.2       3e-16 
PHYCA_122958                                                          77.4       3e-16 
HYAP_14170                                                            77.8       3e-16 
PHYSO_476077                                                          77.8       3e-16 
PHYSO_472009                                                          77.8       3e-16 
SDRG_00948                                                            78.6       4e-16 
PYAP_18584                                                            76.3       4e-16 
PYU1_G005872                                                          77.8       4e-16 
PPTG_03138                                                            77.4       5e-16 
PHYCA_19612                                                           78.6       6e-16 
PHYRA_84947                                                           76.6       6e-16 
PITG_19818                                                            74.3       7e-16 
PITG_11937                                                            77.0       7e-16 
PYAP_18221                                                            75.9       8e-16 
PYVX_16138                                                            78.2       9e-16 
PYIW_25573                                                            76.6       9e-16 
PHYKE_3913                                                            77.0       9e-16 
PHYCA_19598                                                           77.4       1e-15 
SDRG_17318                                                            75.9       1e-15 
PYU1_G005873                                                          75.1       1e-15 
PHYRA_77293                                                           76.6       1e-15 
PPTG_18166                                                            77.4       1e-15 
PHYKE_2809                                                            76.3       1e-15 
PHYCA_112615                                                          74.7       1e-15 
PPTG_01148                                                            76.3       2e-15 
PHYKE_7445                                                            77.0       2e-15 
PHYCA_562062                                                          75.1       2e-15 
PHYRA_79140                                                           77.0       2e-15 
PHYCA_18657                                                           75.9       2e-15 
PHYKE_6078                                                            76.3       2e-15 
PHYSO_262844                                                          75.5       2e-15 
PHYCA_120062                                                          74.3       2e-15 
PHYSO_533747                                                          74.3       2e-15 
PHYRA_73583                                                           77.0       2e-15 
PHYRA_83494                                                           74.3       3e-15 
PHYKE_9024                                                            75.5       3e-15 
PYAP_14265                                                            75.5       3e-15 
PHYKE_8390                                                            72.0       3e-15 
PYIR_25571                                                            75.5       3e-15 
PITG_01966                                                            75.9       3e-15 
PITG_20312                                                            75.1       3e-15 
PYVX_20789                                                            75.1       3e-15 
PYVX_24563                                                            74.7       3e-15 
SDRG_17317                                                            71.6       4e-15 
PYIW_24287                                                            75.5       4e-15 
H257_11258                                                            75.5       4e-15 
PPTG_03160                                                            75.5       5e-15 
PHYKE_8104                                                            70.1       5e-15 
PHYCA_123316                                                          74.7       5e-15 
PYU1_G001525                                                          74.7       6e-15 
PHYRA_80632                                                           75.1       6e-15 
PYAR_16493                                                            73.9       6e-15 
PHYKE_6079                                                            74.7       6e-15 
PITG_04947                                                            74.7       6e-15 
PHYCA_14560                                                           74.3       7e-15 
PYIR_20482                                                            71.6       7e-15 
PYU1_G005867                                                          72.8       7e-15 
PHYRA_83500                                                           75.1       7e-15 
SDRG_07565                                                            73.9       8e-15 
PHALS_02044                                                           73.2       8e-15 
PITG_20631                                                            73.9       8e-15 
PPTG_04620                                                            74.7       9e-15 
PYAR_25093                                                            72.4       9e-15 
PHYCA_103479                                                          74.3       9e-15 
PYU1_G007254                                                          72.0       9e-15 
SDRG_08137                                                            73.9       1e-14 
PPTG_10186                                                            73.6       1e-14 
PHYCA_15126                                                           74.3       1e-14 
PYU1_G001524                                                          73.9       1e-14 
PYAP_19712                                                            73.6       1e-14 
PHYCA_132255                                                          70.5       1e-14 
PPTG_06256                                                            73.9       1e-14 
PHYCA_69583                                                           72.4       1e-14 
PPTG_03140                                                            73.9       2e-14 
PITG_11942                                                            73.2       2e-14 
PHYRA_86201                                                           73.2       2e-14 
PYIR_14463                                                            73.9       2e-14 
PHYSO_246481                                                          73.2       2e-14 
PHYSO_255975                                                          71.2       2e-14 
PHYKE_9023                                                            72.8       2e-14 
PHYRA_78164                                                           73.2       2e-14 
SDRG_15426                                                            73.9       3e-14 
PPTG_06253                                                            72.8       3e-14 
PITG_08892                                                            72.8       3e-14 
PITG_11951                                                            70.5       3e-14 
PHYKE_10296                                                           73.6       3e-14 
PHYSO_374518                                                          68.9       3e-14 
PHYRA_80631                                                           72.8       3e-14 
PYVX_21297                                                            72.0       3e-14 
PYU1_G005866                                                          70.9       4e-14 
PHYRA_78162                                                           73.2       4e-14 
PPTG_18176                                                            72.0       4e-14 
SDRG_08129                                                            71.2       4e-14 
PHYSO_318693                                                          73.2       4e-14 
PHYRA_73581                                                           72.0       4e-14 
PYAP_16338                                                            72.0       4e-14 
PHALS_05394                                                           72.0       5e-14 
PYVX_19277                                                            72.4       5e-14 
PHALS_04411                                                           71.6       5e-14 
PYIR_20483                                                            71.6       6e-14 
PHYKE_6076                                                            71.6       6e-14 
PHYSO_255056                                                          71.2       6e-14 
PHYKE_2379                                                            71.6       7e-14 
PYAR_17166                                                            68.2       7e-14 
SDRG_08782                                                            72.4       7e-14 
PHYRA_78174                                                           71.2       8e-14 
PPTG_03148                                                            71.2       9e-14 
PHALS_01293                                                           71.6       9e-14 
PYAR_15784                                                            69.3       9e-14 
PHYCA_15125                                                           71.2       1e-13 
PPTG_01153                                                            71.2       1e-13 
PYIR_22549                                                            70.5       1e-13 
PYAP_18226                                                            69.7       1e-13 
PHYSO_375794                                                          67.4       2e-13 
HYAP_11923                                                            71.2       2e-13 
PITG_08895                                                            68.6       2e-13 
PHYCA_6388                                                            70.1       3e-13 
PHALS_02041                                                           69.7       3e-13 
PYAR_17163                                                            66.6       3e-13 
PPTG_10073                                                            68.2       3e-13 
PHYCA_552912                                                          70.5       3e-13 
PHYCA_123476                                                          69.7       3e-13 
PPTG_04803                                                            69.3       3e-13 
PYVX_22511                                                            69.7       3e-13 
PHYSO_454780                                                          67.8       4e-13 
PYVX_21174                                                            65.5       4e-13 
PPTG_04801                                                            68.9       4e-13 
PITG_08202                                                            67.8       5e-13 
PPTG_03161                                                            69.7       5e-13 
PYAR_21940                                                            68.6       5e-13 
PHYRA_77290                                                           68.9       7e-13 
PHYKE_3912                                                            68.2       7e-13 
PHYKE_6066                                                            68.6       8e-13 
PYAP_16347                                                            67.0       8e-13 
PPTG_03147                                                            68.6       8e-13 
PHYSO_337515                                                          68.6       9e-13 
PHYKE_6069                                                            68.2       1e-12 
PHYKE_5749                                                            68.2       1e-12 
PYVX_23997                                                            66.6       1e-12 
PHYCA_15124                                                           68.2       1e-12 
PYIR_16375                                                            67.8       1e-12 
PHYSO_525076                                                          68.6       1e-12 
H310_05433                                                            68.6       1e-12 
PPTG_06249                                                            68.2       1e-12 
PYIW_18794                                                            67.4       1e-12 
PYIR_23689                                                            67.0       1e-12 
PHYRA_80750                                                           67.8       1e-12 
PHYRA_78177                                                           68.2       1e-12 
PYAP_16994                                                            67.4       1e-12 
PYAR_25949                                                            66.2       1e-12 
PHALS_08575                                                           67.8       1e-12 
PPTG_01152                                                            67.4       1e-12 
PHYCA_14559                                                           67.4       2e-12 
HYAP_01682                                                            67.8       2e-12 
PYAP_18138                                                            67.4       2e-12 
PHYSO_525490                                                          68.2       2e-12 
PYU1_G001516                                                          67.8       2e-12 
PYAP_23455                                                            67.8       2e-12 
PHYCA_10471                                                           67.4       2e-12 
SPRG_07627                                                            67.8       3e-12 
PYU1_G006405                                                          67.0       3e-12 
PYAR_21271                                                            66.2       3e-12 
PYIW_18065                                                            67.0       3e-12 
PHYRA_78169                                                           67.4       3e-12 
PHYRA_86241                                                           65.5       3e-12 
PHYRA_86751                                                           64.7       3e-12 
PHYCA_18729                                                           67.4       4e-12 
PYIR_25334                                                            66.6       4e-12 
PYVX_22510                                                            67.4       4e-12 
PYIR_22634                                                            66.2       4e-12 
PYVX_16673                                                            67.4       4e-12 
H257_11271                                                            67.0       5e-12 
PHALS_05110                                                           65.1       5e-12 
PPTG_01147                                                            65.9       5e-12 
PYAP_23673                                                            66.6       6e-12 
SDRG_17448                                                            65.9       7e-12 
PHYSO_374025                                                          66.2       7e-12 
PYIW_16208                                                            65.5       7e-12 
PYU1_G007242                                                          65.5       7e-12 
PITG_01969                                                            65.5       8e-12 
PHYCA_19599                                                           66.2       8e-12 
SPRG_04679                                                            64.7       9e-12 
PYAR_15391                                                            63.5       1e-11 
PYIR_17978                                                            64.7       1e-11 
PYU1_G001517                                                          65.5       1e-11 
PPTG_03145                                                            65.1       1e-11 
H310_05438                                                            65.5       1e-11 
PHYRA_78165                                                           65.5       1e-11 
PYU1_G001518                                                          65.1       2e-11 
PPTG_04617                                                            65.5       2e-11 
PYU1_G003057                                                          63.5       2e-11 
PYIR_20304                                                            63.5       2e-11 
PHYRA_93650                                                           63.9       2e-11 
PYU1_G007250                                                          62.8       2e-11 
PHYRA_79881                                                           63.9       2e-11 
PHYRA_78167                                                           64.3       3e-11 
PYVX_21643                                                            63.9       3e-11 
H257_11306                                                            64.7       3e-11 
PYAR_26643                                                            61.6       3e-11 
PYVX_21438                                                            63.9       3e-11 
PYAR_14261                                                            61.6       4e-11 
PYIW_19601                                                            63.2       4e-11 
PITG_11943                                                            62.0       4e-11 
PYVX_22508                                                            63.5       4e-11 
PYU1_G006404                                                          63.5       4e-11 
PHYKE_7446                                                            64.3       4e-11 
PPTG_03143                                                            63.9       6e-11 
PPTG_06106                                                            63.2       6e-11 
PITG_11957                                                            63.5       6e-11 
PYAR_26311                                                            61.2       7e-11 
PYU1_G005869                                                          62.8       8e-11 
PHYRA_87941                                                           60.8       9e-11 
PHYRA_86151                                                           60.8       1e-10 
PYIR_24867                                                            62.8       1e-10 
PITG_11944                                                            62.8       1e-10 
PHALS_10635                                                           62.4       1e-10 
PHYSO_324715                                                          62.4       1e-10 
PHALS_02037                                                           62.8       1e-10 
PHYCA_10470                                                           62.4       1e-10 
PYVX_24274                                                            61.6       1e-10 
PYAP_20077                                                            61.6       2e-10 
PYIR_23622                                                            61.6       2e-10 
PHYKE_7443                                                            62.0       2e-10 
PYAP_18307                                                            61.6       2e-10 
PHYSO_488139                                                          61.6       2e-10 
PYIW_23030                                                            60.8       2e-10 
PYAP_24338                                                            61.2       3e-10 
PYIR_22135                                                            61.6       3e-10 
PPTG_07511                                                            60.1       3e-10 
PYIW_15528                                                            61.2       3e-10 
PYAR_22058                                                            59.7       4e-10 
PYIR_26519                                                            60.5       5e-10 
PYAR_17307                                                            60.1       5e-10 
PYU1_G005878                                                          56.6       5e-10 
PHYCA_19606                                                           60.8       5e-10 
PPTG_20376                                                            59.3       5e-10 
PHYCA_12944                                                           58.9       5e-10 
PYAR_23090                                                            58.2       6e-10 
PYAR_23252                                                            59.7       7e-10 
PYIR_22136                                                            59.7       1e-09 
PHYRA_77292                                                           58.9       1e-09 
PYIW_23029                                                            57.0       1e-09 
PYIW_26655                                                            59.3       1e-09 
PITG_21641                                                            59.7       1e-09 
PYAP_18982                                                            58.2       1e-09 
PYIR_24935                                                            59.3       1e-09 
PITG_04404                                                            58.5       2e-09 
PHALS_01460                                                           58.9       2e-09 
PHALS_02295                                                           58.9       2e-09 
PHYCA_559281                                                          56.6       2e-09 
PYIW_14252                                                            58.2       2e-09 
PYAR_13902                                                            56.6       3e-09 
PPTG_09880                                                            57.4       3e-09 
PYIW_21963                                                            58.5       3e-09 
PHYRA_77291                                                           58.2       3e-09 
PHALS_02296                                                           57.8       3e-09 
PYAR_16632                                                            57.4       4e-09 
PYU1_G001475                                                          58.2       4e-09 
PYAR_15390                                                            57.0       4e-09 
PYIW_25642                                                            56.2       4e-09 
PYU1_G006403                                                          57.8       4e-09 
PYAP_21398                                                            55.8       4e-09 
PHYRA_95184                                                           58.5       4e-09 
PYAP_16337                                                            57.4       6e-09 
PHYSO_256017                                                          55.5       7e-09 
PHYSO_342361                                                          55.5       9e-09 
PYIW_20715                                                            57.0       9e-09 
HYAP_11925                                                            57.0       9e-09 
PPTG_13879                                                            57.0       1e-08 
PYAP_16351                                                            56.2       1e-08 
PYVX_21644                                                            55.5       1e-08 

>PYIR_26626
Length=212

 Score = 373 bits (957),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/212 (100%), Positives = 212/212 (100%), Gaps = 0/212 (0%)

Query  1    MAPsvvkslalaaivssaalCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60
            MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT
Sbjct  1    MAPSVVKSLALAAIVSSAALCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120
            TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT
Sbjct  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180
            HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV
Sbjct  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180

Query  181  YKECVPIGSgrrlegeeaegdeerHLAISNTT  212
            YKECVPIGSGRRLEGEEAEGDEERHLAISNTT
Sbjct  181  YKECVPIGSGRRLEGEEAEGDEERHLAISNTT  212

>PYU1_G001740
Length=206

 Score = 285 bits (730),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 168/188 (89%), Gaps = 2/188 (1%)

Query  1    MAPsvvkslalaaivssaalCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60
            MAPS +KS+ALAAIVS+AALCDS  DAHQ VILP PTFT P K+  W+PLAFLENQGYKT
Sbjct  1    MAPSAIKSVALAAIVSAAALCDSVADAHQLVILPNPTFTVPTKDERWSPLAFLENQGYKT  60

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120
            TADFN Y KSKGYK+LRAFMDDKKAYKV++  A+FECGYTN NG RQPIPA   R+TGYT
Sbjct  61   TADFNAYYKSKGYKSLRAFMDDKKAYKVNS-NADFECGYTNKNGARQPIPA-NFRTTGYT  118

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180
            HDGPCEVWLDNTKV+SG+NC+KDFPGKTH++SYA+CKGSCTLRWYWMG+RFLK K SWQV
Sbjct  119  HDGPCEVWLDNTKVLSGSNCHKDFPGKTHAMSYAACKGSCTLRWYWMGIRFLKGKHSWQV  178

Query  181  YKECVPIG  188
            YKECVP+G
Sbjct  179  YKECVPLG  186

>PYU1_G001744
Length=213

 Score = 280 bits (715),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 145/166 (87%), Gaps = 1/166 (1%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
             S DAHQ V+LPAPTFT   +   +NPLAFLENQG+KTTADFN Y K+KGYK+LRAFMDD
Sbjct  23   ESADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDD  82

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            KKAYKV AAGA+F+CG+T ++GKRQPIPAGTIRSTGYTHDGPCEVWLDNT VM G NC+ 
Sbjct  83   KKAYKV-AAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDNTLVMKGNNCHS  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
            +FPG TH ISYASCKGSCTLRWYWMG+RFLK K+SWQVYK CVPIG
Sbjct  142  EFPGTTHKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PYU1_G001742
Length=213

 Score = 271 bits (693),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 142/166 (86%), Gaps = 1/166 (1%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
             S DAHQ V+LPAPTFT   +   +NPLAFLENQGYKTT DFN Y K+KGYKTLRAFMDD
Sbjct  23   ESADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDD  82

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
             KAYKV AAGA+F+CG+T ++GKRQPIPAGTIRSTGYTHDGPCEVWLD+T+VM G NC+ 
Sbjct  83   PKAYKV-AAGADFQCGWTKLDGKRQPIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHS  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
            +FPG T  I Y+SCKGSCTLRWYWMG+RFLK K+SWQVYK CVPIG
Sbjct  142  EFPGTTFKIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPIG  187

>PYU1_G001741
Length=199

 Score = 268 bits (685),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 1/166 (1%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LPAPTFT   +   +NPLAFLENQG++TTADFN Y K+KGYKTLRAFMDDK
Sbjct  23   TADAHQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDK  82

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
            KAY V A+GA+FECG+T ++G RQ IPAGTIRSTGYTHDGPCEVWLD+T+VM G NC+ +
Sbjct  83   KAYTV-ASGADFECGWTKLDGTRQSIPAGTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTE  141

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            F G TH+I Y+SCKGSCTLRWYWMG+RFLK ++SWQVYK CVPIGS
Sbjct  142  FTGTTHTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPIGS  187

>PYIR_25089
Length=262

 Score = 262 bits (669),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 139/167 (83%), Gaps = 2/167 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            D+SVDAHQ VILPAPTFT   +   +NPLAFLENQG+KTTADF+ Y K+KGYKTLRAFMD
Sbjct  22   DTSVDAHQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMD  81

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIP-AGTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            DK AYKV A GA+FECG+T + G  QPIP A T+RSTGYTHDGPCEVWLD T+V+ GTNC
Sbjct  82   DKSAYKV-ADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNC  140

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            + +FPG T  I Y+SCKGSC LRWYWMG+RFLK ++SWQVYK CVP+
Sbjct  141  HSEFPGTTFKIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPV  187

>PHYSO_284086
Length=204

 Score = 234 bits (596),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LPAPT+T  DK   + PLAFLENQGY+T  DFN + + KGYKTLRAFMD  
Sbjct  24   TADAHQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMD-G  82

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             +Y V A GA++ CG+T+I G  QPIP GT+RSTGYTHDGPCEVWLD T+V+   NC++ 
Sbjct  83   ASYTV-ADGADYYCGFTDIKGVAQPIPDGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHET  141

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            F GKT+ + Y+SCKGSCTLRWYW+G+RFLKN++SWQVYK CVP+ +
Sbjct  142  FSGKTYDLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLST  187

>PHYCA_129425
Length=204

 Score = 230 bits (586),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 130/166 (78%), Gaps = 2/166 (1%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LPAPT+T  +K+  + PLAFLE+QG+KT  DFNG+ +S GYKTLRAFMD  
Sbjct  24   TADAHQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDGA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
            K    D  GA++ CG+TN     QPIP GT+RSTGYTHDGPCEVWLD+T+V+   NC++ 
Sbjct  84   KYTVTD--GADYYCGFTNAKAAPQPIPDGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHET  141

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            FPGKT+++ Y+SCKGSC LRWYW+G RFLKN+ SWQVYK C+P+ S
Sbjct  142  FPGKTYNLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLSS  187

>PYAP_22278
Length=289

 Score = 228 bits (582),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 131/171 (77%), Gaps = 6/171 (4%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
            SSVDAHQ V +PAPTFTN D+NV WNPLAFLENQG K   D  G+++SKG KTLR +MD+
Sbjct  20   SSVDAHQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDN  79

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSG--TN  139
            K  YK++A GA+FECGYTN NG RQPIP  G +RSTGYTHDGPCEVWLDNT+V+     N
Sbjct  80   KANYKIEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGN  139

Query  140  CNKDFPGK--THSISYASCKGSCTLRWYWMGLRFL-KNKWSWQVYKECVPI  187
            C++D   K  ++ I ++ CKG+C LRWYW+G R +   KWSWQ+YK CVP+
Sbjct  140  CHRDVGNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PYU1_G001739
Length=266

 Score = 228 bits (580),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 125/164 (76%), Gaps = 2/164 (1%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
            VDAHQ +I P P F    K+  W PLAFLENQG  T+AD  G++K KGY  LRA MDD+K
Sbjct  21   VDAHQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEK  80

Query  85   AYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y+V+   A FECGYT+   + QPIP  GTIRSTGYTHDGPCEVWLD+ KVMSG NC+  
Sbjct  81   LYEVNT-DALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDK  139

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            FPGKT  + Y+SCKGSCTLRWYW+G+R+LK ++SWQ+YKECV +
Sbjct  140  FPGKTFPLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSL  183

>PPTG_17122
Length=204

 Score = 222 bits (566),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 147/189 (78%), Gaps = 2/189 (1%)

Query  1    MAPsvvkslalaaivssaalCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60
            MAPS++ SL++AA++SSAAL   + +AHQ V+LPAPT+T  +K+  + PLAFLENQGY+T
Sbjct  1    MAPSLLSSLSVAAVLSSAALLAPTSNAHQVVLLPAPTYTTDNKDTKYAPLAFLENQGYET  60

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120
              DFNG+ ++ GYKTLR FMD  K    D  GA++ CG+TN+N   QPIP GT+RSTGYT
Sbjct  61   VEDFNGWRRNNGYKTLRDFMDRAKYTVTD--GADYYCGFTNVNAAPQPIPDGTMRSTGYT  118

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180
            HDGPCEVWLD  +V+   NC++   GKT+++ Y+SC G+CTLRWYW+G+R+LKN +SWQ+
Sbjct  119  HDGPCEVWLDTKRVLQSDNCHETISGKTYNLDYSSCTGTCTLRWYWLGVRYLKNAYSWQI  178

Query  181  YKECVPIGS  189
            YK C+P+ +
Sbjct  179  YKACIPLSA  187

>PHYRA_85631
Length=228

 Score = 221 bits (562),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLEN+G+ T  DF  +    GYK+LR FMD+ 
Sbjct  24   TADAHQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDNA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V A GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  84   K-YNV-ADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN +SWQVYKEC+P+
Sbjct  142  KFPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPL  186

>PPTG_10635
Length=199

 Score = 219 bits (559),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 127/164 (77%), Gaps = 3/164 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ V+LP P +T  DK+  +NPLAFLENQG+KT  DF  +    GYK+LR FMD  K
Sbjct  8    ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDRAK  67

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y+V  +GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++ 
Sbjct  68   -YEV-TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  125

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            FPGK +++ Y+SCKGSCTLRWYW+G+RFLKN +SWQVYK C+P+
Sbjct  126  FPGKDYTVDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPL  169

>PHYSO_341599
Length=185

 Score = 218 bits (556),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 127/167 (76%), Gaps = 3/167 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK   +NPLAFLENQG+KT  DF  + K  GYK+LR FMD  
Sbjct  7    TADAHQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDRA  66

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V  +GA+F CG+T+  G  QPIP G  +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  67   K-YDV-TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHE  124

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN +SWQVYK C+P+ S
Sbjct  125  KFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  171

>PHYRA_82864
Length=193

 Score = 218 bits (554),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 126/166 (76%), Gaps = 2/166 (1%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  +K+  +NPLAFLE QG+ T  DFN + +  GYKTLR FMD  
Sbjct  24   TADAHQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDRA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
            K Y V   GA++ CG+T+ NG  QPIPAG +RSTGYTHDGPCEVWLDNT+V+ G NC++ 
Sbjct  84   K-YTV-TEGADYFCGWTDPNGTPQPIPAGNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQ  141

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            FP K + I Y+SCKG+CTL WYW+G+RFLKN +SWQVYKEC+ + S
Sbjct  142  FPDKDYPIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLTS  187

>PHYKE_8389
Length=204

 Score = 218 bits (555),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 128/167 (77%), Gaps = 3/167 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LPAPT+T  DK+  + PLAFLENQG++T  DFN + ++ GYKTLRAFMD  
Sbjct  23   TADAHQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDGA  82

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K    D  GA++ CG+TN +   Q IP+G  +RSTGYTHDGPCEVWLD T+V++  NC++
Sbjct  83   KYTVTD--GADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHE  140

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
               GK ++I Y+SC G+CTLRWYW+G+RFLKN++SWQVYK CVP+ +
Sbjct  141  AISGKDYTIDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLSA  187

>PHYCA_14369
Length=248

 Score = 219 bits (558),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 126/166 (76%), Gaps = 3/166 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLENQG+KT  DF  +    GYK+LR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDRA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  84   K-YTV-TNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
             FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN +SWQVYK C+P+ 
Sbjct  142  KFPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PPTG_10636
Length=246

 Score = 218 bits (556),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 128/164 (78%), Gaps = 3/164 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ V+LP P +T  DK+  +NPLAFLENQG+KT  DF  +     YK+LR FMD+ K
Sbjct  25   ADAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDNAK  84

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y+V  +GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++ 
Sbjct  85   -YEV-TSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEK  142

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN++SWQVYK C+P+
Sbjct  143  FPGKDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  186

>PPTG_10643
Length=250

 Score = 217 bits (553),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 126/165 (76%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLENQG+K   DF  + K  GYK+LR FMD  
Sbjct  24   TTDAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDRA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y+V   GA+F CG+TN  G  QPIPA G +RSTGYTHDGPCEV+LD+T V+ G NC++
Sbjct  84   K-YEV-TPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             FPGK   I Y+SCKG+CTLRWYW+G+RFLKN +SWQVYKEC+P+
Sbjct  142  KFPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PHYRA_84190
Length=206

 Score = 216 bits (549),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 125/165 (76%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLEN+G+ T  DF  +    GYK+LR FMD+ 
Sbjct  7    TADAHQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDNA  66

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+F CG+T+  G  QPIPA   +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  67   K-YSV-TNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHE  124

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             FPGK +++ Y+SCKG+CTLRWYWMG+RFLK  +SWQVYKEC+P+
Sbjct  125  KFPGKDYTVDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPL  169

>PPTG_10634
Length=208

 Score = 215 bits (547),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 97/165 (59%), Positives = 126/165 (76%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            +VDAHQ V+LP P +T  DK   +NPLAFLEN+G+ T  DF  + K  GYK+LR F+D+ 
Sbjct  24   TVDAHQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDNA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K    D  GA+F+CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  84   KYPVTD--GADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             FPGK +++ Y+SCKG+CTL WYW+G+RFLKN +SWQVYK C+P+
Sbjct  142  KFPGKDYTVDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PITG_18450
Length=203

 Score = 214 bits (545),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 142/189 (75%), Gaps = 5/189 (3%)

Query  1    MAPsvvkslalaaivssaalCDSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT  60
            MAPSV  SL +AA++SS  L   +  AHQ V+LP+PT+T  DK+  + PL FLE QGY+T
Sbjct  1    MAPSVFSSLVVAAVLSSGELLAPTATAHQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYET  60

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120
              DFNG+ ++ GYKTLR FM+    Y V A GA++ CG+TN+N   QP P G +RSTGYT
Sbjct  61   VEDFNGWRRNNGYKTLRDFME----YTV-ADGADYYCGFTNVNAAPQPNPDGAMRSTGYT  115

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180
            HDGPCEVWLD+T+V+   NC++   GKT+++ Y+SCKG+CTLRWYW+G+RFLKN +SWQ+
Sbjct  116  HDGPCEVWLDSTRVLQSDNCHETIIGKTYNLDYSSCKGTCTLRWYWLGVRFLKNAYSWQI  175

Query  181  YKECVPIGS  189
            YK C+P+ +
Sbjct  176  YKACIPLSA  184

>PHYCA_102852
Length=195

 Score = 213 bits (543),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 126/165 (76%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLEN+G+ T  DF  +    GYK+LR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDRA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+F+CG+T+ NG  QPIPAG  +RSTGYTHDGPCEVWLD+T V+ G NC++
Sbjct  84   K-YPV-TEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             FPGK ++I Y+SCKG+CTL W+W+G+RFLKN +SWQVYK C+P+
Sbjct  142  KFPGKGYTIDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPL  186

>PYAP_22279
Length=223

 Score = 213 bits (543),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 124/165 (75%), Gaps = 6/165 (4%)

Query  28   HQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87
            HQ + +PAPT T  D+N   NPLAFLENQG K T D  GY++ KG KTLR FMD+K  YK
Sbjct  22   HQRITIPAPTLTT-DRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  88   VDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGT--NCNKDF  144
            V+AAGA FECGYT+ NG RQPIP+ G +RSTGYTHDGPCEVWLDNT+V+  T  +C+KD 
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  145  PGK--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                 ++ I ++ CKG+C LRWYW+  R + +KWSWQVYK+CVP+
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PHYSO_536424
Length=197

 Score = 211 bits (536),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 124/166 (75%), Gaps = 3/166 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
            +  HQ V+LP P +T  DK   +NPLAFLEN+G+ T  DF  + K  GYK+LR FMD  K
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK  79

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y V  +GA+F CG+T+  G  QPIP G  +RSTGYTHDGPCEVWLD+T V+ G NC++ 
Sbjct  80   -YDV-TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN +SWQVYK C+P+ S
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  183

>PHYSO_507031
Length=197

 Score = 211 bits (536),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 124/166 (75%), Gaps = 3/166 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
            +  HQ V+LP P +T  DK   +NPLAFLEN+G+ T  DF  + K  GYK+LR FMD  K
Sbjct  20   ITTHQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDRAK  79

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y V  +GA+F CG+T+  G  QPIP G  +RSTGYTHDGPCEVWLD+T V+ G NC++ 
Sbjct  80   -YDV-TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEK  137

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            FPGK +++ Y+SCKG+CTLRWYW+G+RFLKN +SWQVYK C+P+ S
Sbjct  138  FPGKDYTVDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLTS  183

>PHYRA_81106
Length=202

 Score = 210 bits (535),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 125/166 (75%), Gaps = 3/166 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ V+LPAPT+T   K+  + PLAFLENQG++T  DFN + +S GYKTLRAFMD  K
Sbjct  25   TDAHQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDGAK  84

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y V A GA++ CG+TN +   Q IP G  +RSTGYTHDGPCEVWLD T+V++  NC++ 
Sbjct  85   -YTV-ADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEA  142

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
              GK ++I Y+SC G+CTL WYWMG+R+LKN +SWQVYK CVP+ +
Sbjct  143  ISGKDYTIDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLSA  188

>PHYCA_102550
Length=268

 Score = 211 bits (537),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 123/162 (76%), Gaps = 3/162 (2%)

Query  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86
            AHQ V+LPAP +   +++   +PLAFLE+QG+KT  DF  +    GYK+LR FMD  K Y
Sbjct  27   AHQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDRAK-Y  85

Query  87   KVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145
             V   GA+F+CGYT+ NG  QPIPAG  +RSTGYTHDGPCEVW+D+T VM G NC++ FP
Sbjct  86   TV-RNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFP  144

Query  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            GK ++I Y+ CKG CTL WYW+G+RFLKN +SWQVYKEC+P+
Sbjct  145  GKGYTIDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPL  186

>PHYCA_102624
Length=195

 Score = 208 bits (530),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 124/164 (76%), Gaps = 3/164 (2%)

Query  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86
            AHQ V+LP P +   +++    PL FLE  G+KT ADF  + K  GYK+LR FMD+ K Y
Sbjct  27   AHQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDNAK-Y  85

Query  87   KVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145
             V + GA+F+CG+T+ NG  QPIPAG  +RSTGYTHDGPCEVW+D+T VM G NC++ FP
Sbjct  86   PV-SEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFP  144

Query  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            GK ++I Y+ CKG CTL WYW+G+RFLKN++SWQVYKEC+P+ S
Sbjct  145  GKDYTIDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLTS  188

>PHALS_00498
Length=199

 Score = 207 bits (528),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 124/166 (75%), Gaps = 3/166 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            +V AHQ V+LP P +   DK+  +NPLAFLENQ +KTT D   Y K   +KTLR FMD+ 
Sbjct  24   NVAAHQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDNA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+  CG+T+ NG  QPIPA   +RSTGYTHDGPCEVWL+NT+V+S +NC++
Sbjct  84   K-YTV-VKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
             FPGK ++I Y+SCK +C LRWYW+G+RFLK K+SWQVYK C+P+ 
Sbjct  142  KFPGKDYTIDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLS  187

>PPTG_15264
Length=194

 Score = 206 bits (525),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 125/167 (75%), Gaps = 5/167 (3%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            S DAHQ V+ P P +T  +K++ +NPLAFLE QG++T  DFN + +  GYKTLR FMD  
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA++ CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+ +V+ G NC++
Sbjct  81   K-YTV-TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHE  138

Query  143  DFPGKTHSISYASC--KGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              PGK ++I Y+SC  KG C LRWYW+G+RFLKN +SWQVYKEC+P+
Sbjct  139  SIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PPTG_17366
Length=194

 Score = 206 bits (525),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 125/167 (75%), Gaps = 5/167 (3%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            S DAHQ V+ P P +T  +K++ +NPLAFLE QG++T  DFN + +  GYKTLR FMD  
Sbjct  21   STDAHQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDRA  80

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA++ CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+ +V+ G NC++
Sbjct  81   K-YTV-TEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHE  138

Query  143  DFPGKTHSISYASC--KGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              PGK ++I Y+SC  KG C LRWYW+G+RFLKN +SWQVYKEC+P+
Sbjct  139  SIPGKDYTIDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPL  185

>PHYKE_3446
Length=199

 Score = 206 bits (523),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 3/165 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            DAHQ V+LP P +    K + +NPLAFLENQG+ T  D N + +  GYKTLRAFMD  K 
Sbjct  26   DAHQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDMAK-  84

Query  86   YKVDAAGANFECGYTNINGKRQPIP-AGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            Y+V   GA++ CG+T+ NG  QPIP  G +RSTGYTHDGPCEVW+DNT+V+   NC++  
Sbjct  85   YQV-TEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETI  143

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GK ++I Y++C+G+C LRWYW+G+RFLKN +SWQVYK C+P+ S
Sbjct  144  TGKDYTIDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLTS  188

>PHYKE_7718
Length=220

 Score = 205 bits (522),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 122/164 (74%), Gaps = 3/164 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ V+LP PT+T  DK+  +NPLAFLE +G+    DF  +    GYK+LR FMD+ K
Sbjct  29   ADAHQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDNAK  88

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
             Y V  +GA+  CG+T+ NG  QPIP G  +RSTGYTHDGPCEVW+D+T  M   NC++ 
Sbjct  89   -YSV-TSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEA  146

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            FPGK ++I Y++CKG+CTLRWYW+G+RFLKN +SWQVYK C+P+
Sbjct  147  FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPL  190

>PYVX_18173
Length=500

 Score = 213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 121/161 (75%), Gaps = 1/161 (1%)

Query  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86
            AHQ VILPAPT+T   K+  W PLAFLE Q + TT DF GY+ + G+ +LRAFMDD   Y
Sbjct  234  AHQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLY  293

Query  87   KVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146
             V+A+ A+F CG+T+ +   QPIP G +RSTGYTHDGPCEVWLD+T+V+   NC++   G
Sbjct  294  SVNAS-ADFRCGFTDPDAAPQPIPDGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISG  352

Query  147  KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            KT+ + Y++C GSCTL WYW+G+R+LK  +SWQVYK CVPI
Sbjct  353  KTYDLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPI  393

 Score = 152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 101/165 (61%), Gaps = 2/165 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            DS +   Q V+ P P F     +   +P+A+LE QG  T  +   ++  +GY TLRA MD
Sbjct  31   DSGLGEGQVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMD  90

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D   Y V   G  F+CG T  N + QPIP  G+  ++GYT DGPCE+W+DNT  ++G NC
Sbjct  91   DDGLYSVTEEGL-FDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNC  149

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            + +FP   H+I Y+ C  SC + W+W+G+++   ++SWQV+K C+
Sbjct  150  HTEFPEGHHTIDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCI  194

>PHYRA_81107
Length=202

 Score = 202 bits (513),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            DAHQ V+LPAPT+T  DK   + PLAFLE+QG+ T  DF  + +  GY +LRAF DD  +
Sbjct  23   DAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGAS  81

Query  86   YKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            Y V + GA+F CG+T+ING  Q IP G  +RSTGYTHDGPCEVWLD+T VM   NC++  
Sbjct  82   YTV-SDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVI  140

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GK ++I Y+SC  +CTL W+WMG+R+L N +SWQVYK CVP+ +
Sbjct  141  SGKDYTIDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLSA  185

>PHYKE_8388
Length=205

 Score = 201 bits (511),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            +AHQ V+LP+PT+T  DK   + PLAFLE+QG+ T  DF  +    GY +LRAF DD  +
Sbjct  26   NAHQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDDA-S  84

Query  86   YKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            Y V + GA+F CG+T+ING  QPIP    +RSTGYTHDGPCEVWLD+T VM   NC+   
Sbjct  85   YTV-SDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSI  143

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GK ++I Y+SC  +CTL W+WMG+R+LKN++SWQVYK CVP+ +
Sbjct  144  SGKDYTIDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLSA  188

>PPTG_17121
Length=202

 Score = 200 bits (509),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 122/165 (74%), Gaps = 3/165 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            +AHQ V+L APT+T  DK+  + PLAFLE+QG+ T  DF  + K  GY +LRAF +D  +
Sbjct  23   NAHQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAF-NDGAS  81

Query  86   YKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            Y V + GA+  CG+TNING  QPIP G  +RSTGYTHDGPCEVWLD+T VM   NC++  
Sbjct  82   YTV-SDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAI  140

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GK ++I Y+SC  +CTL W+W+G+R+LKN++SWQ+YK CVP+ +
Sbjct  141  SGKYYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLST  185

>PHYSO_477820
Length=202

 Score = 199 bits (507),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)

Query  27   AHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAY  86
            AHQ V+LPAPT+T  DK   + PLAFLE+QG+ T  DF  +    GY +LRAF +D  +Y
Sbjct  24   AHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAF-NDGASY  82

Query  87   KVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145
             V A GA+F CG+TN NG+ QPIP    +RSTGYTHDGPCEVWLD+T VM   NC++   
Sbjct  83   TV-ADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESIS  141

Query  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            GK ++I Y+SC  +CTL W+W+G+R+LKN++SWQ+YK CVP+ +
Sbjct  142  GKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLST  185

>PHYCA_511409
Length=204

 Score = 197 bits (502),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 121/166 (73%), Gaps = 3/166 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ V+LPAPT+T  DK   + PLAFLE+QG+ T  DF  + +  GY +LRAF +D  
Sbjct  24   ADAHQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAF-NDGA  82

Query  85   AYKVDAAGANFECGYTNINGKRQPIP-AGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
            +Y V + GA+F CG+TN NG  Q IP A  +RSTGYTHDGPCEVWLD+T VM   NC++ 
Sbjct  83   SYTV-SDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEA  141

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
              GK ++I Y+SC  +CTL W+W+G+R+LKN++SWQ+YK CVP+ +
Sbjct  142  ISGKDYTIDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLSA  187

>PYVX_18174
Length=204

 Score = 197 bits (501),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 123/166 (74%), Gaps = 4/166 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ VILP PT+T  D++V++ PLAFLE+QG++T  DFN + +S GYKTLRAFM D+ 
Sbjct  25   ADAHQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFM-DQA  83

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            +Y V   GA+  CG+T I+G  QPIPA   RSTGYTHDGPCE+WLD+T+V +  NC++  
Sbjct  84   SYTV-TDGADQTCGFTEIDGTPQPIPAN-FRSTGYTHDGPCEIWLDSTRVYANDNCHEAI  141

Query  145  PGKTHSISYA-SCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GK  +I Y+    G+CTL WYWMG+R+L N +SWQVYK CVP+ +
Sbjct  142  SGKDTAIDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLST  187

>PHALS_03284
Length=188

 Score = 195 bits (496),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 121/165 (73%), Gaps = 3/165 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            +V AHQ ++LP P +   DK+  +NPLAFLENQ + T+ADF GY+K   Y +LR F+  K
Sbjct  10   NVIAHQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL--K  67

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            +A      GA+ +CG+T+ NG  QPIPAG  +R TGYTHDG CE+WLD+TKV+SG+NC+ 
Sbjct  68   RANYTVTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHN  127

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            DFPGK   + Y+SCK +C + WYW+ +R LKN++SWQVYK C+P+
Sbjct  128  DFPGKDCPVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPL  172

>PYVX_18176
Length=201

 Score = 194 bits (494),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 114/165 (69%), Gaps = 2/165 (1%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
             DAHQ VILPAPT+   DK+V + PLAFLE+QG+ T  DF  +    GY +LRAFMD   
Sbjct  22   ADAHQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDGAS  81

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
                D  GA+  CG+TN +G  Q +P G +RSTGYTH GPCEVWLD+T V+   NC+   
Sbjct  82   YTVTD--GADQTCGWTNKDGTAQALPDGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSI  139

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             GKT+ + Y+SC  +CTL W+WMG+R+L N++SWQVYK CVP+ +
Sbjct  140  SGKTYDLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLSA  184

>PYIW_18791
Length=194

 Score = 192 bits (488),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 115/163 (71%), Gaps = 2/163 (1%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            DAHQ+V +P P +T   K  YW PL+FLE  G KT+   +G++K KGY TLRA MDD K 
Sbjct  20   DAHQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKL  79

Query  86   YKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            YK ++   NF CGYT+ +   Q IP   T+R+TGYTH GPCEVW+D+ +V++G NC++  
Sbjct  80   YKTNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQV  139

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               T  + Y++CKG CT+RWYW+GLR+LK KWSWQVYK C+ +
Sbjct  140  SNTTK-VDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIAL  181

>PPTG_10048
Length=190

 Score = 190 bits (483),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 116/163 (71%), Gaps = 3/163 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            +AHQ V+ PAP +   +++   NPLAFLE+QG+KT  DF  +    GYKTLR FM+  K 
Sbjct  23   EAHQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEHAK-  81

Query  86   YKVDAAGANFECGYTNINGKRQPIPAGTI-RSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            Y V   GA+F CG+TN  G  QPIPAG I RSTGYTH+GPCE+W+ +T+V    NC+   
Sbjct  82   YTV-TEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSL  140

Query  145  PGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            PGK + I Y+ CKG+C L WYW+G+RFLKN +SWQVYKEC+P+
Sbjct  141  PGKEYPIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPL  183

>PYAP_22273
Length=268

 Score = 190 bits (482),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 112/167 (67%), Gaps = 4/167 (2%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
            V+AHQ V  P   +T  D+   W P A LENQGYKTT DFN Y+ + GYKTLR FMD   
Sbjct  23   VEAHQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPG  82

Query  85   AYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKD  143
            AYK +  GA  ECGYT+ N   QPIP  G  R++GYTH+GPCE+W+D+  V SG NC+ D
Sbjct  83   AYKAN-KGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYD  141

Query  144  FPGK--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
               K  T  I Y++CKG C L+WYW+G+R +  K+SWQ+YK C+P+ 
Sbjct  142  ISEKAFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PPTG_08820
Length=250

 Score = 184 bits (466),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 115/169 (68%), Gaps = 5/169 (3%)

Query  24   SVDAHQSVILPAPTFTNP--DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            +VDAHQ ++ P P +     D++  W PLAFLE+QG+   ADFNG+    GYK LR FMD
Sbjct  24   TVDAHQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMD  83

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
              K       GA+  CG T + G  +PIP  G ++STGYTHDGPC V+LD+  V+   NC
Sbjct  84   RAKYTTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNC  143

Query  141  NKDFPGKTHSISYASC--KGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            ++  PGK++ I Y+SC  KG CTL W+W+G+RF+K++WSWQVYKECVP+
Sbjct  144  HEKLPGKSYKIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPL  192

>PYIR_26546
Length=239

 Score = 182 bits (462),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 115/170 (68%), Gaps = 5/170 (3%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQ-GYKTTADFNGYIKSKGYKTLRAFM  80
            DS+  AHQ V+LP PT+T   K   W P+A+LE Q G+    DFNGY+ SKG+KT+R FM
Sbjct  22   DSTARAHQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFM  81

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTN  139
            D+ K Y+   + A+F+CGYT ++G+ QPIP    IR+TGYTH+GPCE+WLD+ KV  G N
Sbjct  82   DNDKLYR-PVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKN  140

Query  140  CNKDFPGKT--HSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            C+ D         + ++SC G CT+ WYWMG+R      SWQ+YKEC+P+
Sbjct  141  CHYDVASGMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PYAR_24096
Length=227

 Score = 182 bits (461),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 112/165 (68%), Gaps = 4/165 (2%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            +AHQ V LP   +T  ++N  W P A LE QGYKTTADFN Y+K+  YKTLR FMD   A
Sbjct  25   EAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGA  84

Query  86   YKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            YK + +GA FECG+T+     QPIP  G  R++GYTH+GPCE+W+D+ +V  G NC+ D 
Sbjct  85   YKPN-SGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDI  143

Query  145  PGK--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                 T  I Y++CKG+C L+WYW+G+R     +SWQ+YK C+P+
Sbjct  144  SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188

>PHYCA_510817
Length=188

 Score = 171 bits (434),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 116/170 (68%), Gaps = 8/170 (5%)

Query  24   SVDAHQSVILPAPTFTNP-----DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            S +AHQ V +P+PT+T P     ++   WNPL+FLE +G+KT  +F  Y    GYK+LR 
Sbjct  19   STEAHQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  78

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSG  137
            FM+ K  YKV + GA+  CG+++  G  Q IP+ GT+R++GYTHDGPCE+W+ +   +S 
Sbjct  79   FME-KAKYKV-SDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSY  136

Query  138  TNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC++  P +T  + Y+ C  SC L WYW+G+R LK K+SWQVYKEC+P+
Sbjct  137  LNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PHYSO_499978
Length=174

 Score = 168 bits (425),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 104/153 (68%), Gaps = 3/153 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+ P P +T  DK   +NPLAFLENQG+ T  DF  +    GYKTLR FMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+F CG+T+  G  QPIP G  +RSTGYTHDGPCEVW+DNT+V+ G NC++
Sbjct  84   K-YTV-TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNK  175
                K ++I Y++CKG+CTLRWYW     L ++
Sbjct  142  KIADKGYTIDYSACKGTCTLRWYWRRCTRLASR  174

>PHYSO_501575
Length=174

 Score = 168 bits (425),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 104/153 (68%), Gaps = 3/153 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+ P P +T  DK   +NPLAFLENQG+ T  DF  +    GYKTLR FMD  
Sbjct  24   TADAHQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDHG  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V   GA+F CG+T+  G  QPIP G  +RSTGYTHDGPCEVW+DNT+V+ G NC++
Sbjct  84   K-YTV-TKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHE  141

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNK  175
                K ++I Y++CKG+CTLRWYW     L ++
Sbjct  142  KIADKGYTIDYSACKGTCTLRWYWRRCTRLASR  174

>PPTG_14255
Length=268

 Score = 171 bits (432),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 114/169 (67%), Gaps = 8/169 (5%)

Query  27   AHQSVILPAPTFT-----NPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            AHQ V +P+PT+T     + ++ V WNPL+FLE +GY T  +F  Y    GYK+LR FMD
Sbjct  21   AHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMD  80

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            + K    D  GA+  CG+T+  G  Q IP  GT+R++GYTHDGPCE+++ +T  +S  NC
Sbjct  81   NAKYSVTD--GADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNC  138

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            ++    +T  + Y++C  SC L WYW+G+R+LK K+SWQVYKEC+P+ S
Sbjct  139  HESITDQTFKLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPLYS  187

>PPTG_14254
Length=188

 Score = 167 bits (422),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 113/170 (66%), Gaps = 8/170 (5%)

Query  24   SVDAHQSVILPAPTFT-----NPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            + +AHQ V +PAPT+T     + ++   WNPL+FLE +G+KT  +F  +    GYK+LR 
Sbjct  19   ATEAHQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRD  78

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSG  137
            FMD  K YKV   GA+  CG+T+  G  Q IP  GT+R+TGYTHDGPCE+++     +S 
Sbjct  79   FMDRAK-YKV-TEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSY  136

Query  138  TNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC++  P +T  + Y+ C  SC L WYW+G+R LK K+SWQVYKEC+PI
Sbjct  137  LNCHESIPEQTFKLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PITG_10499
Length=323

 Score = 168 bits (426),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 3/149 (2%)

Query  42   DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTN  101
            D++  W PLAFLE+QG+    DFNG+    GYK LR FMD  K       GA+  CG T 
Sbjct  14   DRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGLTE  73

Query  102  INGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASC--KG  158
            + G  +PIP  G +RSTGYTHDGPC ++LD+  VM   NC++  PG+T+ I ++SC  KG
Sbjct  74   LKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTYKIDFSSCQKKG  133

Query  159  SCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             CTL W+W+G+RF+K++WSWQVYKEC+ +
Sbjct  134  GCTLYWFWLGIRFVKSRWSWQVYKECISL  162

>PHYSO_417649
Length=185

 Score = 163 bits (412),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 111/170 (65%), Gaps = 8/170 (5%)

Query  24   SVDAHQSVILPAPTFTNP-----DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            SV+AHQ V +P+PT+T       ++   WNPL+FLE +G+KT  +F  Y    GYK+LR 
Sbjct  17   SVEAHQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRD  76

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSG  137
            FM+  K    D  GA+  CG+T+  G  Q IP  GT+R++GYTHDGPCE+++ +   +S 
Sbjct  77   FMERAKYKLTD--GADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSY  134

Query  138  TNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC++    +T  + Y+ C  SC L WYW+G+R LK K+SWQVYKEC+P+
Sbjct  135  LNCHESITDQTFKLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PITG_13520
Length=171

 Score = 162 bits (409),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 98/135 (73%), Gaps = 3/135 (2%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK+  +NPLAFLENQG+KT  DF  +    GYK+LR FMD  
Sbjct  24   TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDRA  83

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V  +GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+  V+ G NC++
Sbjct  84   K-YDV-TSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHE  141

Query  143  DFPGKTHSISYASCK  157
             FPGK +++ Y+SCK
Sbjct  142  KFPGKDYTVDYSSCK  156

>PYU1_G001738
Length=226

 Score = 161 bits (408),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 103/165 (62%), Gaps = 2/165 (1%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            +V A   V+ P P +          P+A LE QG KT+AD + ++K KGY  LRA +DD+
Sbjct  18   AVHAQHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQ  77

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
            K Y V+    + ECGYT+   + QPIP      STGY  +GPCEVWLD+ KVMS  NC+ 
Sbjct  78   KLYNVNPDALD-ECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHT  136

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             +PG    + Y+SCKGSC LRWYW+G++ +   +SWQVYK CV +
Sbjct  137  KYPGTNFMLDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYKE_9185
Length=281

 Score = 162 bits (410),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 112/171 (65%), Gaps = 8/171 (5%)

Query  23   SSVDAHQSVILPAPTFTNP-----DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLR  77
            S+ +AHQ V +P+PT+T P     ++   WNPL+FLE +G KT  +F  Y     Y +LR
Sbjct  20   STTEAHQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLR  79

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMS  136
             FMD K  YKV + GA+  CG+T+  G  Q IP  GT+R++GYTHDGPCE+++ +   +S
Sbjct  80   DFMD-KAKYKV-SDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALS  137

Query  137  GTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              NC++    +T  + Y++C  SC L WYW+G+R LK  +SWQ+YKEC+P+
Sbjct  138  YLNCHESITDQTFKLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PHYCA_536934
Length=983

 Score = 171 bits (432),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 112/168 (67%), Gaps = 8/168 (5%)

Query  26   DAHQSVILPAPTFT-----NPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
            +AHQ V +P+PT+T     + ++ V WNPL+FLE +GY T  +F  Y    GYK LR FM
Sbjct  37   EAHQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFM  96

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTN  139
            D+ K    D  GA+  CG+++ NG  Q IP  GT+R++GYTHDGPCE+W+ +   +S  N
Sbjct  97   DNAKYAVTD--GADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLN  154

Query  140  CNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            C++    +T  + Y+ C  SC L WYW+G+R+LK K+SWQVYKEC+P+
Sbjct  155  CHESITDQTFKLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PHYSO_254168
Length=170

 Score = 156 bits (395),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 100/148 (68%), Gaps = 18/148 (12%)

Query  42   DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTN  101
            DK+  +NPLAFLE QG+ T   F+   +  GYKTLR FMD  K Y V   GA++ CG+TN
Sbjct  30   DKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDRGK-YTV-TQGADYFCGWTN  87

Query  102  INGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASC--KGS  159
              G  QPIP    RSTGYTHDGPCE+WLD+ +V+           ++ +I Y+SC  KG 
Sbjct  88   PKGTPQPIP----RSTGYTHDGPCEIWLDDVRVLE----------RSPTIDYSSCEKKGG  133

Query  160  CTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            CT+ WYW+G+RFLKN +SWQVYKEC+P+
Sbjct  134  CTMHWYWLGVRFLKNSYSWQVYKECIPL  161

>HYAP_07096
Length=251

 Score = 159 bits (401),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 107/168 (64%), Gaps = 3/168 (2%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
            S +   Q V+ P+P F   D  +    LA+L+ QG  T+ +   + +  GY +LRA +DD
Sbjct  80   SDLSEGQVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDD  139

Query  83   KKAYKVDAAGANFECGYTNINGKR-QPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            +  Y V +  A F+CG+T++  +  Q IP  GT+ S+GYT DGPCEVW D+T+V SG NC
Sbjct  140  QSLYHV-SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNC  198

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
              +FP   H + Y+SC  SCTLRWYW+G++++   +SWQVYK C+ +G
Sbjct  199  RTEFPHGQHQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGLG  246

>PPTG_17123
Length=201

 Score = 157 bits (396),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 107/169 (63%), Gaps = 2/169 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            D+ +   Q V+ P P F     +     LA+L+ QG  T+ +   +++  GY +LRA +D
Sbjct  30   DAGLGEGQVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLD  89

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D+  YKV    A FECG T+   + QPIP   + +++GYT DGPCEVWLD+TKV SG NC
Sbjct  90   DESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNC  148

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            + +FP   H + Y+SC  +CTL WYW+G+++++  +SWQVYK CV + +
Sbjct  149  HTEFPHGQHEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLST  197

>PHYCA_537323
Length=200

 Score = 155 bits (393),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 107/169 (63%), Gaps = 2/169 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            D+ +   Q V  P P F     +     LA+L+ QG  T+ +   +++  GY +LRA +D
Sbjct  29   DAGLGEGQVVQHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQSWMEQHGYTSLRAMLD  88

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D+  Y+V    A FECG T+   + QPIP   + +++GYT DGPCEVWLD+TKV +G NC
Sbjct  89   DESLYQVTEE-AIFECGLTSPKTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSAGRNC  147

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            + +FP   H + Y+SC  SCTL WYW+G+++++  +SWQVYK CV +G+
Sbjct  148  HTEFPQGQHQVDYSSCGESCTLSWYWLGIKYVEGIYSWQVYKNCVGLGT  196

>PHYSO_343376
Length=172

 Score = 154 bits (388),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 3/133 (2%)

Query  35   APTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGAN  94
            A  +T  DK   +NPLAFLENQG+ T  DF  +    GYKTLR FMD  K Y V   GA+
Sbjct  33   AAQWTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDHGK-YTV-TKGAD  90

Query  95   FECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY  153
            F CG+T+  G  QPIP G  +RSTGYTHDGPCEVW+DNT+V+ G NC++    K ++I Y
Sbjct  91   FSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYTIDY  150

Query  154  ASCKGSCTLRWYW  166
            ++CKG+CTLRWYW
Sbjct  151  SACKGTCTLRWYW  163

>PHYSO_262732
Length=188

 Score = 154 bits (389),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 109/171 (64%), Gaps = 22/171 (13%)

Query  25   VDAHQSVILPAPTFTNP-----DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAF  79
             +AHQ V +P+PT+T       ++   WNPLAFLENQG++T               LR F
Sbjct  19   AEAHQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTH--------------LRDF  64

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGT  138
            MD+ K Y V   GA+  CG+T+  G  Q IP+ GT+R++GYTHDGPCE+++ +   +S  
Sbjct  65   MDNAK-YTV-TEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYL  122

Query  139  NCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            NC++    +T  + Y+ C  SCTL WYW+G+RFL NK+SWQVYKEC+PI S
Sbjct  123  NCHESITDQTFKLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPIYS  173

>PHYRA_81105
Length=201

 Score = 154 bits (388),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 106/168 (63%), Gaps = 2/168 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            D+ +   Q V+ P P F     +     LA+L+ QG  T+ +  G+++  GY +LR+ +D
Sbjct  30   DAGLGEGQIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLD  89

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D+  Y+V    A F+CG T+   + Q IP   + +S+GYT DGPCEVWLD+TK  +G NC
Sbjct  90   DESLYQVTEE-AIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNC  148

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIG  188
            + +FP   H I Y++C  +C LRWYW+G+++++  +SWQVYK C+ +G
Sbjct  149  HTEFPHGQHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIALG  196

>PYIW_18788
Length=244

 Score = 152 bits (385),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 103/167 (62%), Gaps = 3/167 (2%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
            S V A+  V  P P F           +A LE+Q   T+AD  G++K KGY +LRA +DD
Sbjct  22   SVVVANMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDD  81

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCN  141
            +  Y V+   + FECGYT+   + QPIP  G +R TGY  DGPCE+W+D+ K++S  NC 
Sbjct  82   ETLYDVNI-DSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCK  140

Query  142  KDFPGKTHSISYASCKGSCTLRWYWMGL-RFLKNKWSWQVYKECVPI  187
            KDFPG +  + Y+SCKG CTLRWY + + +     +SW+VYK CV +
Sbjct  141  KDFPGTSTKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVAL  187

>PHYSO_353401
Length=146

 Score = 147 bits (372),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 96/139 (69%), Gaps = 2/139 (1%)

Query  50   LAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPI  109
            LA+L+ QG  T+ +   +++  GY +LRA +DD+  YKV    A F+CG T+   + QPI
Sbjct  3    LAYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEE-ALFDCGLTSPKTETQPI  61

Query  110  PA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMG  168
            P+  + +++GYT DGPCEVWLD+TKV +G NC+  FP   H I Y++C  SCTL WYW+G
Sbjct  62   PSNSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQHEIDYSACGDSCTLWWYWLG  121

Query  169  LRFLKNKWSWQVYKECVPI  187
            +++++  +SWQVYK CV +
Sbjct  122  IKYVEGAYSWQVYKNCVAL  140

>PITG_18452
Length=856

 Score = 159 bits (401),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 107/167 (64%), Gaps = 2/167 (1%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            D+ +   Q V+ P P F     +     LA+L+ QG  T+ +   +++ +GY +LRA +D
Sbjct  685  DAGLGEGQIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLD  744

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D+  YKV    A FECG T+   + QPIP   + +++GYT DGPCE+WLD+TKV SG NC
Sbjct  745  DESLYKVTEE-AIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNC  803

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            + +FP   H + Y+SC GSC L WYW+G+++++  +SWQVYK CV +
Sbjct  804  HTEFPHGQHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGL  850

>PYIW_18792
Length=125

 Score = 139 bits (349),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 79/104 (76%), Gaps = 3/104 (3%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKK  84
            VDAHQ V LPAPT+T   +   +NPLAFLE QGYK TADF  Y KSKGYK LR FMDDKK
Sbjct  21   VDAHQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKK  80

Query  85   AYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEV  127
            AYKVD  G NFECG++++ G  QPIPA G +RSTGYTHDGP  +
Sbjct  81   AYKVD--GGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PHYSO_341596
Length=231

 Score = 142 bits (357),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 90/129 (70%), Gaps = 11/129 (9%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+L        DK+  +NPLAFLENQG++T  DF  +    GYK+LR FMD K
Sbjct  24   TADAHQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMD-K  74

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAG-TIRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
              Y V  +GA+F CG+T+  G  QPIPAG  +RSTGYTHDGPCEVWLD+TKV+ G NC++
Sbjct  75   AKYTV-TSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCHE  133

Query  143  DFPGKTHSI  151
             FPGK ++ 
Sbjct  134  KFPGKDYTT  142

>PHYSO_527908
Length=174

 Score = 136 bits (342),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 98/156 (63%), Gaps = 8/156 (5%)

Query  24   SVDAHQSVILPAPTFTNPDK-----NVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            SVDAHQ V +P PT+T  +         W PLAFLE QG+ T A+F  ++   GYK+LR 
Sbjct  18   SVDAHQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRD  77

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSG  137
            FMD+   Y V   GA+  CG+T+ NG  Q IP  GT+R++G+THD PCE+++ +   +S 
Sbjct  78   FMDNGN-YSV-TKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSY  135

Query  138  TNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLK  173
             NC++    +   + Y++C  SC L WYW+G+RF+K
Sbjct  136  PNCHESITSQPFKLDYSACGDSCVLYWYWLGVRFIK  171

>PYAP_18131
Length=226

 Score = 135 bits (339),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 9/114 (8%)

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGT  138
            MDDK  YKV+AAGA FECG T+ NG RQPIP  G +RSTG+THDG   VW+DNT+V+   
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  139  --NCNKDFPGK---THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              NC+K   G+   ++ I ++ CKG C +RWYW+G+R L  KWSWQVYK C+PI
Sbjct  59   LGNCHKSI-GQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>PHYCA_14368
Length=219

 Score = 134 bits (338),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 92/166 (55%), Gaps = 46/166 (28%)

Query  22   DSSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            DS+ +AHQ V+LP P +T  DK+  +NPLAFLENQG+KT  DF  +     YK+LR FMD
Sbjct  22   DSTAEAHQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMD  81

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCN  141
            + K    D  GA+F CG+T+                                        
Sbjct  82   NAKYTVTD--GADFSCGFTDP---------------------------------------  100

Query  142  KDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                 K +++ Y+SCKG+CTLRWYW+G+RFLKN++SWQVYK C+P+
Sbjct  101  -----KDYTVDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPL  141

>PHYSO_340369
Length=200

 Score = 121 bits (304),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 93/166 (56%), Gaps = 20/166 (12%)

Query  27   AHQSVILPAPTFT-----NPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            A+Q V +PAPT+T       ++   W PLA+ E+QG+ T+++F  +  + G+KTLR FMD
Sbjct  24   ANQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMD  83

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCN  141
            +               G  ++   +Q      +R+ GYT DGPCE+WLDNT   S  +C 
Sbjct  84   N---------------GNYSVTSPQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCL  128

Query  142  KDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               P  T+++ Y+ C  SC + WY +G+      +SW+VYKEC+P+
Sbjct  129  VSLPNMTYTLDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PHYSO_246676
Length=187

 Score = 119 bits (298),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 88/165 (53%), Gaps = 41/165 (25%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
            + DAHQ V+LP P +T  DK   +NPLAFLENQG+KT  DF  + K  GY+TLR FM DK
Sbjct  7    TADAHQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFM-DK  65

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGT-IRSTGYTHDGPCEVWLDNTKVMSGTNCNK  142
              Y V  +GA+F CG+T+  G  QPIP G  +RSTGYTHDG     L    V+ G     
Sbjct  66   AKYDV-TSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGLVHASL----VLDG-----  115

Query  143  DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                                         +KN +SW+VYK C+P+
Sbjct  116  -----------------------------MKNSYSWKVYKACIPL  131

>PYVX_18179
Length=147

 Score = 109 bits (273),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 81/164 (49%), Gaps = 60/164 (37%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            DAHQ VILP PT+T+ D +V+++PLAFLE+QG+ T  DFN +  + GY TLRAFMD    
Sbjct  26   DAHQYVILPKPTWTSEDHDVWYSPLAFLEDQGFATQEDFNSWRSANGYDTLRAFMD----  81

Query  86   YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145
                                                           + +SG +   D+ 
Sbjct  82   -----------------------------------------------QAVSGKDTAVDY-  93

Query  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
                    +SC GSCTL W+WMG+R+LK  +SWQVYK CVP+ +
Sbjct  94   --------SSCSGSCTLYWFWMGVRYLKGAYSWQVYKNCVPLST  129

>PYAP_18711
Length=210

 Score = 111 bits (277),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 91/175 (52%), Gaps = 25/175 (14%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQG------YKTTADFNGYIKSKGYKTLR  77
             +DAH  V  P   F    K     P  ++   G      ++T A ++   K +G K LR
Sbjct  19   EIDAHTYVKSPLAEFKAGTKY----PSEWVAEFGPPWSGTFRTGAQYDAERKKRGIKNLR  74

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-STGYTHDGPCEVWLDNTKVM  135
            AF++ K            ECG TN N KR+PIP+ G I+  +   H GPCEVW DNT V 
Sbjct  75   AFLESKGP----------ECGRTNPNAKRKPIPSDGLIKFGSSMEHPGPCEVWFDNTLVF  124

Query  136  SGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            S  +C K F   T   I Y+ CKG+C LR+YW+GL+    +  WQ YK CVPIGS
Sbjct  125  SEVDCEKRFGSATQFKIDYSKCKGNCMLRFYWLGLQDGGKR--WQSYKNCVPIGS  177

>PYIW_18790
Length=86

 Score = 102 bits (254),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 2/80 (3%)

Query  31   VILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDA  90
            V+LP PT+T   +   +NPLAFLENQG+KTTADF  Y + KGYKTLR FMDD+ AYKVD 
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVD-  63

Query  91   AGANFECGYTNINGKRQPIP  110
             G +FECG++ + G  QPIP
Sbjct  64   -GGDFECGWSTLKGTPQPIP  82

>PYAP_24689
Length=252

 Score = 106 bits (265),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 76/134 (57%), Gaps = 15/134 (11%)

Query  59   KTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-S  116
            +T A ++   K  G KTLRAF++ K             CG TN N KR+PIP  G I+  
Sbjct  59   RTGAQYDAVRKKHGVKTLRAFLESKGPV----------CGSTNPNAKRKPIPRDGLIKFG  108

Query  117  TGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKNK  175
            +   H GPCE+W DNT+V    +CNK F   T   I Y+ C+G C LR+YW+GL+    +
Sbjct  109  SSMEHPGPCEIWFDNTRVFVDADCNKRFGSATQFKIDYSKCRGKCLLRFYWLGLQDGGKR  168

Query  176  WSWQVYKECVPIGS  189
              WQ YK CVP+G+
Sbjct  169  --WQSYKNCVPLGN  180

>PHYSO_342364
Length=194

 Score = 102 bits (254),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 86/179 (48%), Gaps = 25/179 (14%)

Query  26   DAHQSVILPAPTFTNPDKNVYWN---PLAFLENQGY----KTTADFNGYIKSKGYKTLRA  78
            DAH  + +P   F    +N  W+   P  +  N  Y    K+   FN    S  YK LR 
Sbjct  22   DAHGYIYVPQSQFFG-GENSQWSVQIPPVWPSNDWYGNTQKSVQVFNSLKTSHNYKDLRT  80

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVMS  136
             +D+   Y     G N  CGYTN NG  QPIP     I S G  H GPCE+WLD+ KVM+
Sbjct  81   LLDNTAVY-----GPN--CGYTNPNGTPQPIPTNGKAIFSRGLIHTGPCEIWLDDKKVMA  133

Query  137  GTNCNKDFPGKTHSI--------SYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              +C   +     ++        SY   KG C +R+YW+G + L  K  WQ YK C+P+
Sbjct  134  ADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGFQALGKKTVWQTYKNCIPL  192

>PYU1_G007476
Length=195

 Score = 100 bits (249),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 72/132 (55%), Gaps = 19/132 (14%)

Query  63   DFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTI----RST  117
            DF    K KGYKTLR+F+++K A           CGYT  N   + IP  G +     + 
Sbjct  65   DFARISKQKGYKTLRSFLENKGA----------SCGYTEPNTTPRAIPRDGKVIFAHSNV  114

Query  118  GYTHDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWYWMGLRFLKNK  175
            G+ H GPCE+WLDN  ++   NC K FPG      + ++SCKG+C LR YW+G  F    
Sbjct  115  GFVHPGPCELWLDNKMILHKDNCQKAFPGVKAVMPVDFSSCKGTCMLRMYWLG--FQDQG  172

Query  176  WSWQVYKECVPI  187
              WQ YK CVP+
Sbjct  173  QRWQTYKYCVPV  184

>PYIR_16444
Length=182

 Score = 99.0 bits (245),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 90/172 (52%), Gaps = 22/172 (13%)

Query  24   SVDAHQSVILPAPTF----TNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAF  79
             VDAH  V +P   F    +NP + +   P  +  N  +K   +F    K KG+ TLR++
Sbjct  22   QVDAHGFVQVPKSEFVKGTSNPSEWIVEFPPPWSGN--WKDPKNFAKVAKQKGFPTLRSY  79

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-STGYTHDGPCEVWLDNTKVMSG  137
            +++K A           CG TN     +PIP+ G +  S    H GPCE+WLDN +V   
Sbjct  80   IENKGAI----------CGKTNAKATPKPIPSDGKVHFSRAIVHPGPCELWLDNKRVYQN  129

Query  138  TNCNKDFPGKTH--SISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC   F  K     I ++SCKG+C LR++W+GL+    +  WQVYK CVP+
Sbjct  130  DNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGKR--WQVYKNCVPV  179

>PYIR_16435
Length=304

 Score = 101 bits (251),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 75/130 (58%), Gaps = 16/130 (12%)

Query  62   ADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-STGY  119
            A+F    K KGY TLR++++DK             CG TN +   + IP+  T++ S   
Sbjct  65   ANFATVSKEKGYSTLRSYIEDKGTL----------CGRTNPDATPKAIPSDNTVKFSRAI  114

Query  120  THDGPCEVWLDNTKVMSGTNCNKDFPGK--THSISYASCKGSCTLRWYWMGLRFLKNKWS  177
             H GPCE+WLD+ +VM   NC   F  K  T  I ++SCKGSC LRW+W+GL+    +  
Sbjct  115  VHPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGER--  172

Query  178  WQVYKECVPI  187
            WQVYK CVP+
Sbjct  173  WQVYKNCVPL  182

>PYIR_22134
Length=300

 Score = 100 bits (248),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 89/186 (48%), Gaps = 28/186 (15%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWN-----PLAFLENQGYKTTAD-------FNGYIKS  70
            SSVDAH  + +P PTFT       ++     P       G   T D       F   +K+
Sbjct  24   SSVDAHGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKA  83

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDG  123
              Y ++RA ++ K  +    +GA  ECG T+  G  QP+PA  +      S G+T  H G
Sbjct  84   STYDSVRALVEAKGVF---ISGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQG  140

Query  124  PCEVWLDNTKVMSGTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVY  181
            PCEVW DN KV S  NC K++P       I +A C G+  L+  W+ L    +  +WQ+Y
Sbjct  141  PCEVWCDNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLAL----HSSTWQIY  196

Query  182  KECVPI  187
              C P+
Sbjct  197  INCAPL  202

>PYIW_27477
Length=180

 Score = 96.3 bits (238),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 16/128 (13%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR--  115
            +K  A+F    K KG++TLR++++DK A          +CG T+ N K + IP+  +   
Sbjct  35   WKDPANFAKVSKEKGFETLRSYIEDKGA----------KCGKTDPNAKAKAIPSDNVVKF  84

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGK--THSISYASCKGSCTLRWYWMGLRFLK  173
            S    H GPCE+W+D+T+VM   NC K F  K  T  I +++CKG C LRW+W+GL+   
Sbjct  85   SRAIVHPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSG  144

Query  174  NKWSWQVY  181
             +  WQVY
Sbjct  145  KR--WQVY  150

>PYAP_18709
Length=235

 Score = 95.5 bits (236),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 15/133 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            +KT A +      KG+K LR+F++DK             CG +  N   +PIP+ GTI+ 
Sbjct  54   FKTGAQYAAVAPGKGFKDLRSFLEDKGP----------TCGNSLPNASPKPIPSDGTIKL  103

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCEVWLDNT+     +C K F   T   + + +CKGSC LR+YW+GL+    
Sbjct  104  ASTIEHAGPCEVWLDNTRAFHNDDCEKAFGSATSFKMDFLACKGSCMLRFYWLGLQDGGK  163

Query  175  KWSWQVYKECVPI  187
            +  WQ YK C+P+
Sbjct  164  R--WQSYKNCIPL  174

>PYIR_16443
Length=275

 Score = 96.3 bits (238),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 92/181 (51%), Gaps = 30/181 (17%)

Query  25   VDAHQSVILPAPTFTN----PDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
            V+AH  + +P   F      P + +   P  +  N  +K   +F    K KG++TLR+++
Sbjct  23   VNAHGFIEVPKSEFVKGTKYPSEWIVEFPPPWEGN--WKDPKNFATVSKQKGFETLRSYI  80

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR--STGYTHDGPCEVWLDNTKVMSGT  138
            +DK A           CG TN N   + IP+ ++   S    H GPCE+WLD+ +VM   
Sbjct  81   EDKGAL----------CGRTNPNASPKAIPSDSVVKFSRAIVHPGPCEIWLDDKRVMQDD  130

Query  139  NCNKDFPGK--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVY-KEC-------VPIG  188
            NC   F  K  T  I ++SCKGSC LRW+W+GL+    +  WQVY K C       +PI 
Sbjct  131  NCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGKR--WQVYSKSCDSSPLCIIPIA  188

Query  189  S  189
            S
Sbjct  189  S  189

>PYAR_14260
Length=212

 Score = 93.6 bits (231),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            +KT A +      KG+K LR+F++ K             CG +  + K +PIP+ G ++ 
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT----------CGNSLSSAKPKPIPSDGMVKF  80

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCE+WLD T      +C K F   T   +++++CKGSC LR+YW+GL+    
Sbjct  81   ASTLEHPGPCEIWLDETMAFHSDDCEKQFGSSTSVKVNFSACKGSCMLRFYWLGLQDSGT  140

Query  175  KWSWQVYKECVPIG  188
            +  WQ YK CVP+G
Sbjct  141  R--WQSYKNCVPLG  152

>PYAR_14256
Length=199

 Score = 92.4 bits (228),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 14/133 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-S  116
            ++T A +      KG+K LRAF++DK             CG T  N K +P     I+ +
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGP----------TCGNTLPNAKPKPXXXXLIKLA  100

Query  117  TGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKT-HSISYASCKGSCTLRWYWMGLRFLKNK  175
            +   H GPCE+WLD++      +C K F   T   + +++CKGSC LR+YW+GL+    +
Sbjct  101  STIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSFKVDFSACKGSCMLRFYWLGLQNSGKR  160

Query  176  WSWQVYKECVPIG  188
              WQ YK C+P+G
Sbjct  161  --WQSYKNCIPLG  171

>H310_06362
Length=197

 Score = 92.0 bits (227),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 72/130 (55%), Gaps = 26/130 (20%)

Query  70   SKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTI------RSTGY--T  120
            + G+KTLRA +D              +CGYT +N   +PIP  G +         G+  +
Sbjct  49   ATGFKTLRAMLDPHGP----------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPS  98

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKGSCTLRWYWMGLRFLKNKWS  177
            H GPCE+WLDNT+V    NC  +FP K  +   + ++SC GSCT+R+YW+ L    ++  
Sbjct  99   HTGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLAL----HEDL  154

Query  178  WQVYKECVPI  187
            WQVYK C P+
Sbjct  155  WQVYKNCAPL  164

>H257_13550
Length=266

 Score = 93.6 bits (231),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 84/160 (53%), Gaps = 39/160 (24%)

Query  40   NPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGY  99
            +PDKNV     AF + Q             + G+KTLRA +D +            +CGY
Sbjct  87   SPDKNVAAFNKAFRDQQ-------------ATGFKTLRAMLDPQGP----------DCGY  123

Query  100  TNINGKRQPIPA-GTI------RSTGY--THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS  150
            + ++   +PIP+ G +         G+  +H GPCE+WLDNT+V    +C  +FP K  +
Sbjct  124  SKLDVPAKPIPSDGNVVWQNPDSGEGFVPSHTGPCEIWLDNTRVFQNDDCATNFPEKPAA  183

Query  151  ---ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               + +ASC GSCT+R+YW+ L    ++  WQVYK C P+
Sbjct  184  HLPVDFASCVGSCTIRFYWIAL----HQDLWQVYKNCAPL  219

>PYIR_24421
Length=213

 Score = 91.7 bits (226),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 75/133 (56%), Gaps = 16/133 (12%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STG  118
            F   +KS  YK++R  ++ K ++    +GA+ ECG ++ +G +QP+PA  +      S G
Sbjct  42   FTAALKSSSYKSVRDLVNAKASF---ISGASKECGISSSSGAKQPLPAQYVEWAHSSSEG  98

Query  119  YT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKN  174
            +T  H+GPCEVW DN    S  NC K++P     + Y  + C G+  LR+YW+ L    +
Sbjct  99   FTPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVAL----H  154

Query  175  KWSWQVYKECVPI  187
              +WQVY  C P+
Sbjct  155  SSTWQVYINCAPL  167

>PYU1_G014690
Length=295

 Score = 93.6 bits (231),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 89/171 (52%), Gaps = 22/171 (13%)

Query  25   VDAHQSVILPAPTF----TNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
             DAH  + +P   F    +NP + +   P  +  N  +K  A+F    K KG+ TLR+++
Sbjct  22   ADAHGFIEVPKSEFPKGTSNPSEWIVEFPPPWTGN--WKDPANFAKVSKEKGFDTLRSYI  79

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR--STGYTHDGPCEVWLDNTKVMSGT  138
            +DK A           CG T+ N   + IP+      S    H GPCE+WLD+ +VM   
Sbjct  80   EDKGAL----------CGKTDPNATPKAIPSDNKVHFSRPIVHPGPCEIWLDDKRVMQDD  129

Query  139  NCNKDFPGKTH--SISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            +C   F  +    +I ++SCK +C LR++W+GL+    +  WQVYK CVP+
Sbjct  130  DCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQDSGTR--WQVYKNCVPL  178

>PYVX_18175
Length=147

 Score = 89.7 bits (221),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 81/164 (49%), Gaps = 61/164 (37%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKA  85
            DAHQ VILP P++T  D++V+++PLAFLENQ               G+KT   F   ++A
Sbjct  26   DAHQYVILPQPSWTTSDRDVWYSPLAFLENQ---------------GFKTQEDFSAWRRA  70

Query  86   YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFP  145
                             NG +      T+RS           ++D+ K            
Sbjct  71   -----------------NGYK------TLRS-----------FMDSGKYTDT--------  88

Query  146  GKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
                +I Y+SCKGSCTL WYWMG+R+LK  +SWQVYK CVP+ +
Sbjct  89   ----AIDYSSCKGSCTLYWYWMGVRYLKGAYSWQVYKNCVPLST  128

>PYIW_24289
Length=196

 Score = 91.3 bits (225),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 83/183 (45%), Gaps = 25/183 (14%)

Query  23   SSVDAHQSVILPAPTFTNPDKN-----VYWNP--LAFLENQGYKTTADFNGY--------  67
            ++VD H ++ +P PTFT    N         P  L   E   Y  + + N          
Sbjct  21   TNVDGHGAMSVPQPTFTTGIVNEGFCATMLGPEVLPVPEGMSYSGSPEMNALAFKTAFSS  80

Query  68   -IKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCE  126
               S  Y+ LR  +D K  +   +AG + ECG+TN+   +QP+ A        TH GPCE
Sbjct  81   QTDSIKYRNLRDLIDTKAVF---SAGTDKECGFTNVTSAKQPLSAHATGGFTPTHQGPCE  137

Query  127  VWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            +W D   V    NC K++P     + Y  + C G+  L++YW+ +  +K    W+ Y  C
Sbjct  138  IWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWLAVHSIK----WEAYINC  193

Query  185  VPI  187
             P+
Sbjct  194  APL  196

>PYIW_19151
Length=248

 Score = 92.0 bits (227),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/174 (34%), Positives = 89/174 (51%), Gaps = 21/174 (12%)

Query  23   SSVDAHQSVILPAPT---FTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAF  79
            S  DAH  +I P        +P   V   P  +  +  +K   +F    K KG+ TLR++
Sbjct  19   SQTDAHGYIISPKAQGNGVGHPGTFVIEYPPPWTGD--WKDPKNFAAAAKEKGFSTLRSY  76

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPAG-TIR-STGYTHDGPCEVWLDNTKVMSG  137
            ++DK A           CG+T+     + IPA  TIR S    H GPCE+++D+T+V   
Sbjct  77   LEDKGAV----------CGFTDPKVSPRAIPADRTIRFSRDIPHPGPCELYIDDTRVYQN  126

Query  138  TNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
             +C   F G   S  + ++ CKG C +R+YW+GL+    +  WQVYK CVP+ S
Sbjct  127  DDCESAFTGVIPSWDVDWSLCKGECMIRFYWLGLQASGTR--WQVYKSCVPVSS  178

>PYU1_G005323
Length=251

 Score = 91.3 bits (225),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 74/133 (56%), Gaps = 15/133 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            ++T A +      KGYK L++F++DK             CG +  + K +PIP+ G I+ 
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV----------CGNSLPDAKAKPIPSDGVIKL  103

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCEVW D+ +     +C K F   T   + +++CKGSC LR+YW+GL+    
Sbjct  104  ASTIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSFKVDFSACKGSCMLRFYWLGLQDGGK  163

Query  175  KWSWQVYKECVPI  187
            +  WQ YK C+P+
Sbjct  164  R--WQSYKNCIPL  174

>PYU1_G005324
Length=191

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 15/135 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            ++T A +      KGYK L++F+D K             CG T  N K + IP  G ++ 
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP----------TCGNTLSNAKAKAIPKDGMLKF  104

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCE+WL NT+     +C K F   T   I +++CKG+C LR+YW+GL+    
Sbjct  105  ASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK  164

Query  175  KWSWQVYKECVPIGS  189
            +  WQ YK CVP+ S
Sbjct  165  R--WQSYKNCVPLKS  177

>PYU1_G005326
Length=191

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 15/135 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            ++T A +      KGYK L++F+D K             CG T  N K + IP  G ++ 
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP----------TCGNTLSNAKAKAIPKDGMLKF  104

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCE+WL NT+     +C K F   T   I +++CKG+C LR+YW+GL+    
Sbjct  105  ASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK  164

Query  175  KWSWQVYKECVPIGS  189
            +  WQ YK CVP+ S
Sbjct  165  R--WQSYKNCVPLKS  177

>PYU1_G005328
Length=191

 Score = 89.7 bits (221),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 15/135 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            ++T A +      KGYK L++F+D K             CG T  N K + IP  G ++ 
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP----------TCGNTLSNAKAKAIPKDGMLKF  104

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCE+WL NT+     +C K F   T   I +++CKG+C LR+YW+GL+    
Sbjct  105  ASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK  164

Query  175  KWSWQVYKECVPIGS  189
            +  WQ YK CVP+ S
Sbjct  165  R--WQSYKNCVPLKS  177

>PYIW_24288
Length=201

 Score = 89.0 bits (219),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 87/188 (46%), Gaps = 30/188 (16%)

Query  23   SSVDAHQSVILPAPTFTNPD------KNVYWNPLAFLENQG--YKTTADFNGYIKSKG--  72
            +SVD H ++ +P PTF N          +   P       G  Y +    N  +  +   
Sbjct  21   TSVDGHGAMTVPKPTFMNGTVKEAYCATIRGPPTGMGAPAGMTYSSNGANNARVYERAFG  80

Query  73   ----YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTI-------RSTGYTH  121
                Y+ LR  +D    +   +AGA+ ECG+T+  G +QP+PA  +       +    TH
Sbjct  81   NQNRYRNLRELVDFTAVF---SAGADKECGFTSATGAKQPLPAQYVEWNNRVNQGLAPTH  137

Query  122  DGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQ  179
            +GPCEVW D        NC K+F G    +SY  + C G+  L++YW+ L    +   W+
Sbjct  138  EGPCEVWCDQQLAFKDFNCAKNFMGAPAKLSYKKSVCTGAKMLKFYWLSL----DSREWE  193

Query  180  VYKECVPI  187
            VY  CVP+
Sbjct  194  VYINCVPL  201

>PHYRA_74651
Length=344

 Score = 91.3 bits (225),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 85/185 (46%), Gaps = 31/185 (17%)

Query  25   VDAHQSVILPAPTFTNPDKNVY-----------WNPLAFLENQGYKTTADFNGYIKSKGY  73
            V+AH  V  P   F + + + +           W+  +  +N+   T   +    +S GY
Sbjct  21   VNAHGYVSNPLSEFVDSETSAWVVQIDPQWAGDWDSCSSDDNECLTTL--YTSLKESNGY  78

Query  74   KTLRAFMD-DKKAYKVDAAGANFECGYTNING--KRQPIPAGTIRSTGYTHDGPCEVWLD  130
              +R  +D D   Y  D       CG+T+ N   K  P       S G  H GPCE+WLD
Sbjct  79   SDIRTLLDSDTSLYGAD-------CGFTDPNATPKDPPSTGDATFSRGMVHAGPCEIWLD  131

Query  131  NTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSWQVYK  182
            +TKV+S  NC   +   T         + Y+SC  G CTLR+YW+  + L +   WQVYK
Sbjct  132  DTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDSSTVWQVYK  191

Query  183  ECVPI  187
             CVP+
Sbjct  192  NCVPL  196

>PHYCA_98479
Length=276

 Score = 90.1 bits (222),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 64/118 (54%), Gaps = 18/118 (15%)

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIR------STGYTHDGPCEVWLDNTKVMSG  137
            K   +D  G+  ECG+T  +G RQP+P   +         G+TH GPCE+++D+T V+ G
Sbjct  73   KDVVLDMVGSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHG  132

Query  138  TNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC  ++PG            + Y+SCKG CTL  YW+G +  +    WQ Y  CVP+
Sbjct  133  DNCEDEYPGGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGFQNAQ----WQAYINCVPL  186

>PYU1_G005325
Length=207

 Score = 88.6 bits (218),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 15/133 (11%)

Query  58   YKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-  115
            ++T A +      KGYK L++F+D K             CG T  N K + IP  G ++ 
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP----------TCGNTLSNAKAKAIPKDGMLKF  104

Query  116  STGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKT-HSISYASCKGSCTLRWYWMGLRFLKN  174
            ++   H GPCE+WL NT+     +C K F   T   I +++CKG+C LR+YW+GL+    
Sbjct  105  ASSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSFKIDFSACKGNCMLRFYWLGLQDGGK  164

Query  175  KWSWQVYKECVPI  187
            +  WQ YK C+P+
Sbjct  165  R--WQSYKNCIPL  175

>PPTG_07507
Length=299

 Score = 90.5 bits (223),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 83/183 (45%), Gaps = 34/183 (19%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLRA  78
            + DAH ++  P  TF +    V W  +  ++N      G      F    K KG      
Sbjct  18   TADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDV  75

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDNT  132
             +D  K  K         CGYT  +   +PIPA G ++       G+TH GPCE+++D+ 
Sbjct  76   VLDMVKDKK---------CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDK  126

Query  133  KVMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
             V+ G NC +DFPG            + ++SC G CTL  YW+G +  +    WQ Y  C
Sbjct  127  MVLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNC  182

Query  185  VPI  187
            VP+
Sbjct  183  VPL  185

>PHYSO_438103
Length=238

 Score = 89.4 bits (220),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (47%), Gaps = 23/180 (13%)

Query  24   SVDAHQSVILPAPTFT---NPDKNVYWNPL---AFLENQGYKTTADFNGYIKSKGYKTLR  77
            S DAH  +++P   FT   N    V  +P+      +     +   F     +  +K L+
Sbjct  19   SADAHGYMLIPESQFTGGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLK  78

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVM  135
              MDD   Y  D       CG+T+ NG  QPIP       S    H GPCE+WLDNTKV+
Sbjct  79   TLMDDTSVYGQD-------CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVL  131

Query  136  SGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +  +   I       Y+SC  G C  +R+YW+  + L +K  WQ YK+C+P+
Sbjct  132  YEDDCFSKYGNENQDIKSVFPVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PPTG_07509
Length=299

 Score = 90.1 bits (222),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 82/182 (45%), Gaps = 34/182 (19%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLRAF  79
             DAH ++  P  TF +    V W  +  ++N      G      F    K KG       
Sbjct  19   ADAHGNLKEPPATFEDGAPTVEW--VTMIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  76

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDNTK  133
            +D  K  K         CGYT  +   +PIPA G ++       G+TH GPCE+++D+  
Sbjct  77   LDMVKDKK---------CGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKM  127

Query  134  VMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            V+ G NC +DFPG            + ++SC G CTL  YW+G +  +    WQ Y  CV
Sbjct  128  VLHGDNCEEDFPGGPDGSEKMSEMPVDFSSCNGKCTLTIYWLGFQNAQ----WQAYVNCV  183

Query  186  PI  187
            P+
Sbjct  184  PL  185

>PHYKE_10578
Length=239

 Score = 89.0 bits (219),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 82/184 (45%), Gaps = 34/184 (18%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S  DAH ++ +P PTF     +  W  +  ++N      G      F      KG     
Sbjct  18   SHADAHGALKVPEPTFEQGASHSNW--VTLVDNYWDIGSGGDQVGKFKTMATEKGMSVKD  75

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTI-----RSTGYTHDGPCEVWLDN  131
              +D  K  K         CG+T  +   QP+P+ G +      + G+TH GPCEV++D+
Sbjct  76   VILDMVKDKK---------CGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDD  126

Query  132  TKVMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
              V+ G NC  ++PG           +I Y+SC G C L +YW+G +       WQ Y  
Sbjct  127  KLVLHGDNCEDEYPGGPDESGKLSEMTIDYSSCNGDCMLSFYWLGFQ----NEQWQSYVN  182

Query  184  CVPI  187
            CVP+
Sbjct  183  CVPL  186

>PYU1_G001528
Length=274

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query  25   VDAHQSVILPAPTFT-NPDKNVYWNPL---AFLENQGYKTTAD-------FNGYIKSKGY  73
             DAH S+ +P PTFT N D   +   +   A     G   T D       F   +K+  Y
Sbjct  24   ADAHGSMSVPKPTFTINGDTTQFCGTVDSSALTAPAGMSFTTDPLSNTNAFTAALKTSSY  83

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPCE  126
            K++R   + K    V   GA  +CGYT+  G  QP+PA  +        G+T  H GPCE
Sbjct  84   KSVRDLWNAKGVLGV--TGATKQCGYTSATGAAQPLPAKYVEWSHGSGEGFTPSHQGPCE  141

Query  127  VWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            VW DN    + TNC K++P     + +  A C G   L  YW+ L   +    WQ Y  C
Sbjct  142  VWCDNVLAFTDTNCAKNYPTAPAKLPFDHAKCVGKKMLTIYWLALHSPQ----WQAYINC  197

Query  185  VPI  187
             P+
Sbjct  198  APL  200

>PHYRA_78625
Length=434

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 78/169 (46%), Gaps = 51/169 (30%)

Query  26   DAHQSVILPAPTFTNPDKNV-----YWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
            +AHQ V +P+PT+T  + +       WNPL+FLE +G++T  +F  +    GY +LR F+
Sbjct  239  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  298

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D  K YK+                                              +S  NC
Sbjct  299  DKAK-YKL---------------------------------------------ALSYLNC  312

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            ++    +T  + Y+ C  SC L WYW+G R+LK  +SWQVYKEC+ + S
Sbjct  313  HESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYS  361

>PHYRA_78626
Length=473

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 78/169 (46%), Gaps = 51/169 (30%)

Query  26   DAHQSVILPAPTFTNPDKNV-----YWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
            +AHQ V +P+PT+T  + +       WNPL+FLE +G++T  +F  +    GY +LR F+
Sbjct  278  EAHQVVYIPSPTWTRSNSSSSERRELWNPLSFLEKEGFETQENFTQFQVDNGYTSLRDFL  337

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMSGTNC  140
            D  K YK+                                              +S  NC
Sbjct  338  DKAK-YKL---------------------------------------------ALSYLNC  351

Query  141  NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            ++    +T  + Y+ C  SC L WYW+G R+LK  +SWQVYKEC+ + S
Sbjct  352  HESITDQTFKLDYSGCGDSCILYWYWLGARYLKGSYSWQVYKECILLYS  400

>PITG_05271
Length=278

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 86/181 (48%), Gaps = 25/181 (14%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYW----NPLAFLEN-QGYK--TTADFNGYIKSKGYKTL  76
            S DAH  +++P   F     N  W    +P+   E+  G K  +   F     +  +K L
Sbjct  20   STDAHGYMLIPESQFKG-SANSAWIVQIDPVWASEDWDGNKPGSVNAFKALKTANKFKDL  78

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIP--AGTIRSTGYTHDGPCEVWLDNTKV  134
            +  MDD   Y  D       CG+T+ NGK QPIP       S    H GPCE+WLD+TKV
Sbjct  79   KTLMDDTSVYGAD-------CGFTDPNGKAQPIPKDGKATFSRALVHVGPCEIWLDDTKV  131

Query  135  MSGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVP  186
            +   +C   +  +   I       Y+SC  G C  +R+YW+  + +  K  WQ YK+C+P
Sbjct  132  LYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIP  191

Query  187  I  187
            +
Sbjct  192  L  192

>PPTG_04622
Length=273

 Score = 89.0 bits (219),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 16/129 (12%)

Query  69   KSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNING--KRQPIPAGTIRSTGYTHDGPCE  126
            +S GY  +RA +D       D  GAN  CG+T+ +   K  P       S G  H GPCE
Sbjct  74   ESNGYSDIRALLDSD----TDLYGAN--CGFTDPDATPKDPPTTGDATFSRGMVHAGPCE  127

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCK-GSCTLRWYWMGLRFLKNKWSW  178
            +WLD+T V+S  +C   +   T         + Y+SC  G C LR+YW+  + + +K  W
Sbjct  128  IWLDDTMVLSNDDCQTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFYWLAFQGVDSKMVW  187

Query  179  QVYKECVPI  187
            QVYK+CVP+
Sbjct  188  QVYKDCVPL  196

>PYIW_16810
Length=216

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 87/175 (50%), Gaps = 14/175 (8%)

Query  25   VDAHQSVILPAPTFTNPDKNV--YWN-PLAFLENQGYKTTADFNGYIKSKGYKTLRAF-M  80
            VDAH  + LPAPTF    K+   YW   +   +N    T A F    K  G+K+LRAF M
Sbjct  23   VDAHGRLALPAPTFIASAKSKPNYWAYGVDNTKNPPRATAATFAANYKKNGFKSLRAFIM  82

Query  81   DDKKAYKVDA--AGANFECGYTNINGKRQPIPAGTI-RSTGYTHDGPCEVWLDNTKVMSG  137
            D++   K D   +G   ECG+T+ NG  QP+P         + H+GPCE W D+  VM  
Sbjct  83   DNQTPGKYDGKPSGGTPECGFTDPNGTPQPLPDKLGWPGPTFQHEGPCEAWCDDVLVMPF  142

Query  138  TNCNKDFPGKTHS-ISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            T   K + G   + + Y  A C G   L +YW+   F+     +Q Y  CVPI S
Sbjct  143  TASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLA-TFVS---PFQAYTNCVPIKS  193

>PHYKE_6077
Length=322

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 68/134 (51%), Gaps = 15/134 (11%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----  115
            TA+FN  + +  Y +L+ FM  K   KV +     ECGYTN  G  QP+P   +      
Sbjct  66   TANFNKGMAASKYTSLKEFMAAKA--KVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGS  123

Query  116  STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRF  171
              G+T  H+GPCEVW D+T+V    NC  +FP     + Y   +C GS  L  YW+ L  
Sbjct  124  GEGFTSSHEGPCEVWCDDTRVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIAL--  181

Query  172  LKNKWSWQVYKECV  185
              +  SWQVY  C 
Sbjct  182  --HSPSWQVYINCA  193

>PHYCA_130365
Length=266

 Score = 87.8 bits (216),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 64/136 (47%), Gaps = 17/136 (13%)

Query  62   ADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGK--RQPIPAGTIRSTGY  119
            A F     S  YK +R+ MD    Y  D       CG+T+ NG     P       S G 
Sbjct  64   ATFKELAASNNYKDVRSMMDGNSVYGED-------CGFTDPNGTPVDPPTDGTATFSRGI  116

Query  120  THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRF  171
             H GPCE+WLD+  V+   +C   +   T         + Y+SC  G C LR+YW+GL+ 
Sbjct  117  VHAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQR  176

Query  172  LKNKWSWQVYKECVPI  187
            L  K  WQ YK C+P+
Sbjct  177  LDGKTVWQAYKNCIPL  192

>PYAP_18713
Length=184

 Score = 85.9 bits (211),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 80/160 (50%), Gaps = 16/160 (10%)

Query  23   SSVDAHQSVILPAPTF--TNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFM  80
            S+ DAH  V  P   F  + P  + +        +  +KT A +    K KG+K LR+F+
Sbjct  20   STADAHGYVAEPPAEFPKSTPYPSEWVAEFPPPWSGTFKTGAQYAVVAKDKGFKDLRSFL  79

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGT--IRSTGYTHDGPCEVWLDNTKVMSGT  138
            +DK             CG TN N K + +P+ +  + S    H GPCE+W+D+T V    
Sbjct  80   EDKGP----------ACGKTNPNAKPRNVPSDSKVVFSRPMVHRGPCELWIDDTMVYHND  129

Query  139  NCNKDFPGKT--HSISYASCKGSCTLRWYWMGLRFLKNKW  176
            +C  +F  K     + ++SCKG C LR+YW+GL+    +W
Sbjct  130  DCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSGKRW  169

>PYIR_22133
Length=441

 Score = 89.4 bits (220),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 81/180 (45%), Gaps = 27/180 (15%)

Query  28   HQSVILPAPTF-------TNPDKNVYWNPLAFLENQGYKT-----TADFNGYIKSKGYKT  75
            H S+ LP PTF       T P  NV  + L       + T     T  FN  IK+  YK+
Sbjct  26   HGSMSLPKPTFSTQGGDTTQPGLNVDSSALTAPSGMSFTTDPTSNTNAFNAAIKTSAYKS  85

Query  76   LRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA------GTIRSTGYTHDGPCEVWL  129
            ++  +    A  V   GAN +CG T   G +QP+PA      G+      +H+GPCEVW 
Sbjct  86   VKDLI---AAKGVPIPGANKDCGLTTPTGAKQPLPAQVEWSHGSGEGFTPSHEGPCEVWC  142

Query  130  DNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            DN    S  NC K+FP     + Y  + C G   L+  W+ L    +  +WQ Y  C  I
Sbjct  143  DNVLAFSDGNCAKNFPSAPAKLPYDKSKCVGKSVLKTIWLAL----HSPTWQAYINCAAI  198

>PHYCA_127270
Length=279

 Score = 87.0 bits (214),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 82/180 (46%), Gaps = 23/180 (13%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFL------ENQGYKTTADFNGYIKSKGYKTLR  77
            SVDAH  +++P   F     + +   +  +      +    ++   F     +  +K L+
Sbjct  20   SVDAHGYMLIPESQFKGSANSAWIVQIDPVWASDKWDGNNPQSVDTFKSLKAANNFKDLK  79

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVM  135
              MDD   Y  D       CG+T+ NG  QPIP       S    H GPCE+WLD+ KV+
Sbjct  80   TLMDDTSVYGAD-------CGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDDKKVL  132

Query  136  SGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +  K   I       Y+SC  G C  +R+YW+  + L  K  WQ YK+C+P+
Sbjct  133  YEDDCFSKYGNKNQDIKSVFPVDYSSCDNGGCKQMRFYWLAFQGLSKKTVWQSYKDCIPL  192

>PHYCA_12942
Length=353

 Score = 87.4 bits (215),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 82/178 (46%), Gaps = 31/178 (17%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLRA  78
            + DAH S+  P PTF     +  W  +  ++N      G      F      +G      
Sbjct  19   NADAHGSLKQPKPTFDG--SSAEW--VTMIDNYWDIGSGGDQVGKFKTMAAERGMSVKDV  74

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDNT  132
             +D  K  K         CGYT  +   QPIP+ G ++       G+TH GPCE+++D+ 
Sbjct  75   ILDMVKDKK---------CGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDK  125

Query  133  KVMSGTNCNKDFPGKTHS---ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             V+ G NC ++F G   S   I Y+SC G+C L  YW+G +  +    WQ Y  CVP+
Sbjct  126  MVLHGDNCEEEFKGGDTSDMKIDYSSCNGNCMLTIYWLGFQNAQ----WQAYVNCVPL  179

>PHYCA_534473
Length=1050

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 16/129 (12%)

Query  69   KSKGYKTLRAFMDDKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPCE  126
            +S GY  +R  +D       D  GAN  CG+T+  +  K  P       S G  H GPCE
Sbjct  846  ESNGYSDIRTLLDSD----TDLYGAN--CGFTDPDVTAKDPPTTGDATFSRGMVHAGPCE  899

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFLKNKWSW  178
            +WLD+TKV+S  +C   +   T         + Y+SC  S C LR+YW+  + + +K  W
Sbjct  900  IWLDDTKVLSNDDCQTAYGDGTQEKASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKIVW  959

Query  179  QVYKECVPI  187
            QVYK+CVP+
Sbjct  960  QVYKDCVPL  968

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 18/130 (14%)

Query  69   KSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTNINGKRQPIPA--GTIRSTGYTHDGPC  125
            KS   K +R  +D D K Y  D       CG T+   K +  P+      S G  H GPC
Sbjct  541  KSNNVKDIRTMIDADPKLYGED-------CGNTDPKAKPKDPPSTGDATFSRGIVHAGPC  593

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCK-GSCTLRWYWMGLRFLKNKWS  177
            E+WLD+  V+   +C   +   T +       + Y+SC  G C  R+YW+ L+   +K  
Sbjct  594  EIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQRRDSKTL  653

Query  178  WQVYKECVPI  187
            WQVYK C+P+
Sbjct  654  WQVYKNCIPL  663

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 71/166 (43%), Gaps = 24/166 (14%)

Query  25   VDAHQSVILPAPTFTNPDKN---VYWNPL---AFLENQGYK-TTADFNGYIKSKGYKTLR  77
            V AH  +  PAP++ + + N   V   P     + E++G     + F        YK +R
Sbjct  21   VQAHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDPGLLSTFKELAAKNNYKDVR  80

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGK--RQPIPAGTIRSTGYTHDGPCEVWLDNTKVM  135
              MD    Y  D       CG+T+  G     P       S G  H GPCE+WLD+  V+
Sbjct  81   TLMDGNPVYGED-------CGFTDPKGTPVDPPTDGTATFSRGIVHAGPCEIWLDDKMVL  133

Query  136  SGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLK  173
               +C   +   T         + Y+SC  G C LR+YW+ L+ LK
Sbjct  134  QNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLK  179

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 52/114 (46%), Gaps = 18/114 (16%)

Query  70   SKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPCE  126
            S   K +R  +D D K Y  D       CGYTN  +  K  P       S G  H GPCE
Sbjct  279  SNNAKDIRTLLDSDTKLYGAD-------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCE  331

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFL  172
            +WLD+  V+S  +C   +   T         + Y+SC  G C  R+YW+ L+ L
Sbjct  332  IWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRL  385

>PHYSO_533903
Length=208

 Score = 84.7 bits (208),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 86/181 (48%), Gaps = 26/181 (14%)

Query  25   VDAHQSVILPAPTFTNPDKNVY-------WNPLAFLENQGYKTTADFNGYIKSKGYKTLR  77
            VDAH  + +P   F   + + +       W    +  N   K+   F     +  +K L+
Sbjct  22   VDAHGYIYVPQSQFKGGENSQWLVQIDPVWKSDDWYGNTA-KSVEVFKSLKVANNFKDLK  80

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVM  135
              +DD   Y  D       CG+T+ NG  QPIP     + S G  H GPCE WLD+ KV+
Sbjct  81   TMLDDTSLYGPD-------CGFTDPNGTPQPIPTDGKAVFSRGLIHTGPCEFWLDDKKVL  133

Query  136  SGTNCNKDFPGKT------HSISYASCK-GSC-TLRWYWMGLRFLKNKWS-WQVYKECVP  186
               +C  ++            I Y+SC+ G C  +R+YW+G + L +K + WQ YK+C+P
Sbjct  134  YADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGFQALDDKKTVWQTYKDCIP  193

Query  187  I  187
            +
Sbjct  194  L  194

>PHYKE_6001
Length=289

 Score = 86.7 bits (213),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 82/180 (46%), Gaps = 25/180 (14%)

Query  25   VDAHQSVILPAPTFTNPDKNVY-------WNPLAFLENQGYKTTADFNGYIKSKGYKTLR  77
             DAH  +++P   F     + +       W    +  N     TA FN   K+  Y  L+
Sbjct  21   ADAHGYMLIPESQFKGSASSAWIVQIDPVWASEDWDGNNAQSVTA-FNALKKANNYVDLK  79

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVM  135
              MDD   Y  D       CG+T+ NG  QPIP+      S    H GPCE+WLD+  V 
Sbjct  80   TLMDDTSVYGAD-------CGFTDPNGTPQPIPSDGKATYSRAIQHVGPCEIWLDDKMVF  132

Query  136  SGTNC-----NKDFPGKT-HSISYASCKGSC--TLRWYWMGLRFLKNKWSWQVYKECVPI  187
            S  +C     N++   K+   + Y+SC G     +R+YW+  + +  K  WQ YK C+P+
Sbjct  133  SDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAFQGVDGKTVWQSYKNCIPL  192

>PYIW_21964
Length=265

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 82/184 (45%), Gaps = 28/184 (15%)

Query  25   VDAHQSVILPAPTFTNPDKNVYW-----NPLAFLENQGYKTTAD-------FNGYIKSKG  72
            V AH  + +P  TF   D    +      P       G   T D       F   +K+  
Sbjct  22   VSAHGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKAST  81

Query  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPC  125
            YK++RA +DDK  +  +A   N ECG T+  G +QP+P   +      S G+T  H GPC
Sbjct  82   YKSMRALVDDKAVFIKEA---NKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPC  138

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            EVW D+    +  NC  D+        I +A C G+  L+  W+ L    +  +WQ+Y  
Sbjct  139  EVWCDDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLAL----HSSTWQIYIN  194

Query  184  CVPI  187
            C P+
Sbjct  195  CAPL  198

>PHYRA_73584
Length=287

 Score = 85.9 bits (211),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 18/135 (13%)

Query  64   FNGYIKSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYT  120
            ++   KS GY  +R  +D D   Y     GAN  CG+TN     K  P       S G  
Sbjct  66   YSSLKKSNGYSDIRTLLDSDTTLY-----GAN--CGFTNPDATAKDPPTTGDATFSRGMV  118

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFL  172
            H GPCE+WLD+T V+S  +C   +   +         + Y+SC  S C LR+YW+  + +
Sbjct  119  HAGPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFTPVDYSSCSSSGCMLRFYWLAFQGV  178

Query  173  KNKWSWQVYKECVPI  187
             +K  WQVYK+CVP+
Sbjct  179  DSKTVWQVYKDCVPL  193

>PHYRA_73607
Length=343

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 65/135 (48%), Gaps = 18/135 (13%)

Query  64   FNGYIKSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYT  120
            ++    S GY  +R  +D D   Y  D       CG+TN     K  P       S G  
Sbjct  69   YSSLKSSNGYSDIRTLLDSDTSLYGAD-------CGFTNPDATAKDPPTTGDATFSRGMV  121

Query  121  HDGPCEVWLDNTKVMSGTNC-------NKDFPGKTHSISYASCKGS-CTLRWYWMGLRFL  172
            H GPCE+WLD+TKV+S  NC        +D       + Y+SC  S C LR+YW+  + +
Sbjct  122  HVGPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAFQGV  181

Query  173  KNKWSWQVYKECVPI  187
             +   WQVYK CVP+
Sbjct  182  DSSMVWQVYKNCVPL  196

>PHYKE_10295
Length=292

 Score = 86.3 bits (212),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 67/142 (47%), Gaps = 29/142 (20%)

Query  59   KTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTG  118
            K TA F        +KTLRA MD              +CG T + G   P+    + S  
Sbjct  61   KNTATFTSSFPKSQFKTLRALMDTVAP----------DCGNTALTGS--PVDVSALSSMK  108

Query  119  Y-----------THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWY  165
            +           +H GPCE W+D+T+VM   +C  D+P       I Y+SC G CT  +Y
Sbjct  109  WQNDQEQKGFIDSHHGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFY  168

Query  166  WMGLRFLKNKWSWQVYKECVPI  187
            WM L    ++ +WQVYK+C PI
Sbjct  169  WMAL----HEPNWQVYKQCAPI  186

>PHYRA_73606
Length=366

 Score = 87.0 bits (214),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 68/138 (49%), Gaps = 18/138 (13%)

Query  61   TADFNGYIKSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRST  117
            T+ + G   S GY  +R  +D D   Y  D       CGYTN     K  P       S 
Sbjct  66   TSVYTGLKSSNGYSDIRTLLDSDTSLYGAD-------CGYTNPDATAKDPPTTGDATFSR  118

Query  118  GYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGL  169
            G  H GPCE+WLD+T V+S  +C   +   T         + Y+SC  S C LR+YW+  
Sbjct  119  GMVHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSTSGCMLRFYWLAF  178

Query  170  RFLKNKWSWQVYKECVPI  187
            + + ++  WQVYK+CVP+
Sbjct  179  QGVDSEIVWQVYKDCVPL  196

>PPTG_07521
Length=281

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 61/118 (52%), Gaps = 18/118 (15%)

Query  84   KAYKVDAAGANFECGYTNINGKRQPIPAGTIR------STGYTHDGPCEVWLDNTKVMSG  137
            K   +D  GA  ECG+T  +G RQPIP+  +         G+TH GPCE++LD+  V+ G
Sbjct  73   KDVVLDMVGAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHG  132

Query  138  TNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             NC  ++PG            + Y+SC   CTL  YW+  +      +WQ Y  CVP+
Sbjct  133  DNCEDEYPGGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAYINCVPL  186

>PITG_11936
Length=333

 Score = 86.3 bits (212),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (51%), Gaps = 19/138 (14%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANF--ECGYTNINGKRQPIPAGTIR---  115
            TA+FN    +  YK+L+ FM+D           +F  ECGYTN +   QP+P   +    
Sbjct  66   TANFNKGFAASKYKSLKEFMNDNMVL----VNEDFTKECGYTNPDATPQPLPKTYVEWSH  121

Query  116  --STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGL  169
                G+T  H+GPCEV+ D T+V    NC K+FP     + +   +C GS  L  YW+ L
Sbjct  122  GAGEGFTLSHEGPCEVYCDETRVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIAL  181

Query  170  RFLKNKWSWQVYKECVPI  187
                +  SWQVY  C P+
Sbjct  182  ----HSPSWQVYINCAPL  195

>PHYCA_97965
Length=288

 Score = 85.5 bits (210),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 79/182 (43%), Gaps = 34/182 (19%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLRAF  79
             +AH ++  P  TF +    V W  +  ++N      G      F    K KG       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLIDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTI------RSTGYTHDGPCEVWLDNTK  133
            +D  K  K         CGYT  +   QPIP+  I         G+TH GPCE+++D+  
Sbjct  80   LDMVKDKK---------CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  134  VMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            V+ G +C  +FPG           S+ ++SC G CTL  YW+  +  +    WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGAKGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCV  186

Query  186  PI  187
            P+
Sbjct  187  PL  188

>PPTG_04647
Length=327

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 64/130 (49%), Gaps = 18/130 (14%)

Query  69   KSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPC  125
             S GY  +R  +D D   Y  D       CGYTN     K  P       S G  H GPC
Sbjct  73   SSNGYSDIRTLLDSDTDLYGAD-------CGYTNPDATAKDPPTTGDATFSRGMVHVGPC  125

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFLKNKWS  177
            E+WLD+T V+S  NC   +   T         + Y+SC  S C LR+YW+  + + +K  
Sbjct  126  EIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMV  185

Query  178  WQVYKECVPI  187
            WQVYK+CVP+
Sbjct  186  WQVYKDCVPL  195

>PHALS_03179
Length=372

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 92/180 (51%), Gaps = 21/180 (12%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKS--KGYKTLRA--  78
            SS+++H  V++P   F     N  W     ++      ++D+NG  +   K Y++L+A  
Sbjct  59   SSIESHGYVLIPQTQFKGLPGNEAW----IVQIDPLWKSSDWNGNTEQSVKAYQSLKAAN  114

Query  79   -FMDDKKAYKVDAAGANFECGYTNINGKRQPIP--AGTIRSTGYTHDGPCEVWLDNTKVM  135
             F D K   +  A G   ECG+++  GK QPIP       S    H GPCE+WLDN KV+
Sbjct  115  NFKDLKTLMETHALGP--ECGFSDPKGKPQPIPKDGKATLSRAIVHRGPCEMWLDNKKVL  172

Query  136  SGTNC-----NKDFPGKT-HSISYASC-KGSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C     N+D   K+   + Y+SC  G C  +R+YW+  + +K    WQ YK C+P+
Sbjct  173  YEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKGITFWQSYKNCIPL  232

>PPTG_04618
Length=326

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (47%), Gaps = 24/180 (13%)

Query  25   VDAHQSVILPAPTFTNPDKN---VYWNPL---AFLENQGYK-TTADFNGYIKSKGYKTLR  77
            V AH  +  PAP++ + + N   V   P     + E++G +   A F        YK +R
Sbjct  21   VQAHGYIAKPAPSWKDKETNDWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNYKDVR  80

Query  78   AFMDDKKAYKVDAAGANFECGYTNING-KRQPIPAGTIR-STGYTHDGPCEVWLDNTKVM  135
            + MD    Y  D       CG+T+  G   +P   GT   S G  H GPCE+WLD+  V+
Sbjct  81   SLMDGNPVYGED-------CGFTDPKGTPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVL  133

Query  136  SGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +   T         + Y+SC  G C LR+YW+ L+ L  K  WQ YK C+P+
Sbjct  134  QNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPL  193

>CCI47381
Length=211

 Score = 84.0 bits (206),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 68/140 (49%), Gaps = 27/140 (19%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--------  112
            TA F     S  ++TLR F+ DK  Y          CG TN N   +PIPA         
Sbjct  60   TATFLTAFASSPFRTLRDFLKDKGPY----------CGSTNPNASPKPIPADNAIVWENP  109

Query  113  -TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF---PGKTHSISYASCKGSCTLRWYWMG  168
             T      +H GPCEVWL  T+V    NC   F   P +   I+++SC G C L+++W+ 
Sbjct  110  DTREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARI-PINFSSCSGGCLLQFFWLA  168

Query  169  LRFLKNKWSWQVYKECVPIG  188
            L    ++  WQVYK C+PI 
Sbjct  169  L----HEPQWQVYKNCIPIA  184

>PHYRA_78689
Length=296

 Score = 85.5 bits (210),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/180 (29%), Positives = 83/180 (46%), Gaps = 23/180 (13%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFL------ENQGYKTTADFNGYIKSKGYKTLR  77
            S DAH  +++P   F     + +   +  +      +    ++   F     +  +K L+
Sbjct  20   SADAHGYMLIPESQFKGSASSAWVVQIDPVWTSDKWDGNNPQSVDTFKSLKTANNFKDLK  79

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVM  135
              MDD   Y  D       CG+T+ +G  QPIP       S    H GPCE+WLD+TKV+
Sbjct  80   TLMDDTSVYGAD-------CGFTDPDGTPQPIPTDGKATFSRALVHVGPCEIWLDDTKVL  132

Query  136  SGTNCNKDFPGKTHSI------SYASC-KGSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +  +   I       Y+SC  G C  +R+YW+  + L +K  WQ YK+C+P+
Sbjct  133  YEDDCFSKYGNENQDIKSVFPVDYSSCNSGGCKQMRFYWLAFQGLDSKTVWQSYKDCIPL  192

>PPTG_03156
Length=445

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 89/186 (48%), Gaps = 30/186 (16%)

Query  23   SSVDAHQSVILPAPTFTNP--DKNVYWNPLAFLE--NQGYKTT---------ADFNGYIK  69
            S V AH  +  PA TF+N   DK+ +   +A +E  + G+K T         A F     
Sbjct  16   SCVSAHGWLSKPAATFSNEAGDKSQF---IATIEASSSGFKGTFNTAPADNVASFTKAFA  72

Query  70   SKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT----IRSTGYT--HDG  123
            +  YK+L+AF+DDK   K+   GA   CG    +   QP+P         S G+T  H+G
Sbjct  73   TSTYKSLKAFIDDKA--KITVTGATLTCGNAEPDATAQPLPDKLEWYHSESEGFTASHEG  130

Query  124  PCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVY  181
            PCE W D+ +V    NC  +F      + Y  + C G+ TL +YWM +       +WQVY
Sbjct  131  PCEAWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGP----TWQVY  186

Query  182  KECVPI  187
              C P+
Sbjct  187  VNCAPL  192

>PHYSO_533682
Length=278

 Score = 85.1 bits (209),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 19/135 (14%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTH  121
            F  +     +K L+  MDD   Y  D       CG+T+ NG  QPIP       S G  H
Sbjct  66   FTSFKSVNNFKDLKTLMDDTSVYGQD-------CGFTDPNGTPQPIPTDGKATFSRGLIH  118

Query  122  DGPCEVWLDNTKVMSGTNC-------NKDFPGKTHSISYASC-KGSC-TLRWYWMGLRFL  172
             GPCE+WLD+ KV+S  +C       N+D    T  + Y+SC  G C  +R Y +G + L
Sbjct  119  VGPCEIWLDDNKVLSEDDCYSKYGNPNQDV-ITTFPVDYSSCNNGGCKEMRCYCLGFQGL  177

Query  173  KNKWSWQVYKECVPI  187
             +K  WQ YK C+P+
Sbjct  178  VDKTVWQSYKNCIPL  192

>PHYCA_12943
Length=287

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 79/182 (43%), Gaps = 34/182 (19%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLRAF  79
             +AH ++  P  TF +    V W  +  ++N      G      F    K KG       
Sbjct  22   ANAHGNLKQPEATFKDGAPTVEW--VTLVDNYWDIGSGGDQVGKFKTMAKEKGMSVKDVV  79

Query  80   MDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTI------RSTGYTHDGPCEVWLDNTK  133
            +D  K  K         CGYT  +   QPIP+  I         G+TH GPCE+++D+  
Sbjct  80   LDMVKDKK---------CGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKM  130

Query  134  VMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            V+ G +C  +FPG           S+ ++SC G CTL  YW+  +  +    WQ Y  CV
Sbjct  131  VLHGDDCEDEFPGGPDGSDKMSEMSVDFSSCNGKCTLTIYWLAFQNEQ----WQSYVNCV  186

Query  186  PI  187
            P+
Sbjct  187  PL  188

>PYAR_24113
Length=192

 Score = 83.2 bits (204),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 81/175 (46%), Gaps = 21/175 (12%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT--------TADFNGYIKSKGYKTLR  77
            DAH  +I PAP +T    N     +  L+    KT         A FN   K+  YK+L+
Sbjct  20   DAHSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLK  79

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKR-QPIPAGTIRSTGYT--HDGPCEVWLDNTKV  134
              +   +     +AGA  ECG+  ++G   QP+P   +    +T  H GPCEVW DN   
Sbjct  80   ELVLQNQKV---SAGATAECGFATLSGATPQPLP-DVVEWDEFTGSHTGPCEVWCDNNLA  135

Query  135  MSGTNCNKDFPGKTHSISYA--SCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                NC+K+  G    ++Y   +C G+  L  YW+ L   +    WQVY  C P+
Sbjct  136  FQDDNCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALHTAE----WQVYTGCAPL  186

>PITG_04949
Length=337

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (47%), Gaps = 24/180 (13%)

Query  25   VDAHQSVILPAPTFTNPDKN---VYWNPL---AFLENQGYK-TTADFNGYIKSKGYKTLR  77
            V AH  +  PAP++     N   V   P     + E++G +   A F        +K +R
Sbjct  21   VQAHGYIAKPAPSWKASKTNNWVVEIEPQWKGGWDESKGDEGLLATFKELAPKNNFKDVR  80

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGK-RQPIPAGTIR-STGYTHDGPCEVWLDNTKVM  135
            + MD    +         ECG+T+  GK  +P   GT   S G  H GPCE+WLD+  V+
Sbjct  81   SLMDGNPVF-------GEECGFTDPKGKPSEPPSDGTATFSRGIVHAGPCEIWLDDKMVL  133

Query  136  SGTNCNKDFPGKTHS-------ISYASCK-GSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +   T         + Y+SC  G C LR+YW+ L+ LK K  WQ YK C+P+
Sbjct  134  QNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRLKGKTVWQAYKNCIPL  193

>PHYCA_534296
Length=309

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 66/134 (49%), Gaps = 17/134 (13%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTH  121
            F     +  +K L+  MDD   Y  D       CG+TN +G  QPIP       S    H
Sbjct  40   FKSLKSANNFKDLKTLMDDTSVYGAD-------CGFTNPSGTAQPIPTDGKATFSRALVH  92

Query  122  DGPCEVWLDNTKVMSGTNCNKDFPGKTHSI------SYASC-KGSC-TLRWYWMGLRFLK  173
             GPCE+WLD+TKV+   +C   +  +   I       Y+SC  G C  +R+YW+  + + 
Sbjct  93   VGPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVD  152

Query  174  NKWSWQVYKECVPI  187
             K  WQ YK+C+P+
Sbjct  153  GKTVWQSYKDCIPL  166

>PPTG_03139
Length=320

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 69/138 (50%), Gaps = 19/138 (14%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANF--ECGYTNINGKRQPIPAGTIR---  115
            TA+FN    +  Y +L+ FM DK          +F  ECGYTN +   QP+P   +    
Sbjct  66   TANFNKGFAASKYSSLKEFMTDKMVL----VSKDFTKECGYTNPDETPQPVPETYVEWSH  121

Query  116  --STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGL  169
                G+T  H+GPCEVW D+T+V    NC K+FP     + Y   +C GS  L  YW+ L
Sbjct  122  GSGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIAL  181

Query  170  RFLKNKWSWQVYKECVPI  187
                +  SWQVY  C  +
Sbjct  182  ----HSPSWQVYINCAAL  195

>PHYRA_73582
Length=326

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 83/182 (46%), Gaps = 29/182 (16%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIK-------SKGYKTLR  77
            V AH  +  PAPT+   + N +   +A L   G+  +   +G +        +  YK L+
Sbjct  21   VQAHGYIANPAPTWKKEETNDWVVEIAPLWKGGWDESKGDDGILAVFKELSATNNYKDLK  80

Query  78   AFMDDKKAYKVDAAGANF--ECGYTNINGKRQPIPA-GTIR-STGYTHDGPCEVWLDNTK  133
              MD          G  F  +CG+T+ NG     P  GT   S G  H GPCE+WLD+  
Sbjct  81   TLMD----------GPEFGEDCGFTDPNGTPSDPPTDGTATFSRGIVHAGPCEIWLDDKM  130

Query  134  VMSGTNCNKDFPGKTHS-------ISYASCK-GSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            V+   +C   +   T         + Y+ C  G C LR+YW+ L+ L  K  WQ YK C+
Sbjct  131  VLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDGKAVWQSYKNCI  190

Query  186  PI  187
            P+
Sbjct  191  PL  192

>PYU1_G001514
Length=469

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 16/124 (13%)

Query  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPC  125
            YK++RA +D K  ++    G + +CG T+  G +QP+PA  +      S G+T  H GPC
Sbjct  83   YKSMRALVDAKGVFQ---PGMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGPC  139

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            EVW DNT+V    NC KD+      + Y  + C G+  L+ YW+ L    +  +WQ Y  
Sbjct  140  EVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLAL----HSSTWQAYIN  195

Query  184  CVPI  187
            C P+
Sbjct  196  CAPL  199

>PYIR_25999
Length=344

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 85/183 (46%), Gaps = 29/183 (16%)

Query  24   SVDAHQSVILPAPTFT----------NPDKNVYWNP--LAFLENQGYKTTADFNGYIKSK  71
            +VDAH S+ +P PTFT            D +    P  ++F  +    T A F   IK+ 
Sbjct  23   AVDAHGSMSIPKPTFTIQGDTTQFAGTVDSSALTAPAGMSFTTDPESNTKA-FTAAIKTS  81

Query  72   GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGP  124
             YK++R  ++ K    V  AGA  +CG T+  G  QP+PA  +      S G+T  H GP
Sbjct  82   AYKSVRDLINAKG---VMMAGATKQCGITSATGTPQPLPAKYVEWSHGASEGFTPSHQGP  138

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CEVW D+    +  NC K++P       I ++ C G   L   W+ L    +  +WQ Y 
Sbjct  139  CEVWCDDALAFTNDNCAKNYPAAPAELPIDHSKCVGKKLLTMIWLAL----HSPTWQAYI  194

Query  183  ECV  185
             C 
Sbjct  195  NCA  197

>PHYSO_483955
Length=320

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 81/180 (45%), Gaps = 24/180 (13%)

Query  25   VDAHQSVILPAPTFTNPDKN---VYWNPL---AFLENQGYK-TTADFNGYIKSKGYKTLR  77
            V AH  +  P P++ +   N   V   P     + E++G +   A F     +  YK +R
Sbjct  21   VQAHGYIAKPEPSWKDKKTNDWVVEIEPQWKGGWDESKGDEGLLATFKELSAANNYKDVR  80

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGK--RQPIPAGTIRSTGYTHDGPCEVWLDNTKVM  135
            + MD    Y  D       CG+T+  GK    P       S G  H GPCE+WLD+  V+
Sbjct  81   SLMDGNPVYGED-------CGFTDPKGKPVAPPTDGTATFSRGIVHAGPCEIWLDDKMVL  133

Query  136  SGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C   +   T         + Y+SC  G C LR+YW+ L+ L  K  WQ YK C+P+
Sbjct  134  QNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRLDGKTVWQAYKNCIPL  193

>SPRG_07826
Length=371

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 82/185 (44%), Gaps = 28/185 (15%)

Query  23   SSVDAHQSVILPAPTFTNP-----------DKNVYWNPLAFLENQGYKTTADFNGYIKSK  71
            S V AH  +  P PTF  P           D        A+ ++ GY   A F    K+ 
Sbjct  15   SQVAAHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGYNA-AQFAANFKTS  73

Query  72   GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKR-QPIPA------GTIRSTGYTHDGP  124
             YKTL+AF+D       D +    +CG T ++    QP+P+      G       +H+GP
Sbjct  74   KYKTLKAFLD-----AWDTSAQCGQCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGP  128

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            CE+W D T+V    +C K+ P  +  I  + C G+  L   WM L   +    WQ YK C
Sbjct  129  CELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNC  184

Query  185  VPIGS  189
            V IGS
Sbjct  185  VAIGS  189

>PYU1_G001527
Length=278

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 16/125 (13%)

Query  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPC  125
            YK++RA +D K  ++    G N ECG T+  G++QP+PA  +      S G+T  H GPC
Sbjct  83   YKSVRALVDAKGVFQ---PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPC  139

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            EVW DN    S  NC  ++P     + +  + C G   L++YW+ L    +  +WQ Y  
Sbjct  140  EVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTWQAYIA  195

Query  184  CVPIG  188
            C P+ 
Sbjct  196  CAPLA  200

>PYU1_G001523
Length=278

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 66/125 (53%), Gaps = 16/125 (13%)

Query  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPC  125
            YK++RA +D K  ++    G N ECG T+  G++QP+PA  +      S G+T  H GPC
Sbjct  83   YKSVRALVDAKGVFQ---PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPC  139

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            EVW DN    S  NC  ++P     + +  + C G   L++YW+ L    +  +WQ Y  
Sbjct  140  EVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLAL----HSSTWQAYIA  195

Query  184  CVPIG  188
            C P+ 
Sbjct  196  CAPLA  200

>PHYSO_340333
Length=284

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 80/181 (44%), Gaps = 25/181 (14%)

Query  24   SVDAHQSVILPAPTFTNPDKNVY-------WNPLAFLENQGYKTTADFNGYIKSKGYKTL  76
            S DAH  +++P   F     + +       W    +  N      A F     +  +K L
Sbjct  20   SADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDA-FKALKTANNFKDL  78

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKV  134
            +  MDD   Y  D       CG+T+ NG  QPIP       S    H GPCE+WLD+ KV
Sbjct  79   KTLMDDTSVYGAD-------CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKV  131

Query  135  MSGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVP  186
            +   +C   +  +   I       Y+SC  G C  +R+YW+  + +  K  WQ YK+C+P
Sbjct  132  LYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIP  191

Query  187  I  187
            +
Sbjct  192  L  192

>SPRG_07825
Length=337

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 82/185 (44%), Gaps = 28/185 (15%)

Query  23   SSVDAHQSVILPAPTFTNP-----------DKNVYWNPLAFLENQGYKTTADFNGYIKSK  71
            S V AH  +  P PTF  P           D        A+ ++ GY   A F    K+ 
Sbjct  15   SQVAAHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPGY-NAAQFAANFKTS  73

Query  72   GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKR-QPIPA------GTIRSTGYTHDGP  124
             YKTL+AF+D       D +    +CG T ++    QP+P+      G       +H+GP
Sbjct  74   KYKTLKAFLD-----AWDTSAQCGQCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGP  128

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            CE+W D T+V    +C K+ P  +  I  + C G+  L   WM L   +    WQ YK C
Sbjct  129  CELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQ----WQAYKNC  184

Query  185  VPIGS  189
            V IGS
Sbjct  185  VAIGS  189

>PHYRA_78176
Length=312

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 67/138 (49%), Gaps = 15/138 (11%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----  115
            TA F    +S  Y +L+ F+DDK    V    A   CG  + +   QP+P   +      
Sbjct  67   TAAFTTAFESSSYSSLKEFIDDKATITV--TDATLTCGACDPDETAQPLPETYVEWAHSD  124

Query  116  STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRF  171
            S G+T  H+GPCEVW D+ +V    +C  DF      + Y   +C GS  L +YW+ L  
Sbjct  125  SEGFTASHEGPCEVWCDDVRVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLAL--  182

Query  172  LKNKWSWQVYKECVPIGS  189
              +  +WQVY  C P+ S
Sbjct  183  --HSSTWQVYVNCAPLES  198

>PHYRA_77971
Length=230

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 81/177 (46%), Gaps = 25/177 (14%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD-DKK  84
            +AH  +  P PTF +    V W     ++   Y      +G  +   YKT+ A      +
Sbjct  21   EAHGHLDQPQPTFQDGASTVNW----VVQIDNYWDIG--SGGDQVGKYKTMAAEKGVSVR  74

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGTIR------STGYTHDGPCEVWLDNTKVMSGT  138
               +D  GA+ +CG+T  +   QP+P             GYTH GPCE+++D+  V+   
Sbjct  75   DVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSD  134

Query  139  NCNKDFPGKTHS--------ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            NC  D+PG  +         + Y+SC G CT   YW+G +  +    WQ Y  CVP+
Sbjct  135  NCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

>PHYRA_86752
Length=300

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 80/184 (43%), Gaps = 34/184 (18%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S  DAH ++  P  TF +    V W  +  ++N      G      +      K      
Sbjct  18   SHADAHGNLKEPEATFEDGAPTVEW--VTLIDNYWDIGSGGDQVGKYKTMAAEKKMSVRD  75

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDN  131
              +D  K  K         CGYT  +   QPIP  G ++       G+TH GPCE+++D+
Sbjct  76   VVLDMVKDKK---------CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDD  126

Query  132  TKVMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            T V+ G +C +++PG            + Y+SC G CTL  YW+  +  +    WQ Y  
Sbjct  127  TMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVN  182

Query  184  CVPI  187
            CVP+
Sbjct  183  CVPL  186

>PHYSO_340332
Length=295

 Score = 83.6 bits (205),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 80/181 (44%), Gaps = 25/181 (14%)

Query  24   SVDAHQSVILPAPTFTNPDKNVY-------WNPLAFLENQGYKTTADFNGYIKSKGYKTL  76
            S DAH  +++P   F     + +       W    +  N      A F     +  +K L
Sbjct  20   SADAHGYMLIPESQFKGSATSAWIVQIDPVWTSNDWDGNNAGSVDA-FKALKTANNFKDL  78

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKV  134
            +  MDD   Y  D       CG+T+ NG  QPIP       S    H GPCE+WLD+ KV
Sbjct  79   KTLMDDTSVYGAD-------CGFTDPNGTPQPIPTDGKATFSRAIVHVGPCEIWLDDKKV  131

Query  135  MSGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVP  186
            +   +C   +  +   I       Y+SC  G C  +R+YW+  + +  K  WQ YK+C+P
Sbjct  132  LYEDDCFSKYGNENQDIKSVFPVDYSSCDNGGCKEMRFYWLAFQGVDGKTVWQSYKDCIP  191

Query  187  I  187
            +
Sbjct  192  L  192

>PHYRA_85794
Length=230

 Score = 82.4 bits (202),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 81/177 (46%), Gaps = 25/177 (14%)

Query  26   DAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMD-DKK  84
            +AH  +  P PTF +    V W     ++   Y      +G  +   YKT+ A      +
Sbjct  21   EAHGHLNQPQPTFQDGASTVNW----VVQIDNYWDIG--SGGDQVGKYKTMAAEKGVSVR  74

Query  85   AYKVDAAGANFECGYTNINGKRQPIPAGTIR------STGYTHDGPCEVWLDNTKVMSGT  138
               +D  GA+ +CG+T  +   QP+P             GYTH GPCE+++D+  V+   
Sbjct  75   DVVLDMVGADKKCGFTRTDVDPQPVPTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSD  134

Query  139  NCNKDFPGKTHS--------ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            NC  D+PG  +         + Y+SC G CT   YW+G +  +    WQ Y  CVP+
Sbjct  135  NCQGDYPGGPNDSGIMSEMPVDYSSCNGDCTFSIYWLGFQNAQ----WQAYINCVPL  187

>PYAP_22462
Length=210

 Score = 81.6 bits (200),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 87/187 (47%), Gaps = 38/187 (20%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPL----AFLENQGYK-------TTADFNGYIKSKGY  73
            VDAH  + LP  ++ N      +N +    A+   QG+K        T  F    ++ G+
Sbjct  27   VDAHGYISLPRASYANSYTKTGYNSILTASAYPAFQGFKWNGSPEDNTKAFTEGFRAGGF  86

Query  74   KTLRAFMDDKK---------AYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGP  124
             +LRA +D               VD +G +      +  GK      G I S    H GP
Sbjct  87   SSLRALLDPAAPGCGNSRTDVAPVDVSGLSVMQFQNDEEGK------GFITS----HHGP  136

Query  125  CEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKG--SCTLRWYWMGLRFLKNKWSWQV  180
            CE W+DNT+V  G +C   F G   T  I+YA+C    +C L +YW+ L    ++ +WQV
Sbjct  137  CEAWIDNTRVFHGDDCRAQFTGYPATIPINYAACPSGQTCVLTFYWLAL----HEANWQV  192

Query  181  YKECVPI  187
            YK+CVPI
Sbjct  193  YKQCVPI  199

>PHYRA_78175
Length=319

 Score = 83.6 bits (205),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 68/138 (49%), Gaps = 19/138 (14%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANF--ECGYTNINGKRQPIPAGTIR---  115
            TA+FN    +  Y +L+ FM DK           F  ECGYTN +   QP+P   +    
Sbjct  66   TANFNKGFAASKYSSLKEFMADKLVL----VNKEFTKECGYTNPDEAAQPVPKTYVEWSH  121

Query  116  --STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGL  169
                G+T  H+GPCEVW D+T+V    NC K+FP     + Y   +C GS  L  YW+ L
Sbjct  122  GDGEGFTASHEGPCEVWCDDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIAL  181

Query  170  RFLKNKWSWQVYKECVPI  187
                +  SWQVY  C  +
Sbjct  182  ----HSASWQVYINCAAL  195

>PHYKE_2937
Length=366

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 63/130 (48%), Gaps = 18/130 (14%)

Query  69   KSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPC  125
             S GY  +R  +D D   Y  D       CGYTN     K  P       S G  H GPC
Sbjct  78   SSNGYSDIRTLLDSDTSLYGAD-------CGYTNPDATAKDPPTTGDATFSRGMVHVGPC  130

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFLKNKWS  177
            E+WLD+T V+S  +C   +   T         + Y+SC  S C LR+YW+  + + +   
Sbjct  131  EIWLDDTMVLSNDDCMTAYGDGTQDTASVFTPVDYSSCSSSGCMLRFYWLAFQGVDSSMV  190

Query  178  WQVYKECVPI  187
            WQVYK+CVP+
Sbjct  191  WQVYKDCVPL  200

>SDRG_00972
Length=333

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 82/185 (44%), Gaps = 28/185 (15%)

Query  23   SSVDAHQSVILPAPTFTNP-----------DKNVYWNPLAFLENQGYKTTADFNGYIKSK  71
            S V AH  +  P PTF  P           D        A+ ++ GY   A F    K+ 
Sbjct  14   SQVAAHGGLFDPKPTFIEPNSDPTRFCGTIDGPTSLPGSAYNQDPGY-NAAQFAANFKAS  72

Query  72   GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKR-QPIPA------GTIRSTGYTHDGP  124
             YKTL+AF+D       D +    +CG T ++    QP+P+      G       +H+GP
Sbjct  73   KYKTLKAFLD-----AWDTSAQCGQCGITKVDAANPQPLPSIVKWRHGDNEGFTPSHEGP  127

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            CE+W D T++    +C K+ P  +  I  + C G+  L   WM L   +    WQ YK C
Sbjct  128  CELWCDETRLYYNDDCAKNIPDGSMPIDTSKCSGAKQLTMLWMALHTPQ----WQAYKNC  183

Query  185  VPIGS  189
            V IGS
Sbjct  184  VAIGS  188

>PYU1_G007364
Length=316

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 91/186 (49%), Gaps = 36/186 (19%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLE-------NQGYKTTAD-FNGYIKSKG-Y  73
            S+V+AH  + +P   F+  D  +  N +A ++       N   +   D F    ++ G Y
Sbjct  32   SAVNAHGYITVPMAEFS--DGAMKTNFIAKMDPAFPGKFNDNPQANVDTFTKAFQASGKY  89

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRS-------TGY--THDGP  124
             +LR  +           G   +CG T ++   +PIP+  + S        G+  +H GP
Sbjct  90   ASLRDLLQ----------GHGEDCGNTKLDATPKPIPSDGMVSWQNPDTNEGFVPSHTGP  139

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CE+WLD+T V+   NC   FPG      + ++SC G C +R+YW+ L+    + +WQ+YK
Sbjct  140  CEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----EPAWQIYK  195

Query  183  ECVPIG  188
             C+P+ 
Sbjct  196  NCIPLA  201

>SDRG_16534
Length=320

 Score = 83.2 bits (204),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 58/177 (33%), Positives = 80/177 (45%), Gaps = 27/177 (15%)

Query  24   SVDAHQSVILPAPTFTN----PDK-NVYWNPLAFLENQGYKTTAD-----FNGYIKSKGY  73
            SV  H  ++ P P FT+    P K     N    L    Y+   D     F  + K+  +
Sbjct  17   SVVGHGHLVDPVPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSF  76

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-----THDGPCEVW  128
            KTL+AF+D   AY         +CG T+ NG  QP+P+    + G      +H GPCE+W
Sbjct  77   KTLKAFLD---AYPTGG-----DCGITDSNGPAQPLPSTVKWANGQEGFISSHQGPCELW  128

Query  129  LDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
             D T+V    NC  + P    SI  + C G+  L   W+ L   +    WQVYK CV
Sbjct  129  CDETRVFQDDNCAANVPDGFMSIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCV  181

>PYAR_18165
Length=261

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 63/113 (56%), Gaps = 10/113 (9%)

Query  81   DDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT--HDGPCEVWLDNTKVMSGT  138
            D+ K+    A G+  +CG TN N   QP P+  + +   +  H GPCE+WLD+TKV+S T
Sbjct  55   DEVKSLLEKAGGS--KCGKTNANAAVQPAPSDGVVAFAISAQHIGPCEIWLDDTKVVSAT  112

Query  139  NCNKDFPGKTHSISYASC--KGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            +C K FP K   + ++ C  K SC LRW WM      +   W+ Y  CV +G+
Sbjct  113  DCWKQFPDKRIPVDFSKCANKASCELRWIWMA----THTSPWEFYDNCVRVGT  161

>PYAR_20617
Length=254

 Score = 82.0 bits (201),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 76/168 (45%), Gaps = 18/168 (11%)

Query  26   DAHQSVILPAPTFTNP---DKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
            DAH  V L  P    P    K+ +           +KT A +    K++G   LR F++D
Sbjct  20   DAHAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLED  79

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT--HDGPCEVWLDNTKVMSGTNC  140
            K             CG +  +   + IPA    S   T  H GPCEVW D+       +C
Sbjct  80   KGPV----------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDC  129

Query  141  NKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             K F   T  ++ ++ C GSC LR+YW+GL+    +  WQ YK CVP+
Sbjct  130  EKTFGSATSFAVDFSKCSGSCLLRFYWLGLQDGGKR--WQSYKNCVPL  175

>SPRG_07797
Length=318

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 81/180 (45%), Gaps = 35/180 (19%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKT--------------TADFNGYIKS  70
            V  H  ++ P P FT  DK  Y +P  F       T              T +F  + K+
Sbjct  18   VVGHGHLVDPVPAFT--DK--YGDPTKFAATLDGPTVLPGSTYGQGPDWNTDEFTKHFKA  73

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-----THDGPC  125
              +KTL+AF+D        A  +  +CG T+ NG  QP+P+    + G      +H GPC
Sbjct  74   SSFKTLKAFLD--------AHPSGGDCGITDANGPAQPLPSTVKWANGQEGFISSHQGPC  125

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            E+W DN +V    NC  ++P    SI  + C G+  L   W+ L   +    WQVYK CV
Sbjct  126  ELWCDNMRVFHDNNCAANYPNGHMSIDPSKCSGAKRLTMLWLALHSPQ----WQVYKNCV  181

>PPTG_14221
Length=275

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 81/181 (45%), Gaps = 25/181 (14%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYW----NPL---AFLENQGYKTTADFNGYIKSKGYKTL  76
            SV+AH  +++P   F     N  W    +P+      +    K+   F     +  +K L
Sbjct  20   SVEAHGYMLIPESQFKG-SANSAWIVQIDPVWASDKWDGNNPKSVDTFKSLKAANNFKDL  78

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKV  134
            +  MDD   Y  D       CG+TN NG  QPIP       S    H GPC +WLD+  V
Sbjct  79   KTLMDDTSVYGAD-------CGFTNPNGTPQPIPTDGKATFSRALVHHGPCGIWLDDKMV  131

Query  135  MSGTNCNKDFPGKTHSI------SYASCK-GSC-TLRWYWMGLRFLKNKWSWQVYKECVP  186
            +   +C   +  +   I       Y+SC  G C  +R+YW+  + L  K  WQ YK+C+P
Sbjct  132  LYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAFQGLNKKTVWQSYKDCIP  191

Query  187  I  187
            +
Sbjct  192  L  192

>PYAP_19707
Length=241

 Score = 81.6 bits (200),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 55/104 (53%), Gaps = 7/104 (7%)

Query  87   KVDAAGANFECGYTNINGKRQPIPAGTIRS--TGYTHDGPCEVWLDNTKVMSGTNCNKDF  144
            K  A  A  +CG T+ N   QPIP   + +      H GPCEVWLDNTKV S   C K+F
Sbjct  59   KALAETAGSKCGKTDANAPVQPIPTDGVLTFDISAVHIGPCEVWLDNTKVASAKECWKEF  118

Query  145  PGKTHSISYASCK-GSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            P K   + +A CK GSC LRW WM      +   W+ +  CV +
Sbjct  119  PNKRIKVDFAKCKSGSCQLRWVWMAT----HTSPWEFFDNCVRV  158

>PITG_04948
Length=232

 Score = 81.3 bits (199),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 62/129 (48%), Gaps = 18/129 (14%)

Query  70   SKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPCE  126
            S   K +R  +D D   Y  D       CGYTN  ++ K  P       S G  H GPCE
Sbjct  73   SNNAKDIRTLLDSDTSLYGAD-------CGYTNPDVSPKDPPTDGTATFSRGIVHAGPCE  125

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSW  178
            +WLD+  V+   +C   +   T         + Y+SC  G C LR+YW+ L+ L  K  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTYW  185

Query  179  QVYKECVPI  187
            QVYK C+P+
Sbjct  186  QVYKNCIPL  194

>PHYCA_531163
Length=314

 Score = 82.8 bits (203),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 67/138 (49%), Gaps = 18/138 (13%)

Query  61   TADFNGYIKSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTNING--KRQPIPAGTIRST  117
            T+ +     S GY  +R  +D D   Y  D       CGYTN +   K  P       S 
Sbjct  66   TSVYTSLKSSNGYSDIRTLLDSDTSLYGAD-------CGYTNADATAKDPPSTGDATFSR  118

Query  118  GYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGL  169
            G  H GPCE+WLD+T V+S  +C   +   T         + Y+SC  S C LR+YW+  
Sbjct  119  GMVHVGPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAF  178

Query  170  RFLKNKWSWQVYKECVPI  187
            + + +   WQVYK+CVP+
Sbjct  179  QGVDSAIVWQVYKDCVPL  196

>PYU1_G001520
Length=379

 Score = 83.2 bits (204),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 81/181 (45%), Gaps = 29/181 (16%)

Query  28   HQSVILPAPTFT----------NPDKNVYWNP--LAFLENQGYKTTADFNGYIKSKGYKT  75
            H S+ +P PTF             D      P  ++F  +    T A F   +K+  YK+
Sbjct  27   HGSMSVPKPTFAIQGDTTQFGLTVDSTALTAPSGMSFTTDPESNTKA-FTAALKASSYKS  85

Query  76   LRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPCEVW  128
            ++  +    A  V  AGAN ECG T   G +QP+P   +        G+T  H GPCEVW
Sbjct  86   VKDLI---AAKGVPIAGANKECGITTSTGTKQPLPDKFVEWSHGSGEGFTPSHQGPCEVW  142

Query  129  LDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVP  186
             DNT V S  NC K++P     + Y  + C G   L+  W+ L    +  +WQ Y  C  
Sbjct  143  CDNTLVFSDDNCAKNYPAAPAQLPYEKSKCVGKSVLKTVWLAL----HSPTWQAYISCAA  198

Query  187  I  187
            +
Sbjct  199  L  199

>SDRG_16535
Length=313

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 79/178 (44%), Gaps = 25/178 (14%)

Query  25   VDAHQSVILPAPTFT--NPDKNVYWNPL---AFLENQGYK-----TTADFNGYIKSKGYK  74
            V+ H  +I P PTF   N D+  Y   +     L    Y       T  F    ++  ++
Sbjct  15   VNGHGFLINPTPTFNELNGDRTKYCGTIDGPVVLPGSSYNQDPAWNTRQFTMQFRASKFQ  74

Query  75   TLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-----THDGPCEVWL  129
            TL +F+DD              CG TN NG  QP+P+    + G      +H+GPCEVW 
Sbjct  75   TLASFVDDPSFAPCGT------CGITNANGAPQPLPSVLKWANGQEGFVASHEGPCEVWC  128

Query  130  DNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            D+T+V    NC  +      SI    C G+  LR  W+ L    +  SWQVY  CVP+
Sbjct  129  DSTRVFQNDNCAANHLSGLLSIDTTRCAGAKQLRLLWLAL----HTPSWQVYINCVPL  182

>SPRG_07795
Length=335

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 80/177 (45%), Gaps = 27/177 (15%)

Query  24   SVDAHQSVILPAPTFTN----PDK-NVYWNPLAFLENQGYKTTAD-----FNGYIKSKGY  73
            SV  H  ++ P P FT+    P K     N    L    Y+   D     F  + K+  +
Sbjct  17   SVVGHGHLVDPLPAFTDKYGDPSKFAATLNGPTVLPGSSYEQGPDWNTDQFTKHFKASSF  76

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-----THDGPCEVW  128
            KTL+AF+D        A     +CG T+ NG  QP+P+    + G      +H GPCE+W
Sbjct  77   KTLKAFLD--------AHPTGGDCGITDPNGPAQPLPSTVKWANGELGFISSHQGPCELW  128

Query  129  LDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
             D T+V    NC  ++P    +I  + C G+  L   W+ L   +    WQVYK CV
Sbjct  129  CDETRVFQDENCAANYPDGFMAIDTSKCSGAKRLTMLWLALHTPE----WQVYKNCV  181

>PYIW_25463
Length=216

 Score = 80.9 bits (198),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 65/122 (53%), Gaps = 15/122 (12%)

Query  72   GYKTLRAFMDDKKA----YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEV  127
            GYK+L+  MD +       + D A  +   G +++  +      G + S    H GPCE 
Sbjct  78   GYKSLKELMDKQVPGCGFSRTDIAAVDVS-GMSSMKFQNNEYKEGFLGS----HHGPCEG  132

Query  128  WLDNTKVMSGTNCNKDFPGKTHSI--SYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            W+DNTKV    +C K +PG   +I  SYA+CKG+C L +YW+ L   K    WQ YK CV
Sbjct  133  WIDNTKVFHSDDCVKSYPGYPANIPMSYAACKGTCRLTFYWLALHSQK----WQAYKHCV  188

Query  186  PI  187
            PI
Sbjct  189  PI  190

>PYU1_G001526
Length=334

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 16/124 (13%)

Query  73   YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGPC  125
            YK++RA +D K  ++    G N ECG T+  G++QP+PA  +      S G+T  H GPC
Sbjct  83   YKSVRALVDAKGVFQ---PGMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPC  139

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            EVW DN    S  NC  ++P     + +  + C G   L++YW+ L       +WQ Y  
Sbjct  140  EVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIA  195

Query  184  CVPI  187
            C P+
Sbjct  196  CAPL  199

>CCA17179
Length=185

 Score = 79.7 bits (195),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 66/140 (47%), Gaps = 27/140 (19%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--------  112
            TA F     S  ++ LR F+ DK  Y          CG TN N + +PIPA         
Sbjct  34   TATFLNAFASSPFQNLRDFLKDKGPY----------CGSTNPNAQPKPIPADHAIVWENP  83

Query  113  -TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDF---PGKTHSISYASCKGSCTLRWYWMG  168
             T      +H GPCEVWL+  +V    NC + F   P +   I +++C   C L+++W+ 
Sbjct  84   DTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARI-PIDFSTCTNGCLLQFFWLA  142

Query  169  LRFLKNKWSWQVYKECVPIG  188
            L     +  WQVYK C+PI 
Sbjct  143  LH----EPQWQVYKNCIPIA  158

>PYU1_G005868
Length=267

 Score = 81.3 bits (199),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 69/137 (50%), Gaps = 29/137 (21%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY----  119
            F     S  YK+LR  +D           A  +CG+T  +G   P+   +++S  +    
Sbjct  66   FTTAFASSSYKSLREMLD----------SAVPDCGFTLTDGT--PVDVSSLKSMKWQNDQ  113

Query  120  -------THDGPCEVWLDNTKVMSGTNCNKDFPGKTHSI--SYASCKGSCTLRWYWMGLR  170
                   +H GPCE+W+D+TK+M   +C  D+      I   Y+ CKG C L +YW+ L 
Sbjct  114  EQKGFIDSHHGPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLAL-  172

Query  171  FLKNKWSWQVYKECVPI  187
               ++ +WQ+YK+CVPI
Sbjct  173  ---HEPNWQIYKQCVPI  186

>PHYSO_484051
Length=285

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 64/130 (49%), Gaps = 18/130 (14%)

Query  69   KSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTNING--KRQPIPAGTIRSTGYTHDGPC  125
            +S GY  +R  +D D   Y  D       CG+TN +   K  P       S    H  PC
Sbjct  74   ESNGYSDIRTLLDSDTSLYGAD-------CGFTNPDASPKDPPTTGDPTFSRCMVHASPC  126

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFLKNKWS  177
            E+WLD+T V+S  +C   +   T         + Y+SC  S C LR+YW+  + + +K  
Sbjct  127  EIWLDDTMVLSNDDCQTAYGDGTQETASVFTPVDYSSCSTSGCMLRFYWLAFQGVDSKMV  186

Query  178  WQVYKECVPI  187
            WQVYK+CVP+
Sbjct  187  WQVYKDCVPL  196

>PHYKE_7717
Length=568

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 40/44 (91%), Gaps = 0/44 (0%)

Query  144  FPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            FPGK ++I Y++CKG+CTLRWYW+G+RFLKN +SWQVYK C+P+
Sbjct  2    FPGKDYTIDYSACKGTCTLRWYWLGVRFLKNAYSWQVYKACIPL  45

>PYIR_23585
Length=240

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query  60   TTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-ST  117
            + ADF      KG+ T RAF++ +             CG T  N   +PIP+  T++ S 
Sbjct  58   SAADFAKTAPGKGFATTRAFLESRGP----------TCGNTLANASPKPIPSDNTVKFSR  107

Query  118  GYTHDGPCEVWLDNTKVMSGTNCNKDFPGK--THSISYASCKGSCTLRWYWMGLRFLKNK  175
               H GPCE+W+DNT+V    +C   F     T  I +++CKGSC LR+YW+GL+     
Sbjct  108  AIVHPGPCELWIDNTRVYHNDDCEAAFGSSIPTWKIDFSACKGSCMLRFYWLGLQ--DGG  165

Query  176  WSWQVYKECVPI  187
              +Q Y +C+ +
Sbjct  166  ARFQSYSKCLAL  177

>PHYCA_19611
Length=531

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 69/138 (50%), Gaps = 19/138 (14%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANF--ECGYTNINGKRQPIPAGTIR---  115
            TA+FN  + +  Y +L+ FM+DK           F  ECGYTN     QP+P   +    
Sbjct  273  TANFNKGMAASKYTSLKEFMNDKMVL----VNKEFTKECGYTNPKEAPQPVPKTYVEWSH  328

Query  116  --STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGL  169
                G+T  H+GPCEVW D+T+V    NC K+FP     + Y   +C GS  L  YW+ L
Sbjct  329  GDGEGFTQSHEGPCEVWCDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIAL  388

Query  170  RFLKNKWSWQVYKECVPI  187
                +  SWQVY  C  +
Sbjct  389  ----HSPSWQVYINCAAL  402

 Score = 34.3 bits (77),  Expect = 0.53, Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 49/129 (38%), Gaps = 30/129 (23%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYT  120
            TA F    ++  YK+L+  ++D               G T +  + Q            T
Sbjct  40   TAAFTKGFEASKYKSLKEVIND--------------LGKTKLRNRFQ----------RRT  75

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYA--SCKGSCTLRWYWMGLRFLKNKWSW  178
             +GP  V      +    NC  ++P     + Y   +C G+  L +YW+ L    +  +W
Sbjct  76   SNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLAL----HSSTW  131

Query  179  QVYKECVPI  187
            QVY  C  +
Sbjct  132  QVYTNCAAL  140

>PHALS_05392
Length=367

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 62/134 (46%), Gaps = 17/134 (13%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTH  121
            F     +  +K +R+ MD    Y  D       CGYT+ NG     P+      S G  H
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGED-------CGYTDPNGTPVAPPSNGEATFSRGIVH  202

Query  122  DGPCEVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASCKGS-CTLRWYWMGLRFLK  173
             GPCE+WLD+  V+   +C   +   T         + Y+SC    C LR+YW+ L+ L 
Sbjct  203  AGPCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLD  262

Query  174  NKWSWQVYKECVPI  187
             K  WQ YK C+P+
Sbjct  263  GKTVWQAYKNCIPL  276

>PHYRA_78161
Length=373

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 88/187 (47%), Gaps = 31/187 (17%)

Query  25   VDAHQSVILPAPTFTNP--DKNVYWNPLAFLENQGYKTTADFNG--------YIKSKG--  72
            V+ H  +  P  TFT    D   Y   +A +E+     T  FNG        + K+ G  
Sbjct  18   VNGHGYMTDPKVTFTAQAGDPTQY---IATIESTASGLTGTFNGAPSDNVAAFTKAFGSS  74

Query  73   -YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGP  124
             Y +L+ F++DK    V   GA   CG  +   + QP+P  T+      S G+T  H+GP
Sbjct  75   KYSSLKEFINDKATVTV--TGATLTCGSCDPKEEAQPMPKSTMEWSHSDSEGFTASHEGP  132

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CEVW D+ +     +C  ++P     + +   +C GS TL +YWM +    +  +WQVY 
Sbjct  133  CEVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAM----HSSTWQVYV  188

Query  183  ECVPIGS  189
             C P+ S
Sbjct  189  NCAPLAS  195

>PHYKE_6002
Length=197

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 80/168 (48%), Gaps = 20/168 (12%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPLAFL------ENQGYKTTADFNGYIKSKGYKTLRA  78
            V+AH  +++P   F     + +   +A +      +    ++   F+   K+  +  L+ 
Sbjct  21   VNAHGYMLIPESQFKGDKTSAWVVQIAPVWDSSDWDGNNPQSVTTFDSLKKANNFVDLKT  80

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--TIRSTGYTHDGPCEVWLDNTKVMS  136
             MDD   Y  D       CG+T+ +G  QPIP+      S    H GPCE+WLD+TK  S
Sbjct  81   LMDDTSVYGAD-------CGFTDPSGTPQPIPSDGKATFSRAMQHVGPCEIWLDSTKAFS  133

Query  137  GTNCNKDFPGKTHSISYASC-KGSC-TLRWYWMGLRFLKNKWSWQVYK  182
              NC      +T  + Y+SC  G C  +R+YW+  + L +K  WQ Y+
Sbjct  134  KDNCAD---METFPVDYSSCNSGGCKEMRYYWLAFQGLDSKTVWQSYR  178

>PHYRA_86016
Length=236

 Score = 80.5 bits (197),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 18/105 (17%)

Query  97   CGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDNTKVMSGTNCNKDFPG----  146
            CGYT  +   QPIP  G ++       G+TH GPCE+++D+T V+ G +C +++PG    
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  147  ----KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
                    + Y+SC G CTL  YW+  +  +    WQ Y  CVP+
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVNCVPL  122

>PPTG_07516
Length=294

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 82/184 (45%), Gaps = 35/184 (19%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S V+AH  +  P P++ +   NV W  +  ++N      G      F    K KG     
Sbjct  17   SRVEAHGYLEQPKPSWKD-KPNVGW--ITMVDNYWDIGSGGDQIGKFKAMAKEKGMSVKD  73

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDN  131
              +D  K  K         CG T  NG  QPIPA G ++       G+TH GPCE++LD+
Sbjct  74   VVLDMVKDQK---------CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDD  124

Query  132  TKVMSGTNCNKDFPGKTHS--------ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
              V+ G +C  +F G  +         + ++SC G C L  YW+  +  +    WQ Y  
Sbjct  125  KMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVN  180

Query  184  CVPI  187
            CVP+
Sbjct  181  CVPL  184

>PPTG_07520
Length=294

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 82/184 (45%), Gaps = 35/184 (19%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S V+AH  +  P P++ +   NV W  +  ++N      G      F    K KG     
Sbjct  17   SRVEAHGYLEQPKPSWKD-KPNVGW--ITMVDNYWDIGSGGDQIGKFKAMAKEKGMSVKD  73

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDN  131
              +D  K  K         CG T  NG  QPIPA G ++       G+TH GPCE++LD+
Sbjct  74   VVLDMVKDQK---------CGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDD  124

Query  132  TKVMSGTNCNKDFPGKTHS--------ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
              V+ G +C  +F G  +         + ++SC G C L  YW+  +  +    WQ Y  
Sbjct  125  KMVLHGDDCEDEFKGGPNGSKQTSDMPVDFSSCNGKCLLTIYWLAFQNAQ----WQTYVN  180

Query  184  CVPI  187
            CVP+
Sbjct  181  CVPL  184

>PYVX_14662
Length=540

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 68/143 (48%), Gaps = 19/143 (13%)

Query  55   NQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--  112
            NQG   T  +      KG   +R+ +DD   Y  D       CG+T+ +G  Q IP    
Sbjct  60   NQGSVDT--YKSLAAEKGVTEIRSLLDDTSIYGQD-------CGFTDPDGTAQDIPTDGK  110

Query  113  TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHS------ISYASC-KGSC-TLRW  164
               S G  H GPCE+WLD+T V+   +C   + G          + Y+SC  G C  +R+
Sbjct  111  ATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYSSCNSGGCKEMRF  170

Query  165  YWMGLRFLKNKWSWQVYKECVPI  187
            YW+  + +     WQVYK C+P+
Sbjct  171  YWLAFQGVDGDTVWQVYKNCIPL  193

>PYAP_24691
Length=145

 Score = 77.8 bits (190),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (66%), Gaps = 3/70 (4%)

Query  121  HDGPCEVWLDNTKVMSGTNCNKDFPGKTH-SISYASCKGSCTLRWYWMGLRFLKNKWSWQ  179
            H GPCE+W DNT+V   ++C K F   T   I Y+ CKG+C LR+YW+GL+    +  WQ
Sbjct  3    HPGPCEIWFDNTRVFFESDCEKRFGSATQFKIDYSKCKGNCLLRFYWLGLQDGGKR--WQ  60

Query  180  VYKECVPIGS  189
             YK CVPIG+
Sbjct  61   SYKNCVPIGN  70

>PHYKE_1913
Length=280

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 77/184 (42%), Gaps = 34/184 (18%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S  DAH  +  P PTF +    V W  +  +EN      G      +      KG     
Sbjct  18   SRADAHGHLKSPEPTFEDGAPTVEW--VTLIENYWDIGSGGDQVGKYKTMAAEKGMSVKD  75

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR------STGYTHDGPCEVWLDN  131
              +D  K         +  CGYT  +   +P+P+            G+TH GPCEV++++
Sbjct  76   VVLDMVK---------DKTCGYTLADADPKPVPSDGKAIWWGNGGGGFTHTGPCEVYIND  126

Query  132  TKVMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
              V+ G +C  ++PG            I Y+SC G CTL  YW+  +  +    WQ Y  
Sbjct  127  KMVLHGDDCEDEYPGGPDGSNKMSEMPIDYSSCNGDCTLTIYWLAFQNAQ----WQAYIN  182

Query  184  CVPI  187
            CVP+
Sbjct  183  CVPL  186

>PYIR_15187
Length=207

 Score = 79.3 bits (194),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 87/185 (47%), Gaps = 32/185 (17%)

Query  23   SSVDAHQSVILPAPTFTNP-DKNVYWNPLAFLENQGYK----------TTADFNGYIKSK  71
            S V+AH  + +P  ++TN   K  Y   L+   N  ++           T  F    ++ 
Sbjct  24   SQVEAHGYISVPQASYTNSYTKTSYSATLSQSVNPAFQGRKWNGSPEDNTQQFTAGFRAA  83

Query  72   GYKTLRAFMDDKKAYKVDAAG-ANFECGYTNINGKRQPIPAGTIRSTGY------THDGP  124
            GY +L+  +D        A G  N       ++  R  + A   R+  Y      +H GP
Sbjct  84   GYPSLKTLLDPA------APGCGNSRLDVPAVDVSR--LSAMEFRNDEYHEGFVSSHHGP  135

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSI--SYASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CEVW+DNT+     +C   FPG   SI  +++ CK  CTL +YW+ L    ++ +WQVYK
Sbjct  136  CEVWIDNTRAFHNDDCRALFPGFPASIPVNFSLCKDKCTLTFYWLAL----HEPTWQVYK  191

Query  183  ECVPI  187
            +CVPI
Sbjct  192  QCVPI  196

>PYIR_19612
Length=260

 Score = 80.1 bits (196),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 87/179 (49%), Gaps = 33/179 (18%)

Query  25   VDAHQSVILPAPTFTNPDKN------VYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            VDAH  +I P    TN   +      VY  P A      +K   +F    K KG+ TLR+
Sbjct  23   VDAHGYIISPKAQ-TNSKGHPGTFVIVYPPPWA----GSWKDPKNFATAAKEKGFATLRS  77

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT-IR-STGYTHDGPCEVWLDNTKVMS  136
            +++DK A           CG+T+ N   + IPA   +R S   +H GPCE+W+D+ +V  
Sbjct  78   YLEDKGA----------TCGFTDPNVAPRAIPADRKVRFSRDISHPGPCELWIDDKRVYQ  127

Query  137  GTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE------CVPI  187
              +C   F G   S  + +A C G C +R+YW+ L+    +  WQVY+       CVP+
Sbjct  128  NDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGTR--WQVYRSELTRDLCVPV  184

>SPRG_19917
Length=241

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 69/140 (49%), Gaps = 28/140 (20%)

Query  62   ADFNGYIKSKG-YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAG--------  112
            A+FN   K++  YKTLRA +D              +CG T  N  R+ IP+         
Sbjct  61   ANFNKAFKAQSKYKTLRALLDQHGP----------DCGNTLTNVARKEIPSNGKMTFQNP  110

Query  113  -TIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKG-SCTLRWYWM  167
             T      +H GPCEVWLDN +V    +C  +FP K  +   + Y+SC    C LR+YW+
Sbjct  111  DTGEGFILSHTGPCEVWLDNKRVFQNDDCATNFPAKPAANLPVDYSSCGAKGCMLRFYWI  170

Query  168  GLRFLKNKWSWQVYKECVPI  187
             L   +    WQVYK CVP+
Sbjct  171  ALHSPR----WQVYKNCVPL  186

>HYAP_01683
Length=336

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 15/128 (12%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAY---KVDAAGANFECGYTNI-NGKRQPIPAGTIRSTGY  119
            F     +KGYK+L AF+ + +     KVD       CG T   +  R  +PA  +  TG+
Sbjct  70   FTETFPTKGYKSLGAFILENQELFLPKVD-----LNCGLTVYKDSARSELPASELTYTGF  124

Query  120  THDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWS  177
            TH GPCEVW D+TKV+  ++C   +PGK  ++ Y  + C G+  +  YW+G+    +   
Sbjct  125  THPGPCEVWCDDTKVLFDSDCQTTYPGKPATMPYDKSKCAGANRMTIYWLGV----HGDP  180

Query  178  WQVYKECV  185
            WQVY +C+
Sbjct  181  WQVYIDCM  188

>PHYRA_84732
Length=265

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 84/182 (46%), Gaps = 29/182 (16%)

Query  25   VDAHQSVILPAPTFTNPDKNVYWNPL-------AF----LENQGYKTTADFNGYIKSKGY  73
             DAH  +  PA  F +P  + Y+          AF     ++     TA F     + GY
Sbjct  22   ADAHGYISKPAAQFVDPSTSTYYAKTITSDVNSAFGGLKWDDSPEANTAAFTSAFPNAGY  81

Query  74   KTLRAFMD----DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWL  129
             +LR  +D    D    + D +  +   G T +N +      G I S    H GPCEVW+
Sbjct  82   SSLRDMLDQQVTDCANTRTDVSPVDVS-GLTVLNWQNDQEQKGFIDS----HHGPCEVWI  136

Query  130  DNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            D+TKV    +C       +P    S  ++ C G CTLR+YW+ L    ++ +WQVYK+CV
Sbjct  137  DDTKVDHQDDCVATYGSGYPASV-SADFSKCSGDCTLRFYWLAL----HEPNWQVYKQCV  191

Query  186  PI  187
            P+
Sbjct  192  PV  193

>SPRG_07796
Length=322

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 80/178 (45%), Gaps = 25/178 (14%)

Query  25   VDAHQSVILPAPTFT--NPDKNVYWNPL---AFLENQGYK-----TTADFNGYIKSKGYK  74
             D H  +I P PTF   N D+  Y   +     L    Y       T  F    K+  ++
Sbjct  16   ADGHGFLINPTPTFNELNGDRTKYCGTIDGPTTLPGSSYNQDPAWNTLQFTTQFKASPFR  75

Query  75   TLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-----THDGPCEVWL  129
            TL AF+D +    V + G    CG TN  G  QP+P+    + G      +H+GPCEVW 
Sbjct  76   TLAAFVDSQN---VASCG---RCGITNAIGAAQPLPSVLKWANGQEGFVASHEGPCEVWC  129

Query  130  DNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            D+T+V    NC  +      SI    C G+  LR  W+ L    +  SWQVY  CVP+
Sbjct  130  DSTRVFQNDNCAANQQSGLLSIDTTLCAGAKQLRLLWLAL----HTPSWQVYINCVPL  183

>PYIR_26867
Length=163

 Score = 77.8 bits (190),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 13/130 (10%)

Query  50   LAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPI  109
            ++F  +    T A F   +K+  YK++RA +D K  +    +GAN +CG T+  G +QP+
Sbjct  33   MSFTTDPASNTKA-FTAALKASTYKSVRALVDAKGQF---ISGANKQCGVTSPTGDKQPL  88

Query  110  PAGTIR-----STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSC  160
            PA  +      + G+T  H GPCEVW D+    S  NC  ++P     + Y  + C G+ 
Sbjct  89   PAQYVEWAHSSTEGFTPSHQGPCEVWCDDKMAFSDENCATNYPTAPAKLPYDKSKCTGAS  148

Query  161  TLRWYWMGLR  170
             L+ YW+ L 
Sbjct  149  MLKIYWLALH  158

>PHYKE_2454
Length=374

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 16/135 (12%)

Query  62   ADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----S  116
            A F    K+  YK+L+A +DDK   K+  +GA   CG  + +   QP+P+ T+      S
Sbjct  65   ASFTKAFKASSYKSLKALIDDKA--KITVSGATLTCGSADPSAAAQPLPS-TLEWSHSDS  121

Query  117  TGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISYASC--KGSCTLRWYWMGLRFL  172
             G+T  H+GPCE W D+ +V    NC+ +FP     + Y S    G+  L +YW+ +   
Sbjct  122  EGFTPSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMHGP  181

Query  173  KNKWSWQVYKECVPI  187
                SWQVY  C  +
Sbjct  182  ----SWQVYVNCAAL  192

>PPTG_03153
Length=314

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 64/134 (48%), Gaps = 14/134 (10%)

Query  62   ADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT----IRST  117
            A F    +S  YK+L+A +DDK   K+   GA   CG  +     QP+PA        S 
Sbjct  64   AAFTKAFESSKYKSLKAVIDDKA--KIIVPGATLTCGIADPKATPQPLPAKVEWYHSESE  121

Query  118  GYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLK  173
            G+T  H+GPCEVW D  +V    NC   +      + Y  + C G+  L  YW+ +    
Sbjct  122  GFTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAM----  177

Query  174  NKWSWQVYKECVPI  187
            +  SWQVY  C P+
Sbjct  178  HGPSWQVYVNCAPL  191

>H257_11264
Length=282

 Score = 80.1 bits (196),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 83/180 (46%), Gaps = 28/180 (16%)

Query  27   AHQSVILPAPTFTNP--DKNVYWNPL---AFLENQGYK-----TTADFNGYIKSKGYKTL  76
            AH  ++ P PTF NP  D   Y   +     L  + Y       T +F   +K   + +L
Sbjct  23   AHGYLVDPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIEFTRQLKKSSFASL  82

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGY--THDGPCEVWL  129
            RAF+D +            ECG T  +G  + +P+ +       S G+  +H+GPCE+W 
Sbjct  83   RAFIDAQ-------GNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCELWC  135

Query  130  DNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            D T+V    NC ++ P     I+ + C+GS  L   W+ L   +    WQVYK CV + S
Sbjct  136  DATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVRLTS  191

>PHYRA_78172
Length=385

 Score = 81.3 bits (199),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 86/185 (46%), Gaps = 29/185 (16%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQ------------GYKTTADFNGYIKS  70
            S VDAH  + LPA TF N   N  +  +A +E+                T A +  +  S
Sbjct  20   SGVDAHGHLGLPAVTFPNSVDNTQF--IATIESSTSGFSGSFSGSPAANTEAFWTAFNSS  77

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT----IRSTGYT--HDGP  124
            K Y +++ F+ D    ++ A GAN ECG T+ N   QPIP         + G+T  H+GP
Sbjct  78   K-YSSIKEFVTDLG--QIVADGANIECGLTDPNETPQPIPDELEWTHSDTEGFTSSHEGP  134

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CE W D T+V   T+C   F      + Y  A C G+  L +YW+ L       +WQVY 
Sbjct  135  CEAWCDGTQVFHDTDCAAHFTTAPAKMPYDQAGCSGASRLTFYWLALH----SSTWQVYV  190

Query  183  ECVPI  187
             C  +
Sbjct  191  NCAAL  195

>PYAP_22257
Length=247

 Score = 79.3 bits (194),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 72/146 (49%), Gaps = 18/146 (12%)

Query  53   LENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-  111
             E + Y      N    ++ +K+ + F   K   +    G+   CG ++  GK Q +   
Sbjct  45   FEGRKYNNDPTSNVKAFTEAFKSQKTFKTLKDMVEKQLKGS---CGKSSGKGKPQSVEGL  101

Query  112  ------GTIRSTGY--THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCT  161
                   T   TG+  +H GPCE+W+D+T+VM   NC   F G      ++Y+ CKG C 
Sbjct  102  SDVHWENTEEKTGFVSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECM  161

Query  162  LRWYWMGLRFLKNKWSWQVYKECVPI  187
            LR+YW+ L    ++  WQVYK CVPI
Sbjct  162  LRFYWLAL----HEPEWQVYKNCVPI  183

>PYVX_20783
Length=276

 Score = 79.7 bits (195),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 83/178 (47%), Gaps = 25/178 (14%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKS-------KGYKT  75
            S    H ++I+P PT  +     Y  P   ++      +A +  Y ++        G  +
Sbjct  18   SQASGHGNIIVPQPTGDSDHVYYYGGPAGTIDMAEIIGSASYGDYYQAVDDWFTANGISS  77

Query  76   LRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA---GTIRSTGYTHDGPCEVWLDNT  132
            L+ ++    ++         ECG T  +G  QP+P+       + G +H GPCE+W D+T
Sbjct  78   LKEYITTYGSFD--------ECGNTEKDGTPQPVPSDGYAQHDTLGNSHPGPCEIWCDDT  129

Query  133  KVMSGTNCNKDFPGKTHS---ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            +V + TNC  +F G++ +   I  A+C GS    +YW+ L    +   WQVY  CV +
Sbjct  130  RVFTSTNCVTEFSGQSPAKIPIDVATCTGSSEFVFYWLAL----HAQPWQVYINCVAL  183

>PYU1_G005985
Length=200

 Score = 78.2 bits (191),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 83/182 (46%), Gaps = 30/182 (16%)

Query  25   VDAHQSVILPAPTFTNP-DKNVYWNPLAFLENQGYK----------TTADFNGYIKSKGY  73
            V+AH  + +P  T+ N   K  +   L    N  ++           T  F     + GY
Sbjct  21   VEAHGYISMPKATYANDYTKTSFVTTLTAAVNPAFQGKKWDGSPQENTQQFTSGFHAAGY  80

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY------THDGPCEV  127
             +L+A +D      V     N       +   R  + A   R+  +      +H GPCEV
Sbjct  81   SSLKALLD-----PVAPGCGNSRVDVPPVGVSR--LAAMEFRNDEFHEGFVNSHHGPCEV  133

Query  128  WLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECV  185
            W+DN ++  G +C   F G   T  ++++ C+G CTL +YW+ L    ++ +WQVYK+CV
Sbjct  134  WIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYWLAL----HEPTWQVYKQCV  189

Query  186  PI  187
            PI
Sbjct  190  PI  191

>PYIW_15526
Length=256

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 67/142 (47%), Gaps = 29/142 (20%)

Query  59   KTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTG  118
            +  A+F       GY +L+  +D   +           CGYTN N    P+    ++S  
Sbjct  63   QNAAEFTAAWPKTGYTSLKEMLDKSVS----------GCGYTNPNA--APVDVSGLKSMK  110

Query  119  Y-----------THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWY  165
            Y           +H GPCE W+DNTK+    +C K +PG   T  + Y+ CKG+C L +Y
Sbjct  111  YQNNEYKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFY  170

Query  166  WMGLRFLKNKWSWQVYKECVPI  187
            W+ +   K    WQVYK CV I
Sbjct  171  WLAVHSPK----WQVYKGCVAI  188

>PPTG_04619
Length=276

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 60/129 (47%), Gaps = 18/129 (14%)

Query  70   SKGYKTLRAFMD-DKKAYKVDAAGANFECGYTN--INGKRQPIPAGTIRSTGYTHDGPCE  126
            S   K +R  +D D   Y  D       CGYTN  +  K  P       S G  H GPCE
Sbjct  73   SNNAKDIRTLLDSDTSLYGAD-------CGYTNPDVTPKDPPTDGTATFSRGIVHAGPCE  125

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSW  178
            +WLD+  V+   +C   +   T         + Y+SC  G C  R+YW+ L+ L  K  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  179  QVYKECVPI  187
            QVYK C+P+
Sbjct  186  QVYKNCIPL  194

>PHALS_03176
Length=207

 Score = 78.6 bits (192),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 88/180 (49%), Gaps = 22/180 (12%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKS--KGYKTLRA--  78
            S+ D H  +++P   F     N  W     ++      ++D+NG  +   K ++ L+A  
Sbjct  19   SNTDGHGYMLIPQAQFKG-SANSAW----IVQIDPLWKSSDWNGNTQKSVKTFQKLKAAN  73

Query  79   -FMDDKKAYKVDAAGANFECGYTNINGKRQPIP--AGTIRSTGYTHDGPCEVWLDNTKVM  135
             F D K      A GA  +CG+++  GK QPIP       S    H GPCE+WLDN KV+
Sbjct  74   KFKDLKTLMDTSAFGA--KCGFSDPKGKPQPIPKDGKATFSRAIVHTGPCEIWLDNKKVL  131

Query  136  SGTNC-----NKDFPGKT-HSISYASC-KGSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
               +C     N D   K+   + Y+SC  G C  +R+YW+  + +  K  WQ YK C+P+
Sbjct  132  YEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAFQGVNGKTVWQSYKNCIPL  191

>SPRG_19916
Length=305

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 28/141 (20%)

Query  61   TADFNGYIKSK-GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRS---  116
             A+FN   K++  +KTLR  +D +            +CG T  NG ++ IP   + +   
Sbjct  60   VANFNKAFKAQTQFKTLRDMLDPQGP----------DCGNTLTNGAKKAIPTNGMMTWQN  109

Query  117  --TGY----THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKGS-CTLRWYW  166
              TG     +H GPCEVW+D+ +V    +C  +FP K  +   I Y+SC G  C LR+YW
Sbjct  110  PDTGEGFVPSHTGPCEVWIDDKRVFQNDDCATNFPAKPAANLPIDYSSCSGDGCMLRFYW  169

Query  167  MGLRFLKNKWSWQVYKECVPI  187
            + L    ++  WQVYK CVP+
Sbjct  170  LAL----HEPMWQVYKNCVPL  186

>PHYSO_485524
Length=278

 Score = 79.7 bits (195),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 18/129 (14%)

Query  70   SKGYKTLRAFMD-DKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-STGYTHDGPCE  126
            S   K +R  +D D K Y     GAN  CGYTN +   +  P  GT   S G  H GPCE
Sbjct  73   SNNAKDIRTLLDSDTKLY-----GAN--CGYTNPDATPEDPPTDGTATFSRGIVHAGPCE  125

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWSW  178
            +WLD+  V+   +C   +   T         + Y+SC  G C  R+YW+ L+ L  K  W
Sbjct  126  IWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTYW  185

Query  179  QVYKECVPI  187
            QVYK C+P+
Sbjct  186  QVYKNCIPL  194

>PHYKE_2539
Length=258

 Score = 79.3 bits (194),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 86/184 (47%), Gaps = 29/184 (16%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPL-------AF----LENQGYKTTADFNGYIKSK  71
            SS DAH  +  PA  F +P  + Y+          AF     ++     TA F     + 
Sbjct  7    SSTDAHGYISKPAAQFVDPSTSTYYAKTITADVNSAFGGLKWDDSPEANTAIFTSSFANA  66

Query  72   GYKTLRAFMD----DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEV  127
            GY +LR  +D    D    + D +  +   G T +N +      G I S    H GPCEV
Sbjct  67   GYSSLRDMLDQQVTDCANTRTDVSPVDVS-GLTTMNWQNDQEQKGFIDS----HHGPCEV  121

Query  128  WLDNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            W+D+T V    +C       +P   ++  ++ C G CTLR+YW+ L    ++ +WQ+YK+
Sbjct  122  WIDDTLVDHQDDCVATYGSGYPASVNA-DFSKCSGDCTLRFYWIAL----HEPNWQIYKQ  176

Query  184  CVPI  187
            CVP+
Sbjct  177  CVPV  180

>SPRG_07799
Length=345

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 88/179 (49%), Gaps = 31/179 (17%)

Query  27   AHQSVILPAPTFTNPDKN-----VYWNPLAFLENQGY-----KTTADFNGYIKSKGYKTL  76
            AH  ++ P   F +P+ +        +  + L    Y       TADF  + K+  +KTL
Sbjct  22   AHGHLVAPPVQFVDPNSDPTRFCATLDGPSLLPGDTYNKSPGDNTADFTKHFKASRFKTL  81

Query  77   RAFMDDKKAYKVDAAGANFECGYTNIN-GKRQPIPAGTIR-----STGYT--HDGPCEVW  128
            +  ++ + +          ECG T ++  K Q +P+  +R     + G+T  H+GPCE+W
Sbjct  82   KDLIESQPS--------GGECGITKLDPSKPQALPS-VVRWRHGDNEGFTPSHEGPCELW  132

Query  129  LDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             DNT+V    NC K+    + +I    C G+ TLR++W+ L    +  SWQVYK CV +
Sbjct  133  CDNTRVYDNENCAKNIADGSMAIDTTKCAGAKTLRFFWLAL----HSSSWQVYKNCVAL  187

>PYU1_G001519
Length=265

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 85/183 (46%), Gaps = 26/183 (14%)

Query  23   SSVDAHQSVILPAPTFTN-------------PDKNVYWNPLAFLENQGYKTTADFNGYIK  69
            ++ DAH  + LP PT+ N             P        ++F  +    T A    +  
Sbjct  17   ATADAHSKMSLPKPTWANGYGTNSPSGTIDGPSTLTVPAGMSFGTDPLSNTNAYLKAFKA  76

Query  70   SKGYKTLRAF-MDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY--THDGPCE  126
               YK+L+   M D  A KV++ GA  ECG++++NG  QP+P  T++   +  +H GPCE
Sbjct  77   QTKYKSLKDLAMSD--AQKVES-GATKECGFSDVNGTPQPLP-DTVQWDRFDNSHMGPCE  132

Query  127  VWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            VW D+  V    NC+ + P     + Y  A C G   L  +W+ L       +WQ+Y  C
Sbjct  133  VWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALHVP----TWQIYTNC  188

Query  185  VPI  187
             PI
Sbjct  189  API  191

>PHYRA_83499
Length=473

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 79/184 (43%), Gaps = 34/184 (18%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLEN-----QGYKTTADFNGYIKSKGYKTLR  77
            S  DAH ++  P  TF +    V W  +  ++N      G      +      K      
Sbjct  18   SHADAHGNLKEPEATFEDGAPTVEW--VTLIDNYWDIGSGGDQVGKYKTMAAEKKMSVRD  75

Query  78   AFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTIR-----STGYTHDGPCEVWLDN  131
              +D  K  K         CGYT  +   QPIP  G ++       G+TH GPCE+++D+
Sbjct  76   VVLDMVKDKK---------CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDD  126

Query  132  TKVMSGTNCNKDFPG--------KTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            T V+ G +C +++PG            + Y+SC G CTL  YW+  +  +    WQ Y  
Sbjct  127  TMVLHGDDCEEEYPGGPDGSNKMSEMPVDYSSCNGECTLTIYWLAFQNAQ----WQAYVN  182

Query  184  CVPI  187
            CV +
Sbjct  183  CVSL  186

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 12/67 (18%)

Query  123  GPCEVWLDNTKVMSGTNCNKDFPGKTHS--------ISYASCKGSCTLRWYWMGLRFLKN  174
            GPCE++LD+T ++ G NC  ++ G            I Y+SC G+CTL  YW+G +  + 
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQNEQ-  409

Query  175  KWSWQVY  181
               WQ Y
Sbjct  410  ---WQAY  413

>PHYSO_459106
Length=223

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 64/130 (49%), Gaps = 18/130 (14%)

Query  69   KSKGYKTLRAFMD-DKKAYKVDAAGANFECGYTNINGKRQ--PIPAGTIRSTGYTHDGPC  125
            K+   K +R  +D D K Y  D       CG+T+  GK Q  P       S G  H GPC
Sbjct  72   KANNVKDIRTMIDSDTKLYGED-------CGFTDPKGKPQDPPTTGDATFSRGIVHAGPC  124

Query  126  EVWLDNTKVMSGTNCNKDFPGKTHS-------ISYASC-KGSCTLRWYWMGLRFLKNKWS  177
            E+WLD+  V+   +C   +   T +       + Y+SC  G C  R+YW+ L+   +K  
Sbjct  125  EIWLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTY  184

Query  178  WQVYKECVPI  187
            WQVYK C+P+
Sbjct  185  WQVYKNCIPL  194

>PYIR_20481
Length=277

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 69/137 (50%), Gaps = 29/137 (21%)

Query  64   FNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY----  119
            F     + GYK+L+  +D      +   G    CG+T  +G   P+    ++S  +    
Sbjct  66   FTSAFANTGYKSLKEMLD------LSVPG----CGFTLTDGA--PVDVSGLKSMKWQNDQ  113

Query  120  -------THDGPCEVWLDNTKVMSGTNCNKDFPGKTHSI--SYASCKGSCTLRWYWMGLR  170
                   +H GPCEVW+DNTK+M   +C  D+      I   Y+ CKG C L +YW+ L 
Sbjct  114  EQKGFIDSHHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLAL-  172

Query  171  FLKNKWSWQVYKECVPI  187
               ++ +WQ+YK+CVPI
Sbjct  173  ---HEPNWQIYKQCVPI  186

>SPRG_22161
Length=300

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 74/140 (53%), Gaps = 28/140 (20%)

Query  62   ADFNGYIKSK-GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRS----  116
            A+FN   K++  +KTLR  +D +            +CG T  NG ++ IP   + +    
Sbjct  61   ANFNKAFKAQTQFKTLRDMLDPQGP----------DCGNTLTNGAKKAIPTNGMMTWQNP  110

Query  117  -TGY----THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKGS-CTLRWYWM  167
             TG     +H GPCEVW+DN +V    +C  +FP K  +   + Y+SC  + C LR+YW+
Sbjct  111  DTGEGFIPSHTGPCEVWIDNKRVFQNDDCATNFPAKPAANLPVDYSSCGANGCMLRFYWL  170

Query  168  GLRFLKNKWSWQVYKECVPI  187
             L    ++  WQVYK CVP+
Sbjct  171  AL----HEPMWQVYKNCVPL  186

>H257_11265
Length=282

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 82/180 (46%), Gaps = 28/180 (16%)

Query  27   AHQSVILPAPTFTNP--DKNVYWNPL---AFLENQGYK-----TTADFNGYIKSKGYKTL  76
            AH  ++ P PTF NP  D   Y   +     L  + Y       T  F   +K   + +L
Sbjct  23   AHGYLVDPQPTFVNPGGDPTGYSGTIDGNVALPGENYNLSPQDNTIAFTRQLKKSSFASL  82

Query  77   RAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGY--THDGPCEVWL  129
            RAF+D +            ECG T  +G  + +P+ +       S G+  +H+GPCE+W 
Sbjct  83   RAFIDAQ-------GNTGGECGLTRADGTPRSLPSDSKVKWAHGSEGFVLSHEGPCELWC  135

Query  130  DNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPIGS  189
            D T+V    NC ++ P     I+ + C+GS  L   W+ L   +    WQVYK CV + S
Sbjct  136  DATRVYENDNCARNIPDGVMPINSSQCQGSEKLIMLWLALHTSQ----WQVYKNCVRLTS  191

>PHYSO_524101
Length=308

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 66/136 (49%), Gaps = 15/136 (11%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----  115
            TA F    +S  Y +L+  ++DK    V    A   CG  + +   QP+P   +      
Sbjct  66   TAAFTTAFESSSYSSLKELINDKATITV--TDATLTCGMCDPDETAQPLPDTYVEWAHSD  123

Query  116  STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRF  171
            S G+T  H+GPCEVW D+ +V    +C  D+      + Y   +C GS TL +YW+ L  
Sbjct  124  SEGFTASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLAL--  181

Query  172  LKNKWSWQVYKECVPI  187
              +  +WQVY  C P+
Sbjct  182  --HSSTWQVYVNCAPL  195

>H310_05432
Length=301

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 82/173 (47%), Gaps = 18/173 (10%)

Query  27   AHQSVILPAPTFTN--PDKNVYWNPL---AFLENQGYKTTADFNGYIKSKGYKTLRAFMD  81
            +H  ++ P PT  +  PDK  Y   +     L  + Y  + ++N     + +K  ++   
Sbjct  20   SHGILVDPKPTIRDGVPDKTNYCGTIDGYKALPGEKYDDSPEYNTNAFVRQFK--KSSFT  77

Query  82   DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-------THDGPCEVWLDNTKV  134
              KA          ECG T  +G  QP+P   I   G+       +H+GPCEVW D T+V
Sbjct  78   SLKALVHSQPTTCGECGITRDDGTPQPMPLDGIVKWGHGNEGYVSSHEGPCEVWCDATRV  137

Query  135  MSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             S  NC ++ P     I+ A+CKG+  L + W+ +    +  SWQVY  CVP+
Sbjct  138  YSNDNCARNIPNGAMPINVAACKGAKRLLFVWLAM----HTSSWQVYINCVPL  186

>PHYSO_318683
Length=352

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 89/185 (48%), Gaps = 29/185 (16%)

Query  23   SSVDAHQSVILPAPTFTNP-DKNVYWNPLAFLENQGY-----------KTTADFNGYIKS  70
            S+V+AH  + LPA TF N  DK  +   +A +E+              + TA F     S
Sbjct  14   SNVNAHGYLGLPAVTFPNDVDKTQF---IATIESSASGFSGSFSGSPAENTAAFWTAFNS  70

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT----IRSTGYT--HDGP  124
              Y +++ F+ D    ++ A GAN ECG T+ +   QP+P         + G+T  H+GP
Sbjct  71   SQYSSIKEFVTDLG--QIVANGANIECGLTDPDETPQPLPDELEWTHSDTEGFTSSHEGP  128

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CE W DNT+V   T+C   +      + Y  A C G+  L +YW+ L       +WQVY 
Sbjct  129  CEAWCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH----SSTWQVYV  184

Query  183  ECVPI  187
            +C  +
Sbjct  185  DCAAL  189

>PYIR_24743
Length=357

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 86/184 (47%), Gaps = 33/184 (18%)

Query  23   SSVDAHQSVILPAPTFTN---PDKNVYWNPLAFLENQGYKTTADFNGYIKS----KGYKT  75
            S VDAH  V  P   F +   P K       AF         A+ + + K+      +KT
Sbjct  30   SMVDAHGYVSSPLAEFKDGVMPTKYTATMSPAFQGKFNDNPQANVDTFTKAFQGQSEFKT  89

Query  76   LRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-GTI------RSTGY--THDGPCE  126
            LR  + D  A          +CG +  +  R+ IP  G +         G+  +H GPCE
Sbjct  90   LRDLLKDHGA----------DCGDSKPDASRKAIPGDGKVVWQNPDTGEGFVPSHTGPCE  139

Query  127  VWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            +WLD+ +V S  NC   F  K  +   + ++SCK +C LR+YW+ L    ++ +WQVYK 
Sbjct  140  IWLDDKRVFSDENCAGHFTSKPKAELPVDFSSCKENCMLRFYWLAL----HEPTWQVYKN  195

Query  184  CVPI  187
            CVP+
Sbjct  196  CVPL  199

>PHYSO_426658
Length=210

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 82/189 (43%), Gaps = 31/189 (16%)

Query  23   SSVDAHQSVILPAPTFT------NPDKNVYWNPLA------FLENQGY-KTTADFNGYIK  69
            SSV+AH  ++ PA T T      N    +    L       F     Y K TA F+  +K
Sbjct  18   SSVEAHGKLVKPALTLTGTGYGGNFQSTIPMTSLTPKPGDIFTTYPDYSKNTAAFDRALK  77

Query  70   SKGYKTLRAFMDDKKAYKVDAAGANF------ECGYTN-INGKRQPIPAGTI-RSTGYTH  121
            +  YK+L+ FM   +    D     F      ECG+T+ ++G  QP+P        G  H
Sbjct  78   ASQYKSLKEFMYSTQ----DMTKGRFNLPKTAECGFTDPVDGAVQPLPDQVEWYGGGMIH  133

Query  122  DGPCEVWLDNTKVMSGT-NCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQV  180
            DGPCE+W D+   M  T NC   +P        A C+G   L  YW+G         WQV
Sbjct  134  DGPCEIWCDDEVAMPFTPNCRAAYPDGKFPYEKAKCEGKKRLTMYWLGTLL-----EWQV  188

Query  181  YKECVPIGS  189
            Y +C  IG 
Sbjct  189  YIDCAKIGE  197

>PYAP_23672
Length=257

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 73/170 (43%), Gaps = 8/170 (5%)

Query  23   SSVDAHQSVILPAPTFTN----PDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRA  78
            S+V+AH  ++LP PT+          +  + L F   Q +     F+  I   G      
Sbjct  17   SNVEAHGELMLPRPTYPKWGGGVTSTISPSVLPFAWRQDFPQA--FDEAITKTGLSLKDF  74

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVWLDNTKVMS-G  137
             M  +        G+  ECGY++  G  QP+P      TG+ H GPCE + DN  V    
Sbjct  75   IMKYQNMSGASDTGSTPECGYSDPKGTPQPLPEKIQFHTGFMHWGPCEAYCDNVLVTKHA  134

Query  138  TNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             +C   +PG       A C G    ++YW+G+    N   WQ Y  CVP+
Sbjct  135  ADCKVAYPGGAVPYDKAKCAGKKQFKFYWLGMD-SGNSAPWQAYVNCVPL  183

>PHALS_03177
Length=259

 Score = 77.8 bits (190),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 90/179 (50%), Gaps = 22/179 (12%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKS--KGYKTLRA---  78
            S+D+H  + +P   F     N  W     ++ +    ++D+NG  +   K +++L+A   
Sbjct  20   SIDSHGYMYIPRTQFKG-QGNDGW----IVQIEPLWKSSDWNGNTQKSVKAFQSLKAANN  74

Query  79   FMDDKKAYKVDAAGANFECGYTNINGKRQPIP--AGTIRSTGYTHDGPCEVWLDNTKVMS  136
            F D K    +D      +CGY++ NGK QPIP       S    H GPCE+WLDN KV+ 
Sbjct  75   FKDLKTL--MDNPVLGRDCGYSDPNGKPQPIPKDGKATFSRAMVHTGPCEMWLDNKKVLY  132

Query  137  GTNC-----NKDFPGKT-HSISYASC-KGSC-TLRWYWMGLRFLKNKWSWQVYKECVPI  187
              +C     N D   K+   + Y+SC  G C  +R+YW+  + +  K  WQ YK C+P+
Sbjct  133  EDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAFQGINGKTFWQSYKMCIPL  191

>PHYSO_488921
Length=296

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 68/136 (50%), Gaps = 27/136 (20%)

Query  64   FNGYIKSKGYKTLRAFMDD---------KKAYKVDAAGANFECGYTNINGKRQPIPAGTI  114
            FN +  + GYK+LR  +D          K A  VD        GYT +  +      G I
Sbjct  67   FNDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDV------TGYTEMWWQNDEYKEGFI  120

Query  115  RSTGYTHDGPCEVWLDNTKVMSGTNCNKDF---PGKTHSISYASCKGSCTLRWYWMGLRF  171
             S    H GPCE W+D+ K+    NC  +F   P K  +  Y+SCKG C L +YW+ L  
Sbjct  121  NS----HSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPA-DYSSCKGDCLLVFYWLAL--  173

Query  172  LKNKWSWQVYKECVPI  187
              ++ +WQ+YK+CVPI
Sbjct  174  --HEPNWQIYKQCVPI  187

>PYAR_24818
Length=198

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 77/178 (43%), Gaps = 21/178 (12%)

Query  24   SVDAHQSVILPAP----------TFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGY  73
            SVDAH  + LP P          T   P+       ++F       T A    Y     Y
Sbjct  19   SVDAHSKMTLPKPNSAIDNAPSGTLDGPNTLQVPAGMSFGYGHEQNTAAFLKAYKSQSKY  78

Query  74   KTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY--THDGPCEVWLDN  131
             ++R  + DK  ++ D  GA  ECG + + G  Q +P      TG+  TH GPCEVW D+
Sbjct  79   TSIRQMIYDK--FRPDG-GATKECGRSAMTGPPQDLPDFVEYETGFDSTHWGPCEVWCDD  135

Query  132  TKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             +V    NC   +P K   + Y  A C+G+  L+ +W+ L        WQ Y  C  +
Sbjct  136  KRVFYEDNCAVKYPQKPGKLPYDKAQCRGAKRLQSFWLALHVP----DWQAYISCATL  189

>PHYSO_329293
Length=310

 Score = 78.6 bits (192),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 68/136 (50%), Gaps = 27/136 (20%)

Query  64   FNGYIKSKGYKTLRAFMDD---------KKAYKVDAAGANFECGYTNINGKRQPIPAGTI  114
            FN +  + GYK+LR  +D          K A  VD        GYT +  +      G I
Sbjct  67   FNDHWNATGYKSLREMLDPIAPDYGHSLKTATPVDV------TGYTEMWWQNDEYKEGFI  120

Query  115  RSTGYTHDGPCEVWLDNTKVMSGTNCNKDF---PGKTHSISYASCKGSCTLRWYWMGLRF  171
             S    H GPCE W+D+ K+    NC  +F   P K  +  Y+SCKG C L +YW+ L  
Sbjct  121  NS----HSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPA-DYSSCKGDCLLVFYWLAL--  173

Query  172  LKNKWSWQVYKECVPI  187
              ++ +WQ+YK+CVPI
Sbjct  174  --HEPNWQIYKQCVPI  187

>PYU1_G005871
Length=284

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 83/194 (43%), Gaps = 52/194 (27%)

Query  24   SVDAHQSVILPAPTFTNPDK-NVYWNPLAFLENQGYKTTADFNGYIKSK-----------  71
            S++AH  V  P  T+        Y   +    N+G      FNGYI ++           
Sbjct  20   SIEAHGYVSQPKGTYNGGSSYTSYSAEITASSNKG------FNGYIFNRSPEQNTQQFTA  73

Query  72   -----GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-------  119
                 GYK+L+  MD           A   CGY+N N    P+    + +  +       
Sbjct  74   AWPKTGYKSLKQMMD----------KAVPGCGYSNPNAA--PVDVSKMSAMKFQNNEYKE  121

Query  120  ----THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWYWMGLRFLK  173
                +H GPCE W+DNT+V    +C   FPG   T  +SY SCKG+C L +YW+ L   K
Sbjct  122  GFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK  181

Query  174  NKWSWQVYKECVPI  187
                WQ YK CV I
Sbjct  182  ----WQAYKSCVAI  191

>PHYCA_122958
Length=260

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 83/183 (45%), Gaps = 31/183 (17%)

Query  25   VDAHQSVILPAPTFTNP------------DKNVYWNPLAFLENQGYKTTADFNGYIKSKG  72
            VDAH  +  PA  F +P            D N  +  L + +N      A F     + G
Sbjct  19   VDAHGYISKPAAQFVDPTASTSYVKTITADVNGAFGGLKWDDNP-VANAATFTSSFPNTG  77

Query  73   YKTLRAFMDDKKA----YKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVW  128
            Y +LR  +D + +     K D +  +   G T +N +      G I S    H GPCEVW
Sbjct  78   YSSLRNMLDQQVSDCANTKTDVSPVDVS-GLTVMNWQNDQEQKGFIDS----HHGPCEVW  132

Query  129  LDNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            +D+T V    +C       +P    +  Y+ C G CTLR+YW+ L     + +WQ+YK+C
Sbjct  133  IDDTMVDHQDDCVATYGSSYPANVKA-DYSQCSGDCTLRFYWLALH----EPNWQIYKQC  187

Query  185  VPI  187
            VPI
Sbjct  188  VPI  190

>HYAP_14170
Length=266

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 86/184 (47%), Gaps = 31/184 (17%)

Query  24   SVDAHQSVILPAPTFTNP------------DKNVYWNPLAFLENQGYKTTADFNGYIKSK  71
            SV AH  V  PA  + +P            D N  ++ L + ++     TA F     + 
Sbjct  8    SVHAHGYVSKPAAQYIDPASSTTYAKTITADVNTAFSGLKW-DDSPEANTATFKSSFANA  66

Query  72   GYKTLRAFMDDK----KAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEV  127
            GYK+LR  +D +       + D A  +   G T +N +      G I S    H GPCE 
Sbjct  67   GYKSLRDMLDQQVPGCANTRTDVAPVDV-AGLTVMNWQNDKEHKGFIDS----HHGPCET  121

Query  128  WLDNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKE  183
            W+D+T V    +C       FP   ++  ++ C G CTLR+YW+ L    ++ +WQVYK+
Sbjct  122  WIDDTMVDRQDDCVATYGTGFPASVNA-DFSRCSGVCTLRFYWLAL----HEVNWQVYKQ  176

Query  184  CVPI  187
            CVPI
Sbjct  177  CVPI  180

>PHYSO_476077
Length=268

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 29/185 (16%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPL-------AF----LENQGYKTTADFNGYIKSKG  72
            S DAH  +  PA  F +  K+ Y+          AF     ++     TA F       G
Sbjct  21   SADAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAG  80

Query  73   YKTLRAFMD----DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVW  128
            Y +LR  +D    D    + D +  +   G T ++ +      G I S    H GPCEVW
Sbjct  81   YSSLRDMLDQQVTDCANTRTDVSPVDVS-GLTTMSWQNDQEQKGFIDS----HHGPCEVW  135

Query  129  LDNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            +D+T V    +C       +P K ++  ++ C G CTLR+YW+ L    ++ +WQ+YK+C
Sbjct  136  IDDTMVEHQDDCVAKYGSGYPAKVNA-DFSKCSGDCTLRFYWLAL----HEPNWQIYKQC  190

Query  185  VPIGS  189
            VP+ S
Sbjct  191  VPVVS  195

>PHYSO_472009
Length=268

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 29/185 (16%)

Query  24   SVDAHQSVILPAPTFTNPDKNVYWNPL-------AF----LENQGYKTTADFNGYIKSKG  72
            S DAH  +  PA  F +  K+ Y+          AF     ++     TA F       G
Sbjct  21   SADAHGYISNPAAQFVDSTKSTYYAKTITADVNSAFGGLKWDDSPEANTATFTSSFAKAG  80

Query  73   YKTLRAFMD----DKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGYTHDGPCEVW  128
            Y +LR  +D    D    + D +  +   G T ++ +      G I S    H GPCEVW
Sbjct  81   YSSLRDMLDQQVTDCANTRTDVSPVDVS-GLTTMSWQNDQEQKGFIDS----HHGPCEVW  135

Query  129  LDNTKVMSGTNC----NKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            +D+T V    +C       +P K ++  ++ C G CTLR+YW+ L    ++ +WQ+YK+C
Sbjct  136  IDDTMVEHQDDCVAKYGSGYPAKVNA-DFSKCSGDCTLRFYWLAL----HEPNWQIYKQC  190

Query  185  VPIGS  189
            VP+ S
Sbjct  191  VPVVS  195

>SDRG_00948
Length=352

 Score = 78.6 bits (192),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 87/179 (49%), Gaps = 31/179 (17%)

Query  27   AHQSVILPAPTFTNPDKN-----VYWNPLAFLENQGYK-----TTADFNGYIKSKGYKTL  76
            AH  ++ P   F +P+ +        +  + L    Y       TA F  + K+  +KTL
Sbjct  22   AHGHLVAPPVQFVDPNSDPTRFCATLDGPSLLPGDTYNKSPGDNTAAFTTHFKASRFKTL  81

Query  77   RAFMDDKKAYKVDAAGANFECGYTNIN-GKRQPIPAGTIR-----STGYT--HDGPCEVW  128
            +  ++ + +          ECG T ++  K Q +P+  +R     + G+T  H+GPCE+W
Sbjct  82   KDLIESQPS--------GGECGITKLDPSKPQALPS-VVRWRHGDNEGFTPSHEGPCELW  132

Query  129  LDNTKVMSGTNCNKDFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
             DNT+V    NC K+    +  I  A C G+ TLR++W+ L    +  SWQVYK CV +
Sbjct  133  CDNTRVYDNENCAKNIADGSMPIDTAKCAGAKTLRFFWLAL----HSSSWQVYKNCVAL  187

>PYAP_18584
Length=210

 Score = 76.3 bits (186),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 78/183 (43%), Gaps = 26/183 (14%)

Query  23   SSVDAHQSVILPAPTFT--------NPDKNVYWNPLAF----LENQGYKTTADFNGYIKS  70
            S VDAH  ++ PA  F         N   N Y  P  F      +        F    K 
Sbjct  17   SQVDAHGYLVQPAAKFKPNVMTTNYNGIINAYSLPAPFAGKKFNDNPTANANTFTAAFKQ  76

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY--THDGPCEVW  128
              YK+++A MD    Y  D           N++G R    A      G+  +H GPCEVW
Sbjct  77   SSYKSIKALMDK---YVPDCGNTLMNGSPINVSGMRSVKWANDQERVGFIKSHSGPCEVW  133

Query  129  LDNTKVMSGT-NCNK---DFPGKTHSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKEC  184
            +DN  V     NC +    +P +   + Y+ CKG C L +YW+ L     + +WQ+YK+C
Sbjct  134  IDNKMVFQELGNCVEKYTSYPAEL-PVDYSVCKGKCQLTFYWLALH----EPNWQIYKQC  188

Query  185  VPI  187
             PI
Sbjct  189  API  191

>PYU1_G005872
Length=297

 Score = 77.8 bits (190),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 84/194 (43%), Gaps = 52/194 (27%)

Query  24   SVDAHQSVILPAPTFTNPDK-NVYWNPLAFLENQGYKTTADFNGYIKSK-----------  71
            S++AH  V  P  T+        Y   +    N+G      FNGYI ++           
Sbjct  20   SIEAHGYVSQPKGTYNGGSSYTSYSAEITASSNKG------FNGYIFNRSPEQNTQQFTA  73

Query  72   -----GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-------  119
                 GYK+L+  MD  KA           CGY+N N    P+    + +  +       
Sbjct  74   AWPKTGYKSLKQMMD--KAVPG--------CGYSNPNAA--PVDVSKMSAMKFQNNEYKE  121

Query  120  ----THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWYWMGLRFLK  173
                +H GPCE W+DNT+V    +C   FPG   T  +SY SCKG+C L +YW+ L   K
Sbjct  122  GFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYWLALHSPK  181

Query  174  NKWSWQVYKECVPI  187
                WQ YK CV I
Sbjct  182  ----WQAYKSCVAI  191

>PPTG_03138
Length=294

 Score = 77.4 bits (189),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/187 (28%), Positives = 86/187 (46%), Gaps = 28/187 (15%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGY-----------IKSK  71
            ++V AH  +  PA TF   +    +  +A +E+     T  FNG             +S 
Sbjct  19   ANVYAHGYMSDPAVTFLTTNDPTQF--IATIESSASGLTGTFNGAPADNTAAFTKAFESS  76

Query  72   GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----STGYT--HDGP  124
             + +L+  +++K    V  + A   CG  + +   QP+P   +      S G+T  H+GP
Sbjct  77   SFSSLKELINEKATLTV--SDATLTCGSCDPDETAQPLPDTYVEWAHSDSEGFTASHEGP  134

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CE+W D+ +V  G +C  D+      + Y   +C GS  L +YW+ L    +  +WQVY 
Sbjct  135  CEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLAL----HSSTWQVYV  190

Query  183  ECVPIGS  189
             C P+ S
Sbjct  191  NCAPLES  197

>PHYCA_19612
Length=610

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 67/138 (49%), Gaps = 15/138 (11%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----  115
            TA F    +S  Y +L+  ++DK    V    A   CG  + +   Q +PA  +      
Sbjct  371  TAAFTTAFESSSYSSLKELINDKATITV--TDATLTCGACDPDETAQALPATYVEWAHSD  428

Query  116  STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRF  171
            S G+T  H+GPCEVW D+ +V  G +C  D+      + Y   +C GS  L +YW+ L  
Sbjct  429  SEGFTASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLAL--  486

Query  172  LKNKWSWQVYKECVPIGS  189
              +  +WQVY  C P+ S
Sbjct  487  --HSSTWQVYVNCAPLES  502

 Score = 72.4 bits (176),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 63/138 (46%), Gaps = 15/138 (11%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----  115
            TA F     S  Y +L+  +       V    A   CG  N +   QP+P   +      
Sbjct  69   TAAFTKAFASSSYTSLKDLI--TSLATVTVTDATLTCGSCNPDETAQPLPDKYVEWSHSS  126

Query  116  STGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRF  171
            + G+T  H+GPCEVW D+ +V    +C  D+      + Y   +C G+ TL +YW+ L  
Sbjct  127  TEGFTSSHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLAL--  184

Query  172  LKNKWSWQVYKECVPIGS  189
              +  +WQVY  C P+ S
Sbjct  185  --HSSTWQVYVNCAPLES  200

>PHYRA_84947
Length=265

 Score = 76.6 bits (187),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 76/171 (44%), Gaps = 10/171 (6%)

Query  23   SSVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDD  82
            SS   H ++ILP P   +        P   ++      +A +  Y ++      +  +  
Sbjct  18   SSTTGHGNIILPKPEGNDQHHFYIGGPAGTIDMPEIIGSASYGDYYEAVDSWFTKNNIAS  77

Query  83   KKAYKVDAAGANFECGYTNINGKRQPIPA---GTIRSTGYTHDGPCEVWLDNTKVMSGTN  139
             K Y         ECG T  NG  QP+P+       + G +H GPCE+W D+T+V   +N
Sbjct  78   LKEYITTYGTDISECGVTKKNGAPQPVPSDGYAQHDNLGNSHPGPCEIWCDDTRVFHDSN  137

Query  140  CNKDFPGKTHS---ISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
            C   F G++ +   I  ++CK S  L +YW+ L        WQVY  CV +
Sbjct  138  CVAKFSGQSPAKIPIDVSTCKSSSELVFYWLALHI----QPWQVYINCVAL  184

>PITG_19818
Length=147

 Score = 74.3 bits (181),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 42/64 (66%), Gaps = 0/64 (0%)

Query  24  SVDAHQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDK  83
           + DAHQ V+LP P +T  DK+  +NPLAFLENQG+K   DF  +    GYK+LR FMD  
Sbjct  22  TADAHQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKPQQDFKAWRDENGYKSLRDFMDRA  81

Query  84  KAYK  87
             ++
Sbjct  82  NLFR  85

>PITG_11937
Length=305

 Score = 77.0 bits (188),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 83/185 (45%), Gaps = 29/185 (16%)

Query  23   SSVDAHQSVILPAPTFTNP-DKNVYWNPLAFLENQGYKT-----------TADFNGYIKS  70
            S V AH  + LPA TF N  DK  +   +A +E                 T  F     S
Sbjct  13   SGVSAHGYLGLPAVTFPNDVDKTQF---IATIEASASGFSGSFSGSPSANTETFWTAFSS  69

Query  71   KGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGT----IRSTGYT--HDGP  124
              + +++ F+      +V A GAN +CG T+ N   QP+P         + G+T  H+GP
Sbjct  70   SKFTSIKEFV--TALGQVVATGANLQCGLTDPNETPQPLPEQIEWTHSDTEGFTSSHEGP  127

Query  125  CEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYK  182
            CE W D+T+V   TNC   F      + Y  A+C G+  L +YW+ L       +WQVY 
Sbjct  128  CEAWCDDTQVFQDTNCAAHFTTAPAKLPYNKAACSGASRLAFYWLALH----SSTWQVYA  183

Query  183  ECVPI  187
             C  +
Sbjct  184  NCAAL  188

>PYAP_18221
Length=226

 Score = 75.9 bits (185),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 63/143 (44%), Gaps = 31/143 (22%)

Query  59   KTTADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTG  118
            + T  F    K  G K+LR  MD             +  G  N N    P     +++  
Sbjct  67   QNTQVFTDAFKQSGLKSLRELMD------------KYVPGCGNTNPNTTPRDVTKLKTMT  114

Query  119  Y-----------THDGPCEVWLDNTKVMSGTNCN---KDFPGKTHSISYASCKGSCTLRW  164
            Y           +H GPCEVW+DNT+V    +C    K +P     + Y+ CKG+C L +
Sbjct  115  YQNNEYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAAL-PVDYSKCKGTCRLTF  173

Query  165  YWMGLRFLKNKWSWQVYKECVPI  187
            YW+ L   K    WQ YK+CVPI
Sbjct  174  YWLALHSQK----WQAYKQCVPI  192

>PYVX_16138
Length=559

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/178 (28%), Positives = 80/178 (45%), Gaps = 23/178 (13%)

Query  21   CDSSVDAHQSVILPAPTFTNPDKN---VYWNPLAFLENQGYKTTADFNGYI---KSKGYK  74
            C S V  H  +++P   F+    +   V  +P    +     +    + Y+   + KG  
Sbjct  18   CVSRVQGHGYMLIPESQFSGTATSSWIVQIDPQWESDGWNGNSQDSVDTYVSLAEEKGVT  77

Query  75   TLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR--STGYTHDGPCEVWLDNT  132
             +R+ +DD   Y  D       CGYT+ +G  Q IP  +    S G  H GPCE+WLD+T
Sbjct  78   QIRSLLDDTSIYGAD-------CGYTDPDGTAQDIPTDSTATFSRGMVHVGPCEIWLDDT  130

Query  133  KVMSGTNCNKDFPGKTHS------ISYASC--KGSCTLRWYWMGLRFLKNKWSWQVYK  182
             V+   +C   + G          + Y+SC   G   +R+YW+  + + ++  WQVY 
Sbjct  131  MVLHDDDCYSTYGGDDQDVKSVFPVDYSSCDTSGCSMMRFYWLAFQGVDDETVWQVYS  188

>PYIW_25573
Length=279

 Score = 76.6 bits (187),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 74/175 (42%), Gaps = 22/175 (13%)

Query  28   HQSVILPAPTF-----TNPDKNVYWNPLAFLENQGYKTTAD-------FNGYIKSKGYKT  75
            H  + LP PT+     TN        P A     G   + D       F   +K+  Y +
Sbjct  25   HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAPSGMSFSTDPTSNTKAFTAALKASSYGS  84

Query  76   LRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTI-RSTGYTHDGPCEVWLDNTKV  134
            L+A      A +   +GA+ ECG++   G  QP+P          +H+GPCEVW DNT  
Sbjct  85   LKALA---FATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMA  141

Query  135  MSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187
              G NC K +      + Y  + C G+  L   W+ L       +WQVY  C PI
Sbjct  142  FHGDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLALHTP----TWQVYTNCAPI  192

>PHYKE_3913
Length=321

 Score = 77.0 bits (188),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 60/128 (47%), Gaps = 13/128 (10%)

Query  73   YKTLRAF---MDDKKAYKVDAAGANFECGYTNING--KRQPIPAGTIRSTGYTHDGPCEV  127
            YK L+      D +  +  D +     CG+TN +   K  P       S G  H GPCE+
Sbjct  94   YKELKVANNAKDIRTLFDSDTSLYGENCGFTNPDATPKDPPTDGTATFSRGIVHAGPCEI  153

Query  128  WLDNTKVMSGTNCNKDFPGKTHS-------ISYASCK-GSCTLRWYWMGLRFLKNKWSWQ  179
            WLD+  V+   +C   +   T         + Y+SC  G C  R+YWM L+ L  K  WQ
Sbjct  154  WLDDKMVLQNDDCQSAYGDGTQETISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTYWQ  213

Query  180  VYKECVPI  187
            VYK CVP+
Sbjct  214  VYKNCVPL  221

>PHYCA_19598
Length=390

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 65/135 (48%), Gaps = 15/135 (11%)

Query  62   ADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIR-----S  116
            A +     S  YK+L+    DK   K+  +GA   CG  +   + QP+P   +      S
Sbjct  65   AAYTKAFASSKYKSLKDLFTDKA--KITVSGATLTCGSCDPKEEPQPMPESIVEWSHSDS  122

Query  117  TGYT--HDGPCEVWLDNTKVMSGTNCNKDFPGKTHSISY--ASCKGSCTLRWYWMGLRFL  172
             G+T  H+GPCEVW D+ +     NC  +FP     + +   +C G+ TL +YWM +   
Sbjct  123  EGFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH--  180

Query  173  KNKWSWQVYKECVPI  187
                +WQVY  C P+
Sbjct  181  --SDTWQVYVNCAPL  193

>SDRG_17318
Length=241

 Score = 75.9 bits (185),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 70/140 (50%), Gaps = 28/140 (20%)

Query  62   ADFNGYIKSKG-YKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRS----  116
             +FN   K++  YKTLRA +D              +CG T  N  R+ IP+    +    
Sbjct  61   VNFNKAFKAQSKYKTLRAMLDPHGP----------DCGNTLTNVARKEIPSNGKMTFQNP  110

Query  117  ---TGY--THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS---ISYASCKG-SCTLRWYWM  167
                G+  +H GPCEVWLDN +V    +C  +FP K  +   + Y+SC    C LR+YW+
Sbjct  111  DTGEGFIPSHTGPCEVWLDNKRVFQNDDCATNFPQKPAANLPVDYSSCGAKGCMLRFYWI  170

Query  168  GLRFLKNKWSWQVYKECVPI  187
             L   +    WQVYK CVP+
Sbjct  171  ALHSPR----WQVYKNCVPL  186

>PYU1_G005873
Length=214

 Score = 75.1 bits (183),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 83/194 (43%), Gaps = 52/194 (27%)

Query  24   SVDAHQSVILPAPTFTNPDK-NVYWNPLAFLENQGYKTTADFNGYIKSK-----------  71
            S++AH  +  P   +T       Y   +    N+G      FNGYI ++           
Sbjct  20   SIEAHGYISQPKAQYTGGSSYTSYSAEITASSNKG------FNGYIFNRSPEQNTQQFTA  73

Query  72   -----GYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPAGTIRSTGY-------  119
                 GYK+L+  MD           A   CGY+  +    P+    + S  +       
Sbjct  74   AWPKTGYKSLKQMMDK----------AVPGCGYSRTD--IAPVDVSRMSSMKFQNNEYKE  121

Query  120  ----THDGPCEVWLDNTKVMSGTNCNKDFPG--KTHSISYASCKGSCTLRWYWMGLRFLK  173
                +H GPCE W+DNT+V    +C   FPG   T  +S+ +CKG+C L +YW+ L   K
Sbjct  122  GFLASHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIRMSFKACKGTCRLTFYWLALHSPK  181

Query  174  NKWSWQVYKECVPI  187
                WQ YK CVPI
Sbjct  182  ----WQAYKSCVPI  191

>PHYRA_77293
Length=302

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 65/139 (47%), Gaps = 25/139 (18%)

Query  61   TADFNGYIKSKGYKTLRAFMDDKKAYKVDAAGANFECGYTNINGKRQPIPA-------GT  113
            TA F        +KTLRA MD           A  +CG T + G    + +         
Sbjct  63   TAMFTKSFPKSQFKTLRALMD----------TAAPDCGNTALTGTAVDVSSLSSMKWQND  112

Query  114  IRSTGY--THDGPCEVWLDNTKVMSGTNCNKDFPGKTHS--ISYASCKGSCTLRWYWMGL  169
                G+  +H GPCE W+D+T+V    +C  D+ G      I ++SC G CT  +YWM +
Sbjct  113  QEQKGFIDSHHGPCEAWIDDTRVFQSDDCRADYTGYPAEIPIDFSSCSGDCTFTFYWMAM  172

Query  170  RFLKNKWSWQVYKECVPIG  188
                ++ +WQVYK+C PI 
Sbjct  173  ----HEPNWQVYKQCAPIA  187

Lambda      K        H        a         alpha
   0.318    0.133    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10110391890

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40