Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_13454147551291296711e-91
PYIW_19970147551301195513e-73
PYU1_G001736147551231224212e-53
PYAP_17747147551341243952e-49
PHYRA_95903147551341223788e-47
PHYKE_8392147551381293613e-44
PHYSO_321155147551361273597e-44
PHYCA_11834147551341223588e-44
PPTG_17126147551361273589e-44
CCA17542147551201203552e-43
PITG_18455147551321243534e-43
PYVX_18180147551351253535e-43
PHALS_06479147551361273492e-42
CCI44820147551231223361e-40
SPRG_06335147551231193212e-38
SDRG_01782147551231193171e-37
HYAP_07103147551641563165e-37
H257_06293147551231202961e-34
H310_09224147551231192665e-30
CCI4423211147105881003e-05
HYAP_084991114710856986e-05
HYAP_085006526017256981e-04
PYAP_228461114710456942e-04
CCA1752111147104106923e-04
PHYKE_58411114712151934e-04
PITG_137391114710556915e-04
PHALS_115641114710756915e-04
PHYSO_3150171114710956916e-04
PPTG_092521114710556870.002
PYAR_232071114711254860.003
PYU1_G0059631114710351860.003
H310_07567111479837840.005
PYVX_208541114710454840.006
PHYCA_5353801114710856810.014
PHYRA_816751114710656790.026
PYIR_151861114710936790.034
SDRG_149121114710554780.035
SPRG_128831114710554780.037
PYIW_147431114710540720.29
H310_138701481110799710.86
PYVX_151505606474661710.94
CCI4872013403114102671.3
SDRG_0542012501211885681.3
H257_07358111479840661.8
PYU1_G0131561561313156671.8
PYAR_1414815613139103653.8
PYIR_224351561313968654.0
CCI4073210525136259664.4
CCA224011561310945626.2
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_13454

Length=129
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_13454                                                            263        1e-91
PYIW_19970                                                            216        3e-73
PYU1_G001736                                                          166        2e-53
PYAP_17747                                                            156        2e-49
PHYRA_95903                                                           150        8e-47
PHYKE_8392                                                            143        3e-44
PHYSO_321155                                                          142        7e-44
PHYCA_11834                                                           142        8e-44
PPTG_17126                                                            142        9e-44
CCA17542                                                              141        2e-43
PITG_18455                                                            140        4e-43
PYVX_18180                                                            140        5e-43
PHALS_06479                                                           139        2e-42
CCI44820                                                              134        1e-40
SPRG_06335                                                            128        2e-38
SDRG_01782                                                            126        1e-37
HYAP_07103                                                            126        5e-37
H257_06293                                                            118        1e-34
H310_09224                                                            107        5e-30
CCI44232                                                              43.1       3e-05
HYAP_08499                                                            42.4       6e-05
HYAP_08500                                                            42.4       1e-04
PYAP_22846                                                            40.8       2e-04
CCA17521                                                              40.0       3e-04
PHYKE_5841                                                            40.4       4e-04
PITG_13739                                                            39.7       5e-04
PHALS_11564                                                           39.7       5e-04
PHYSO_315017                                                          39.7       6e-04
PPTG_09252                                                            38.1       0.002
PYAR_23207                                                            37.7       0.003
PYU1_G005963                                                          37.7       0.003
H310_07567                                                            37.0       0.005
PYVX_20854                                                            37.0       0.006
PHYCA_535380                                                          35.8       0.014
PHYRA_81675                                                           35.0       0.026
PYIR_15186                                                            35.0       0.034
SDRG_14912                                                            34.7       0.035
SPRG_12883                                                            34.7       0.037
PYIW_14743                                                            32.3       0.29 
H310_13870                                                            32.0       0.86 
PYVX_15150                                                            32.0       0.94 
CCI48720                                                              30.4       1.3  
SDRG_05420                                                            30.8       1.3  
H257_07358                                                            30.0       1.8  
PYU1_G013156                                                          30.4       1.8  
PYAR_14148                                                            29.6       3.8  
PYIR_22435                                                            29.6       4.0  
CCI40732                                                              30.0       4.4  
CCA22401                                                              28.5       6.2  

>PYIR_13454
Length=129

 Score = 263 bits (671),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/129 (100%), Positives = 129/129 (100%), Gaps = 0/129 (0%)

Query  1    MASTAAAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLAR  60
            MASTAAAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLAR
Sbjct  1    MASTAAAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLAR  60

Query  61   AQSSIGYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLL  120
            AQSSIGYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLL
Sbjct  61   AQSSIGYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLL  120

Query  121  RRQHFMDRK  129
            RRQHFMDRK
Sbjct  121  RRQHFMDRK  129

>PYIW_19970
Length=130

 Score = 216 bits (551),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)

Query  11   DLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
            DLRPVYKKLL+LAKTLPEGKR+ T  QIRSEFR+RK++SDPKELNALLARAQSSI YLKI
Sbjct  12   DLRPVYKKLLQLAKTLPEGKRETTRQQIRSEFRSRKELSDPKELNALLARAQSSISYLKI  71

Query  71   VTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129
            VTPRKSSDAGVKNYIYKNGQRVEA +V+EDGAKY +PDYN QM RHQKLLRRQHFMDRK
Sbjct  72   VTPRKSSDAGVKNYIYKNGQRVEAAAVMEDGAKYQLPDYNGQMLRHQKLLRRQHFMDRK  130

>PYU1_G001736
Length=123

 Score = 166 bits (421),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 97/122 (80%), Gaps = 0/122 (0%)

Query  8    ALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGY  67
            A  DLRP+YKKLLKLA+TLP  KR  T+ QIR EFRT     DPKE+ ALLARAQSSIGY
Sbjct  2    ASSDLRPMYKKLLKLAQTLPADKRQTTVEQIRREFRTHNGTKDPKEIAALLARAQSSIGY  61

Query  68   LKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127
            LKIVTPR +SDAGVKNY+Y  G+RVEA    EDGA+Y   DYNAQMQRH +LLRRQHFMD
Sbjct  62   LKIVTPRATSDAGVKNYVYIKGKRVEAAGAAEDGARYKTADYNAQMQRHVQLLRRQHFMD  121

Query  128  RK  129
            RK
Sbjct  122  RK  123

>PYAP_17747
Length=134

 Score = 156 bits (395),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 100/124 (81%), Gaps = 3/124 (2%)

Query  8    ALGDLRPVYKKLLKLAKTLP-EGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66
            A  +LRP+YK+LL+LAK+LP E KR+AT+ QIRSEFR+ KD  DPKE+ AL+ RAQ+ IG
Sbjct  2    ATSELRPLYKRLLRLAKSLPDEHKREATMQQIRSEFRSVKDAGDPKEVAALVQRAQAKIG  61

Query  67   YLKIVTPRKSSDAGVKNYIYKNGQRVEATSVL--EDGAKYSIPDYNAQMQRHQKLLRRQH  124
            YLKIVTPR ++DAGVK+++Y NG+RV+++ V   E+GA+Y   D+   M+RH +LLRRQH
Sbjct  62   YLKIVTPRSTADAGVKSFVYVNGKRVDSSDVQTREEGARYKTIDFEGNMRRHNQLLRRQH  121

Query  125  FMDR  128
            FMDR
Sbjct  122  FMDR  125

>PHYRA_95903
Length=134

 Score = 150 bits (378),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  11   DLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
            +LRP+YKKLL+LA++LPE KR  +L QIR EFR+ ++++DPKE++AL+ RAQSS+GYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQQSLDQIRREFRSHEELTDPKEVSALIQRAQSSLGYLKI  64

Query  71   VTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127
            VTPR  S+ G++ YIY+NGQRV A  V    E+ A+Y   D    ++RH +LLRRQHFMD
Sbjct  65   VTPRAESNKGIQRYIYRNGQRVNADEVEAHGEENARYKTQDIEGGLKRHHQLLRRQHFMD  124

Query  128  RK  129
            RK
Sbjct  125  RK  126

>PHYKE_8392
Length=138

 Score = 143 bits (361),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 94/129 (73%), Gaps = 5/129 (4%)

Query  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
            A A  +LRP+YKKLL++A+ LPE KR  +L+QIR EFR   D+SDPKE++ LL  AQSS+
Sbjct  2    AEAARELRPLYKKLLRMAQALPEPKRHQSLSQIRREFRNHGDLSDPKEVSKLLQLAQSSL  61

Query  66   GYLKIVTPR--KSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLL  120
             YLKIVTPR    S++GV+ YIY+NGQRV A  + E G   A+Y   D  A ++RH +L+
Sbjct  62   SYLKIVTPRDETESNSGVQRYIYRNGQRVNAAELEEKGEENARYKTQDMEAGLKRHHQLM  121

Query  121  RRQHFMDRK  129
            RRQHFMDRK
Sbjct  122  RRQHFMDRK  130

>PHYSO_321155
Length=136

 Score = 142 bits (359),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 95/127 (75%), Gaps = 3/127 (2%)

Query  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
            A A  +LRP+YKKLL+LA++LPE KR+ +L QIR EFR+  D++DP+ ++AL+ RAQSS+
Sbjct  2    AEAARELRPLYKKLLRLAQSLPEPKREQSLDQIRREFRSHGDLTDPEGVSALIQRAQSSL  61

Query  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRR  122
             YLKIVTPR  S+ GV+ +IY+NGQRV A       E+ A+Y   D  A ++RH +LLRR
Sbjct  62   SYLKIVTPRGESNTGVQRFIYRNGQRVNAAEFEAKGEENARYKTQDIEAGLKRHHQLLRR  121

Query  123  QHFMDRK  129
            Q+FMDRK
Sbjct  122  QYFMDRK  128

>PHYCA_11834
Length=134

 Score = 142 bits (358),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 95/122 (78%), Gaps = 3/122 (2%)

Query  11   DLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
            +LRP+YKKLL+LA++LPE KR  ++ QIR EFR+ +D++DPKE++ LL RAQSS+GYLKI
Sbjct  5    ELRPLYKKLLRLAQSLPEPKRQTSIDQIRREFRSHEDLTDPKEVSKLLQRAQSSLGYLKI  64

Query  71   VTPRKSSDAGVKNYIYKNGQRVEATSVL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMD  127
            VTPR  S+ GV+ +IY++G+RV A  +    E+ A++   D  A ++RH +LLRRQ+FMD
Sbjct  65   VTPRAESNTGVQRFIYRDGKRVNAEELEGKGEENARWKTQDMEAGLKRHHQLLRRQYFMD  124

Query  128  RK  129
            RK
Sbjct  125  RK  126

>PPTG_17126
Length=136

 Score = 142 bits (358),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 95/127 (75%), Gaps = 3/127 (2%)

Query  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
            A A+ +LRP+YKKLL+LA++LPE KR +++ QIR +FR   D++DP+E++AL+ RAQSS+
Sbjct  2    AEAMRELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRNHGDLTDPQEVSALIQRAQSSL  61

Query  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRR  122
             YLKIVTPR  S+ GV+ YIY+NGQRV A    E G   A++   D    ++RH +LLRR
Sbjct  62   SYLKIVTPRAESNMGVQRYIYRNGQRVNADEFEEKGEENARWKTQDMEGGLRRHHQLLRR  121

Query  123  QHFMDRK  129
            Q+F+DRK
Sbjct  122  QYFLDRK  128

>CCA17542
Length=120

 Score = 141 bits (355),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)

Query  9    LGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
            + D R +YK+L++LAK+LP  K+ ATL  IR+EFR  +D+SDP +L+ LL RAQS+IGYL
Sbjct  1    MSDTRSIYKRLIRLAKSLPAEKQAATLLNIRTEFRKHRDISDPTQLSQLLERAQSTIGYL  60

Query  69   KIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDR  128
            KIVTP K SD+GVK +++K+G+R+E      + A++ + D    ++RH +LLRRQHFMDR
Sbjct  61   KIVTPHKRSDSGVKRFMFKDGERIEENLKASERARFKVQDIGEGLKRHHQLLRRQHFMDR  120

>PITG_18455
Length=132

 Score = 140 bits (353),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 94/124 (76%), Gaps = 3/124 (2%)

Query  9    LGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
            + +LRP+YKKLL+LA++LPE KR +++ QIR +FR+  D +DPKE++AL+ RAQSS+ YL
Sbjct  1    MSELRPLYKKLLRLAQSLPEPKRQSSIDQIRRDFRSHGDPTDPKEVSALIQRAQSSLSYL  60

Query  69   KIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRRQHF  125
            KIVTPR  S+ GV+ YIY+NGQRV A    E G   A++ + D    ++RH +LL+RQ+F
Sbjct  61   KIVTPRAESNTGVQRYIYRNGQRVNAAEFEEKGVENARWKMQDMEGGLKRHHQLLQRQYF  120

Query  126  MDRK  129
            M+RK
Sbjct  121  MNRK  124

>PYVX_18180
Length=135

 Score = 140 bits (353),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query  7    AALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66
            A+  +LRP+YKKLL+LA++LPE KR +T+AQIR+EFR+  +V+D  E+  LL RAQS +G
Sbjct  2    ASPAELRPLYKKLLRLAQSLPEPKRASTVAQIRTEFRSHAEVTDAAEVAKLLQRAQSQLG  61

Query  67   YLKIVTPRKSSDAGVKNYIYKNGQRV---EATSVLEDGAKYSIPDYNAQMQRHQKLLRRQ  123
            YLKIVTPR  S +GVK YIY+NGQRV    A +  EDGA+Y  PD    ++RH +LLRRQ
Sbjct  62   YLKIVTPRGPSASGVKRYIYRNGQRVDADAAEAAGEDGARYKTPDMEGALKRHHQLLRRQ  121

Query  124  HFMDR  128
            HFMDR
Sbjct  122  HFMDR  126

>PHALS_06479
Length=136

 Score = 139 bits (349),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
            + A  +LRP+YKKLL+LA+ LP+ KR +++ QIR EFR  +D++DPKE++  + RAQSS+
Sbjct  2    SNATRELRPLYKKLLRLAQNLPQSKRQSSIDQIRREFRCHEDLTDPKEVSEFIQRAQSSL  61

Query  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDG---AKYSIPDYNAQMQRHQKLLRR  122
             YLKI+TPR  S+ GV+ +IY+NGQRV A    + G   A++   D  A  +RH +LLRR
Sbjct  62   SYLKIITPRTESNTGVQRFIYRNGQRVNAADFEKKGNENARWKTQDMEAGYKRHHQLLRR  121

Query  123  QHFMDRK  129
            Q+FMDRK
Sbjct  122  QYFMDRK  128

>CCI44820
Length=123

 Score = 134 bits (336),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (74%), Gaps = 0/122 (0%)

Query  7    AALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIG  66
             A+ + R ++KK++KLAK+LP  K+  TL  IR+EFR  +D+ DP +L  LL RAQS+IG
Sbjct  2    TAVNETRRIFKKMVKLAKSLPVEKQAGTLLNIRAEFRKHRDIRDPIQLAQLLERAQSTIG  61

Query  67   YLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFM  126
            YLKIVTP K SD+GVK+++YK+G+R+E +    + AK+ + D    ++RH +L+RRQ+FM
Sbjct  62   YLKIVTPHKRSDSGVKHFVYKDGERIEKSLQAGEKAKFKVQDMEEGLKRHNQLIRRQYFM  121

Query  127  DR  128
            DR
Sbjct  122  DR  123

>SPRG_06335
Length=123

 Score = 128 bits (321),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 1/119 (1%)

Query  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71
            +R  YKKLLKLAK++P+ +R  TL ++R+EFR     + P+EL+ LL +AQS I YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRTEFRAHTGAATPEELDQLLRKAQSKISYLKIV  64

Query  72   TPRKSSDAGVKN-YIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129
            TP+KS   G  N ++YKNGQR++   +  D A     DYNA M +H +L+RRQHFMDRK
Sbjct  65   TPKKSPSPGQGNHFVYKNGQRIDGRELSADSATIKTADYNAMMTKHVQLVRRQHFMDRK  123

>SDRG_01782
Length=123

 Score = 126 bits (317),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 84/119 (71%), Gaps = 1/119 (1%)

Query  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71
            +R  YKKLLKLAK++P+ +R  TL ++R EFR  +  + P+EL+ LL +AQS I YLKIV
Sbjct  5    IRAAYKKLLKLAKSVPQEQRAQTLEKVRHEFRAHEGAATPEELDQLLRKAQSKISYLKIV  64

Query  72   TPRKSSDAGV-KNYIYKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129
            TP+KSS +    +++YKNGQR++   +  D A     DYNA M +H +L+RRQHFMDRK
Sbjct  65   TPKKSSSSTQGSHFVYKNGQRIDGRELSADSATIKTHDYNAMMTKHVQLVRRQHFMDRK  123

>HYAP_07103
Length=164

 Score = 126 bits (316),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 93/156 (60%), Gaps = 38/156 (24%)

Query  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71
            +RP+YKKLL+LA++LPE KR  +L QIR EFR   D++DPKE+++LL RAQSSI +LKIV
Sbjct  1    MRPLYKKLLRLAQSLPEPKRQKSLDQIRREFRIHGDLTDPKEVSSLLQRAQSSIDFLKIV  60

Query  72   TPRKS-----------------------------------SDAGVKNYIYKNGQRVEATS  96
            TPR                                     SD G++ ++Y++G+R++A  
Sbjct  61   TPRAESGGFMASLAFSIMCLTLSLFSVLLLLLHHYFSCFFSDTGIQRFVYRDGKRIDAAE  120

Query  97   VL---EDGAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129
            +    E+ A+Y   D  A M+RH +LLRRQHFMDRK
Sbjct  121  LKKKGEENARYKTQDIEAGMKRHHQLLRRQHFMDRK  156

>H257_06293
Length=123

 Score = 118 bits (296),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 88/120 (73%), Gaps = 3/120 (3%)

Query  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71
            +R  YKKL+KLA++LP  ++   L +IR +FR+R  +S  +EL+ L+ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPADQKPTALDKIRHDFRSRGVISTAEELDKLVMKAQSKISYLKIV  64

Query  72   TPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSI--PDYNAQMQRHQKLLRRQHFMDRK  129
            TP+++  +G + +IYK+G+R+++ S L+DG   +I   D NA M+RH KL+RRQHFMDRK
Sbjct  65   TPKRTPQSGPQRFIYKDGKRLDSQS-LDDGGNRTIKTTDVNAMMERHVKLIRRQHFMDRK  123

>H310_09224
Length=123

 Score = 107 bits (266),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 80/119 (67%), Gaps = 1/119 (1%)

Query  12   LRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIV  71
            +R  YKKL+KLA++LP  ++   L ++R EFR+   ++   +L+ ++ +AQS I YLKIV
Sbjct  5    VRTAYKKLIKLAQSLPAEQKPVALDKVRHEFRSHGVITSSDQLDKIVMKAQSKISYLKIV  64

Query  72   TPRKSSDAGVKNYIYKNGQRVEATSVLED-GAKYSIPDYNAQMQRHQKLLRRQHFMDRK  129
            TP+++     + YIYK+G+R++   + +   A     D+NA M+RH KL+RRQHFMDRK
Sbjct  65   TPKRAPQTSPQRYIYKDGKRLDPGCIDQSTNATIKTVDFNAMMERHVKLVRRQHFMDRK  123

>CCI44232
Length=105

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 45/88 (51%), Gaps = 17/88 (19%)

Query  15   VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVTPR  74
            +Y+++L+LA+  P  KRDA +  IR EFR  ++++ P  +   +A               
Sbjct  9    LYRRILRLARRYPSIKRDAIVEDIRLEFRESRNIARPAAIEQKIA---------------  53

Query  75   KSSDAGVKN-YIYKNGQRVEATSVLEDG  101
             S++AG+K   +Y N   VEA   +E G
Sbjct  54   -SANAGIKELMMYANLNPVEANWTVEIG  80

>HYAP_08499
Length=108

 Score = 42.4 bits (98),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA+  P  KR + +  I+SEFR  +++SD +++   LA  Q+ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  65

>HYAP_08500
Length=172

 Score = 42.4 bits (98),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  15   VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
            +Y+++LKLA+  P  KR + +  I+SEFR  +++SD +++   LA  Q+ I  L +
Sbjct  74   MYRRILKLAQRYPSIKRQSIICDIKSEFRANRNLSDAQKVRKELAVVQAGIKELSM  129

>PYAP_22846
Length=104

 Score = 40.8 bits (94),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+ +LKLAK  P  KRDA +  I+ EF   K  +D + +   +A AQ+ I  L +
Sbjct  10  LYRHILKLAKQYPSVKRDAIIQDIKLEFHEGKHATDARTIQHKIAAAQAGIKELSM  65

>CCA17521
Length=104

 Score = 40.0 bits (92),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 20/106 (19%)

Query  15   VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVTPR  74
            +Y+++L+LA+  P  KRDA +  IR EFR  +D++    ++  +A               
Sbjct  9    LYRRILRLARRYPSIKRDAIINDIRMEFRESRDITTAAIIDHKIA---------------  53

Query  75   KSSDAGVKNYI-YKNGQRVEATSVLEDGAKYSIPDYNAQMQRHQKL  119
             S++AG+K  + Y N   V+    +E G     P   A M R  K+
Sbjct  54   -SANAGIKELLMYANLNPVDPNWTVEIGRPSEKP---ADMDRDVKI  95

>PHYKE_5841
Length=121

 Score = 40.4 bits (93),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (67%), Gaps = 0/51 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
           +Y+++LKLA+  P  KRD+ +  I++EF   K ++D +++   LA A++ I
Sbjct  10  MYRRILKLAQRYPSVKRDSIIRDIKTEFHAHKGLTDAQKIREELASARAGI  60

>PITG_13739
Length=105

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA+  P  KR++ +  I++EF   KD++D +++   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGITELSM  65

>PHALS_11564
Length=107

 Score = 39.7 bits (91),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           VY++LLKLA+  P  KR+A +  I+ EF     ++D +++   +A A + I  L +
Sbjct  10  VYRRLLKLAQHYPSIKREAIIRDIKEEFHANAIITDAQKICEAMASAHAGIKELSM  65

>PHYSO_315017
Length=109

 Score = 39.7 bits (91),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA+  P  KR++ +  I++EF   KD++D +++   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSVKRESIIRDIKTEFHANKDLTDAQKIREELASVRAGIKELSM  65

>PPTG_09252
Length=105

 Score = 38.1 bits (87),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 36/56 (64%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA+  P  KR++ +  I++EF   K+++D +++   LA  ++ I  L +
Sbjct  10  LYRRILKLAQRYPSVKRESIIRDIKTEFHANKNLTDAQKIREELASVRAGITELSM  65

>PYAR_23207
Length=112

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 0/54 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
           +Y+++L+LAK  P  KRDA +  I+ EF   K ++D   +   +A AQ+ I  L
Sbjct  13  LYRRVLQLAKQYPSIKRDALVEDIKLEFHEAKHLTDATAIEHKIAAAQAGIKEL  66

>PYU1_G005963
Length=103

 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (61%), Gaps = 0/51 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
           +Y+++LKLA   P  KR+A +  I+ EFR  K ++D   ++A +  A+  I
Sbjct  10  IYRRILKLAAQYPSIKRNAIIRDIKLEFRENKHLTDASAIHAKVQSARQGI  60

>H310_07567
Length=98

 Score = 37.0 bits (84),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDP  51
           +Y+++L+LAK  P  KRD  +  I++EF   K ++DP
Sbjct  10  IYRRVLQLAKKFPSIKRDQLVEDIKAEFHDNKVLTDP  46

>PYVX_20854
Length=104

 Score = 37.0 bits (84),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 34/54 (63%), Gaps = 0/54 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
           +Y+++LKLA+  P  KRD+ +  I++EF   K +SD +++   +  A++ I  L
Sbjct  10  LYRRILKLAQRYPSVKRDSIVRDIKTEFHENKALSDAQQVREKIMAARAGIQEL  63

>PHYCA_535380
Length=108

 Score = 35.8 bits (81),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 33/56 (59%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA   P  KR++ +  I++EF   K ++D + +   LA  ++ I  L +
Sbjct  10  MYRRILKLAHRYPSIKRESIIRDIKTEFHANKSLTDAQRIREELASVRAGIKELSM  65

>PHYRA_81675
Length=106

 Score = 35.0 bits (79),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (61%), Gaps = 0/56 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKI  70
           +Y+++LKLA+  P  KR + +  I++EF   K ++D +++   LA  ++ I  L +
Sbjct  10  MYRRILKLAQRYPSIKRASIIRDIKTEFHANKHLTDAQKIREELASVRAGIKELSM  65

>PYIR_15186
Length=109

 Score = 35.0 bits (79),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 15/36 (42%), Positives = 24/36 (67%), Gaps = 0/36 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSD  50
           VY+++LKLA   P  KR+A + +I+ EF   K ++D
Sbjct  10  VYRRILKLAAQYPSIKRNAIIREIKLEFHANKHLTD  45

>SDRG_14912
Length=105

 Score = 34.7 bits (78),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
           +Y+++LKLA+  P  K+D  +A I++EF     ++D  ++   +A A   I  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>SPRG_12883
Length=105

 Score = 34.7 bits (78),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 0/54 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYL  68
           +Y+++LKLA+  P  K+D  +A I++EF     ++D  ++   +A A   I  L
Sbjct  9   IYRRVLKLAQRFPSIKKDQLVADIKAEFHENASLTDAAKIQEKIAIAVKGIEQL  62

>PYIW_14743
Length=105

 Score = 32.3 bits (72),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (63%), Gaps = 0/40 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKEL  54
           +Y+++LKLA   P  KR A + +I+ EF   K ++D  ++
Sbjct  10  LYRRILKLAAQYPSIKRSAIIREIKIEFHQNKTLTDSAKI  49

>H310_13870
Length=1107

 Score = 32.0 bits (71),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 13/99 (13%)

Query  10   GDLR--PVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNA-----LLARAQ  62
             DLR  P   +  ++A TLP  +      Q+R  FR R DVS    + +     +L R  
Sbjct  628  ADLRLPPHTPRTFQMALTLPATQTTVMCQQVRLVFRNRHDVSWTWTVTSFVPQTILTRRN  687

Query  63   SSIGYLKIVTPRKSSDAGVKNYIYKNGQRVEATSV-LED  100
            S +  ++ V P     AG  ++     QR   TS+  ED
Sbjct  688  SLLAEMQGVIPGMGQGAGSPSF-----QRKPTTSLDFED  721

>PYVX_15150
Length=746

 Score = 32.0 bits (71),  Expect = 0.94, Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query  42   FRTRKDVSDPKELNALLA--RAQSSIGYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLE  99
            FR+  D S+   +  +L   R+  S+ YL +V PR+  DA ++ +      R E   VL 
Sbjct  614  FRSEADTSESGRVEGILEMLRSNCSLQYLSLVMPREQHDASLERF---ERHRNEPLPVLG  670

Query  100  D  100
            D
Sbjct  671  D  671

>CCI48720
Length=114

 Score = 30.4 bits (67),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 25/102 (25%), Positives = 41/102 (40%), Gaps = 6/102 (6%)

Query  6    AAALGDLRPVYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSI  65
            AAAL      Y++  ++   LP   R     QIR EF   + V + +++  LL   +  +
Sbjct  15   AAALRQ----YREFQRVTAKLPTSTRSDIRRQIRVEFENCRFVEEEEQIQLLLRYGKEQL  70

Query  66   GYLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLEDGAKYSIP  107
             Y+  +     S    K  + +N +      V  D  K S P
Sbjct  71   KYVSSLVDTAVSKQHQKRKVNRNPEHTNGQGV--DAVKMSWP  110

>SDRG_05420
Length=118

 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 18/85 (21%)

Query  15  VYKKLLKLAKTLPEGKRDATL-AQIRSEFRTRKDVSDPKELNALLARAQSSIGYLKIVTP  73
           VY+  L+ A   PE    AT+ A ++ +FR +  V D K +  LLA A+  +  +     
Sbjct  11  VYRHCLQSAARCPEQTHRATMRAYVQMKFRDKAHVRDAKAIALLLADAKEELERM-----  65

Query  74  RKSSDAGVKNY---IYKNGQRVEAT  95
                    NY   +Y++GQ  +AT
Sbjct  66  ---------NYYHSMYQSGQTQKAT  81

>H257_07358
Length=98

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 0/40 (0%)

Query  15  VYKKLLKLAKTLPEGKRDATLAQIRSEFRTRKDVSDPKEL  54
           +Y+++L+LA   P  K+   +  I+ EF   K ++DP ++
Sbjct  10  IYRRVLQLANKFPSIKQKQLVQDIKLEFHENKALTDPAKI  49

>PYU1_G013156
Length=131

 Score = 30.4 bits (67),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  15  VYKKLLKLAKTLPEG-KRDATLAQIRSEFRTRKDVSDPKELNALLARAQSSIGYLK  69
           +Y + L+ A+  P+  +R+   A ++ +FR   DV DP  +  LLA A+  +  ++
Sbjct  14  LYAQCLRSARKCPQWEQREMMKAYVKMKFRHDADVQDPARIQRLLADAREELDQME  69

>PYAR_14148
Length=139

 Score = 29.6 bits (65),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (43%), Gaps = 5/103 (5%)

Query  3    STAAAALGDLRPVYKKLLKLAKTLPEG-KRDATLAQIRSEFRTRKDVSDPKELNALLARA  61
            +TA+A   D   +Y+  ++ A+  PE  +R+     +R +FR      D   +  LLA A
Sbjct  2    ATASALRKDALALYRACMRSARKCPEWEQREMMKTYVRMKFRDEVHTQDTSRIKRLLADA  61

Query  62   QSSIG----YLKIVTPRKSSDAGVKNYIYKNGQRVEATSVLED  100
            +  +     Y  +   ++   A V      NG    AT+ L D
Sbjct  62   REELERMDYYHSVYEEKQRQRAAVMGSNSTNGLSTNATAPLAD  104

>PYIR_22435
Length=139

 Score = 29.6 bits (65),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (56%), Gaps = 3/68 (4%)

Query  1   MASTAAAAL--GDLRPVYKKLLKLAKTLPEG-KRDATLAQIRSEFRTRKDVSDPKELNAL  57
           MA++AA A+   ++  +Y + L+ A+  P   +R+   A ++ +F    DV DP  + +L
Sbjct  1   MATSAARAILKREVLGLYAQCLRSARRCPAWEQREMMRAYVKMKFHHDADVQDPARIRSL  60

Query  58  LARAQSSI  65
           LA A+  +
Sbjct  61  LADAREEL  68

>CCI40732
Length=1362

 Score = 30.0 bits (66),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 30/59 (51%), Gaps = 8/59 (14%)

Query  56   ALLARAQSSIGYLKIVTPRKSSDAGV-----KNYIYKNGQRVEATSVLED---GAKYSI  106
            A+ A  +SS  ++ IVTP+K    G+       Y    GQ  +  S+L+D   G +++I
Sbjct  570  AIFATTESSCEFVSIVTPQKHDRIGIILDQTSFYAQAGGQVYDTGSLLKDQPVGTRFNI  628

>CCA22401
Length=109

 Score = 28.5 bits (62),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query  15  VYKKLLKLAKTLPEGK-RDATLAQIRSEFRTRKDVSDPKELNALL  58
           +Y+  L+ A+  PE + R+   A I+ +FR ++ + DP+ +  LL
Sbjct  8   LYRDCLRSARKCPEWQNREMVKAYIKLKFREQQSLRDPRAIKLLL  52

Lambda      K        H        a         alpha
   0.316    0.130    0.351    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3346599168

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40