Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_13453147571186118658670.0
PYIW_1879314757997102442030.0
PYU1_G0017341475780081234690.0
PYAP_17746147571169121529640.0
PHYSO_321157147571180121729250.0
PPTG_17128147571177122728880.0
PITG_18457147571170122328770.0
PHALS_06477147571166121926980.0
PHYRA_9590114757107598723710.0
H257_06305147571099119423510.0
H310_09212147571113120623180.0
PHYCA_344751475769274921190.0
SPRG_063541475788495420460.0
SDRG_0176414757109280419600.0
CCI45122147571105116718410.0
CCA18898147571147116718220.0
PYAR_13581147577303409423e-111
PHYKE_8394147574282226799e-78
PHYSO_48929614211098203910.14
PPTG_16221140501259172910.15
H310_0270966641390120900.18
PHYSO_360938495120050890.27
PHYRA_84534140501368153880.30
PHYCA_12536314211089141880.30
HYAP_00989495133050860.61
HYAP_1285012378697850850.69
HYAP_0862314050118782840.97
PYIR_202022856155546831.2
H310_091715928159797831.4
PPTG_08220495133550821.5
PPTG_239712842011260761.6
PITG_0161514211087109811.9
PHYCA_539991405094780812.1
PHYSO_318067140501368150812.3
PHYCA_51068649593250812.3
SDRG_0327366641325200812.4
PHYRA_809708480758143793.4
PHYRA_72635277476100783.8
PYU1_G007827126131649100784.4
CCA165302856151243775.7
CCI4451515145716136776.1
PYU1_G0024399340124981756.4
PYIW_1987210283998220777.0
PYAP_1444114367127176767.5
PHYRA_8059424621575108767.6
PHYSO_5166945929098546767.6
PITG_17549140501360150769.4
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_13453

Length=1186
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_13453                                                            2264       0.0   
PYIW_18793                                                            1623       0.0   
PYU1_G001734                                                          1340       0.0   
PYAP_17746                                                            1146       0.0   
PHYSO_321157                                                          1131       0.0   
PPTG_17128                                                            1117       0.0   
PITG_18457                                                            1112       0.0   
PHALS_06477                                                           1043       0.0   
PHYRA_95901                                                           917        0.0   
H257_06305                                                            910        0.0   
H310_09212                                                            897        0.0   
PHYCA_34475                                                           820        0.0   
SPRG_06354                                                            792        0.0   
SDRG_01764                                                            759        0.0   
CCI45122                                                              713        0.0   
CCA18898                                                              706        0.0   
PYAR_13581                                                            367        3e-111
PHYKE_8394                                                            266        9e-78 
PHYSO_489296                                                          39.7       0.14  
PPTG_16221                                                            39.7       0.15  
H310_02709                                                            39.3       0.18  
PHYSO_360938                                                          38.9       0.27  
PHYRA_84534                                                           38.5       0.30  
PHYCA_125363                                                          38.5       0.30  
HYAP_00989                                                            37.7       0.61  
HYAP_12850                                                            37.4       0.69  
HYAP_08623                                                            37.0       0.97  
PYIR_20202                                                            36.6       1.2   
H310_09171                                                            36.6       1.4   
PPTG_08220                                                            36.2       1.5   
PPTG_23971                                                            33.9       1.6   
PITG_01615                                                            35.8       1.9   
PHYCA_53999                                                           35.8       2.1   
PHYSO_318067                                                          35.8       2.3   
PHYCA_510686                                                          35.8       2.3   
SDRG_03273                                                            35.8       2.4   
PHYRA_80970                                                           35.0       3.4   
PHYRA_72635                                                           34.7       3.8   
PYU1_G007827                                                          34.7       4.4   
CCA16530                                                              34.3       5.7   
CCI44515                                                              34.3       6.1   
PYU1_G002439                                                          33.5       6.4   
PYIW_19872                                                            34.3       7.0   
PYAP_14441                                                            33.9       7.5   
PHYRA_80594                                                           33.9       7.6   
PHYSO_516694                                                          33.9       7.6   
PITG_17549                                                            33.9       9.4   

>PYIR_13453
Length=1186

 Score = 2264 bits (5867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/1186 (100%), Positives = 1186/1186 (100%), Gaps = 0/1186 (0%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
             MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI
Sbjct  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAATSTTPSSSMRFASSGASQPDVLAFQEI  60

Query  61    LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARLRQNVTSLTAARRNS  120
             LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARLRQNVTSLTAARRNS
Sbjct  61    LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARLRQNVTSLTAARRNS  120

Query  121   RLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQRITKGQLVKKKMAQNARLLPSVNKSD  180
             RLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQRITKGQLVKKKMAQNARLLPSVNKSD
Sbjct  121   RLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQRITKGQLVKKKMAQNARLLPSVNKSD  180

Query  181   PSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIKNSKTRIYDRQEQPIR  240
             PSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIKNSKTRIYDRQEQPIR
Sbjct  181   PSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIKNSKTRIYDRQEQPIR  240

Query  241   SMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQFVSKGGSSLLSPR  300
             SMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQFVSKGGSSLLSPR
Sbjct  241   SMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQFVSKGGSSLLSPR  300

Query  301   QYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLSTDQSQEAESPETNLDDE  360
             QYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLSTDQSQEAESPETNLDDE
Sbjct  301   QYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLSTDQSQEAESPETNLDDE  360

Query  361   VNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS  420
             VNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS
Sbjct  361   VNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVS  420

Query  421   FKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVN  480
             FKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVN
Sbjct  421   FKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVN  480

Query  481   EDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRA  540
             EDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRA
Sbjct  481   EDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRA  540

Query  541   FASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISAD  600
             FASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISAD
Sbjct  541   FASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISAD  600

Query  601   NFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYP  660
             NFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYP
Sbjct  601   NFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYP  660

Query  661   EQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGM  720
             EQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGM
Sbjct  661   EQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGM  720

Query  721   DPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKID  780
             DPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKID
Sbjct  721   DPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKID  780

Query  781   YDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPL  840
             YDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPL
Sbjct  781   YDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPL  840

Query  841   HPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTssns  900
             HPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNS
Sbjct  841   HPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTSSNS  900

Query  901   sssgggagkkagayrskTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVF  960
             SSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVF
Sbjct  901   SSSGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVF  960

Query  961   QEDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstks  1020
             QEDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKS
Sbjct  961   QEDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKS  1020

Query  1021  lkpshsraagatgtsaaDLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAF  1080
             LKPSHSRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAF
Sbjct  1021  LKPSHSRAAGATGTSAADLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAF  1080

Query  1081  FHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG  1140
             FHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG
Sbjct  1081  FHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG  1140

Query  1141  TQALMDEFMGGGESETGNFADVLAVIRALTGGKSAKLEKIRRLRRN  1186
             TQALMDEFMGGGESETGNFADVLAVIRALTGGKSAKLEKIRRLRRN
Sbjct  1141  TQALMDEFMGGGESETGNFADVLAVIRALTGGKSAKLEKIRRLRRN  1186

>PYIW_18793
Length=997

 Score = 1623 bits (4203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1024 (79%), Positives = 888/1024 (87%), Gaps = 30/1024 (3%)

Query  166   MAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIK  225
             MAQ+ARLLPSVNK DPSAPTPELSEQDAK+GMLSLVNRGFLPVG DLT AF+N+HG II+
Sbjct  1     MAQHARLLPSVNKCDPSAPTPELSEQDAKNGMLSLVNRGFLPVGTDLTSAFVNSHGGIIQ  60

Query  226   NSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAA  285
             N KTRIYDRQEQPIR++P TNPSGFN+A+LKFD+A    T   RE      PS  + A A
Sbjct  61    NHKTRIYDRQEQPIRAVPHTNPSGFNIATLKFDLA---ATAECREGDGSDSPSQHKAALA  117

Query  286   TQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVT---AAAML  342
                    GS L       +SA  R+RG  V+TV+FQGDA RGN  A+V S     +    
Sbjct  118   V----VNGSQL-----DHDSAETRARGPNVLTVSFQGDARRGNFHATVRSAQQQHSGIRH  168

Query  343   STDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLH  402
                 +QEAESPETN+D+++        D+ +DD +AMDELRKNVEKIRGYNELLDTYSLH
Sbjct  169   HASANQEAESPETNVDEDL------MYDEKDDDANAMDELRKNVEKIRGYNELLDTYSLH  222

Query  403   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462
             QFIIHKGRAMRETPEFVSFKRVAQEVWGSV+EVI+ALEALLTRYFVPLAY+DGQRLMTVA
Sbjct  223   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEALLTRYFVPLAYVDGQRLMTVA  282

Query  463   AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522
             AMEMA++SKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAA+TIQNFFRMWWNQKKY+
Sbjct  283   AMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAVTIQNFFRMWWNQKKYS  342

Query  523   RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582
             RFRHHLASVV IQRVWR +ASH+ LKR++K QR QQH QWEAKMQRLKRDW  IKGNRRV
Sbjct  343   RFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQWEAKMQRLKRDWIRIKGNRRV  402

Query  583   VIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKL  642
             VIHVPS S+DER R+SADNFSVKQN+QLSRLCGL+D NVDIVYVSPFELT DV QYSMKL
Sbjct  403   VIHVPSFSVDERLRLSADNFSVKQNLQLSRLCGLVDSNVDIVYVSPFELTTDVVQYSMKL  462

Query  643   LQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIP  702
             LQLGGIADPVARVKLV+PE A RFP HFSLTTLLLYSPHCLRRIQRYI+NKEAYLVTG+P
Sbjct  463   LQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSPHCLRRIQRYIKNKEAYLVTGMP  522

Query  703   GREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSL  762
             G EDKRLA+ALNVPILGMDPLSALPLMTKSG KRFFMRADVNVPTGTYDIYDEDELVFSL
Sbjct  523   GPEDKRLAMALNVPILGMDPLSALPLMTKSGGKRFFMRADVNVPTGTYDIYDEDELVFSL  582

Query  763   AKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAA  822
             AKLI+SHIEQSVWVLKIDYDPF TGTALLDVSTM  LREIRREK+SPEYW+QP TRDNAA
Sbjct  583   AKLIVSHIEQSVWVLKIDYDPFSTGTALLDVSTMVALREIRREKRSPEYWRQPGTRDNAA  642

Query  823   RAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPS  882
             R IIAELERTL +LVTPLHPE+YPSWQ++ DAI QFGVVVEAAPSAV+GHVRANLF+EPS
Sbjct  643   RVIIAELERTLGNLVTPLHPELYPSWQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPS  702

Query  883   GEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGASTAIGK  942
             GEVHVSSTQDI+ +     SSGG  GK  GAYR K+VGYAFPQTAAPYEAIRGASTAIGK
Sbjct  703   GEVHVSSTQDILLS-----SSGGCGGKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGK  757

Query  943   LLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSG  1002
             LLA++ VFGY+SID+LVFQEDK+H ARLWAMAL PYLTDSA+TF TFHLLNRGALN +SG
Sbjct  758   LLAEDNVFGYASIDFLVFQEDKSHTARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSG  817

Query  1003  LYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVSLEKAGAQRTYV  1062
             LY       + + +S   ++   S AA A+G SAADLV+ EATHSGLVSLEK GAQ TYV
Sbjct  818   LY----YLPAATVTSASLVQLQSSSAAFASGASAADLVLHEATHSGLVSLEKVGAQHTYV  873

Query  1063  VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSAS  1122
             VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG+MCCSD+AS
Sbjct  874   VSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTAS  933

Query  1123  GALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIRALTGGKSAKLEKIRR  1182
             GALGFLRTALEV+GREVGTQAL DEF  GGE+ETGNFADVLA IRALTGGKSAKLEKIRR
Sbjct  934   GALGFLRTALEVVGREVGTQALTDEFTSGGEAETGNFADVLAAIRALTGGKSAKLEKIRR  993

Query  1183  LRRN  1186
             LRRN
Sbjct  994   LRRN  997

>PYU1_G001734
Length=800

 Score = 1340 bits (3469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/812 (79%), Positives = 719/812 (89%), Gaps = 17/812 (2%)

Query  379   MDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRA  438
             MD+LRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEFVSFKRVAQE+WG VEEVI+A
Sbjct  1     MDDLRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKA  60

Query  439   LEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGK  498
             LE LLTRYFVPLAY+DGQRLMTVA+MEMA+FSK+DLLSCIVNEDQVGSLIRRPGQRYKGK
Sbjct  61    LETLLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGK  120

Query  499   DRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQ  558
             DRKRRAAITIQN FRMW NQKKY+R+R HL+SVV IQ+VWRA+ASHE L+RKLK QR QQ
Sbjct  121   DRKRRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQ  180

Query  559   HEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLID  618
             HEQWEA+MQRL+R+W  IK NRRV+IHVPSLSIDER RI ADNF+VKQN+QLSRLCG+ID
Sbjct  181   HEQWEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRLCGIID  240

Query  619   PNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLY  678
              NVDIVYVSPFELT++V QY MKLLQLGGIADPV RVKLV+PEQA RFPAHFSLTT+LLY
Sbjct  241   ANVDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLY  300

Query  679   SPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFF  738
             SPHCLRRI+R ++ KEAYLVTG+PG+EDKRLA+ALNVPILGMDPL+ LPLMTKSGSKRFF
Sbjct  301   SPHCLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATLPLMTKSGSKRFF  360

Query  739   MRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTV  798
             MRADVNVPTGTYDIYDEDEL+FSLAKLI+SHIEQ+VW+LKIDYDPFGTGTA++D S +T 
Sbjct  361   MRADVNVPTGTYDIYDEDELIFSLAKLIVSHIEQNVWLLKIDYDPFGTGTAIVDASVVTA  420

Query  799   LREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQF  858
             LREIRREKKSPEYW+QP TRDNAAR IIAELERT+  LVTPLHPEVYP+WQEF DAI+QF
Sbjct  421   LREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPTWQEFADAIAQF  480

Query  859   GVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskT  918
             GVV+EAAPSA++G++RANLF+EPSGEVHVSSTQD+I +              A  ++ K 
Sbjct  481   GVVIEAAPSAIVGYIRANLFVEPSGEVHVSSTQDVILS-------------TASIHKRKV  527

Query  919   VGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPY  978
              GYAFPQT APYEAIRGAS AIGK+L D+ VFGYSS+DYLVF+EDKTH  RLWAMALHPY
Sbjct  528   AGYAFPQTTAPYEAIRGASMAIGKVLVDDSVFGYSSVDYLVFREDKTHVPRLWAMALHPY  587

Query  979   LTDSASTFATFHLLNRGALNASSGLYh----lppvaaspsssstkslkpshsraagatgt  1034
             LTDSASTFA FHLLNRGALN  +G YH          S S++S+ SLK + S    A   
Sbjct  588   LTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRAAGSA  647

Query  1035  saaDLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVE  1094
             ++A+LV+QEATH GLVSLEKAGAQRTY V+EYIFHPNVSTMQYS+FFHTCRLHGVCFDVE
Sbjct  648   TSANLVLQEATHLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLHGVCFDVE  707

Query  1095  RCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGES  1154
             RC G++F+LADSLTAGVFGI+CC D+AS ALGFLRTALEVIGREVGTQAL D+  GGG+ 
Sbjct  708   RCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDDLRGGGDC  767

Query  1155  ETGNFADVLAVIRALTGGKSAKLEKIRRLRRN  1186
             E+GNFA+VL V+R LTGGKSAKLEKIRRLRR 
Sbjct  768   ESGNFAEVLTVVRTLTGGKSAKLEKIRRLRRG  799

>PYAP_17746
Length=1169

 Score = 1146 bits (2964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/1215 (51%), Positives = 798/1215 (66%), Gaps = 152/1215 (13%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
             M+Q QQ+HHVEDVGRILLQTQ+QLR +REQ+  ++   + S+  +++  ++      +EI
Sbjct  1     MEQLQQRHHVEDVGRILLQTQDQLRQLREQLVGSNGPGNGSVIASNNAGAE-----IEEI  55

Query  61    LQRAEVEIRAKAELVLNGFVNTSSQASA-----------LPTVSSSANGNASP-KARLRQ  108
             LQRAE E+R KAELVL+  V T+  AS            LPTV           KA L  
Sbjct  56    LQRAEDELRMKAELVLSNIV-TAGPASPGANDREGGLIPLPTVRRPPIARRRRRKAELHD  114

Query  109   NVTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQR-------ITKGQL  161
                            S + D++YFR RF   AV+  SS +  +P QR          G++
Sbjct  115   G-------------GSYDLDIEYFRQRFKRTAVDDASSTMTTAPRQRGGGPTPTHAHGKV  161

Query  162   VKKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFIN---  218
             VK K   NARLLP VNK DP+AP P LS  DAK G+LSL+NRGFLP   DLTPAF +   
Sbjct  162   VKHKTTSNARLLPFVNKYDPTAPRPVLSPVDAKQGVLSLLNRGFLPPNVDLTPAFQSVSS  221

Query  219   -----NHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENS-  272
                  N  S+I+N   +++ R+EQP+R+   ++P  FN+A+LKFD+A  +T  +    S 
Sbjct  222   PKSQGNPTSVIQNGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSI  281

Query  273   ---NGSEPSLQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNL  329
                + SE    R           G S  SPR      N R            G    GN 
Sbjct  282   EPHDESEALPLRAMKTVTISFHNGKSESSPRN-----NARES-------EHDGRREDGND  329

Query  330   QASVGSVTAAAMLSTDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKI  389
              A +               E E  +   D+  NS               M++LR NVEKI
Sbjct  330   TAPL---------------EREDLDVTADEAANS---------------MEDLRNNVEKI  359

Query  390   RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVP  449
             RGYNELLD YSLHQFIIHKGRA+R+TPEF SFKRVAQE+WGS+EEVI+ALE LLTRYFVP
Sbjct  360   RGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILLTRYFVP  419

Query  450   LAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  509
             LAYIDGQRLMT+A+MEMA  S  +LL+C+VNEDQV SLIRRPGQRYKGKDRKRRAA T+Q
Sbjct  420   LAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRRAATTLQ  479

Query  510   NFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRL  569
              FFRM  ++ ++ + R + +S + IQ+ WR++A  +SL+R+L   R ++  +W+AK++R+
Sbjct  480   AFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWKAKVRRM  539

Query  570   KRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPF  629
             +  W  I+  RRVVIHV S+S+DER+R+S +NFSVKQN+QLSRL GL+D NV+IVYV+PF
Sbjct  540   RSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRLAGLVDQNVEIVYVTPF  599

Query  630   ELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRY  689
             EL+ +V+QY +KLLQL GIA+   RV+LV+PE AA+FP HFSL T L+YSP+C+RRIQR 
Sbjct  600   ELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPNCIRRIQRL  659

Query  690   IRNKEAYLVTGIPGREDKRLAVALNVPILG-MDPLSALPLMTKSGSKRFFMRADVNVPTG  748
             ++ KEAYLV G+PG ED+RLAVAL VPILG  DP S LPLMT+SGSKRFF++ADVNVPTG
Sbjct  660   VQGKEAYLVMGVPGPEDQRLAVALQVPILGPEDPTSILPLMTRSGSKRFFIKADVNVPTG  719

Query  749   TYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKS  808
             TYDIYD DEL+FSLAKLI+SH+ Q+VW+LK+D DP GTGTA+LDVS MT LR+IRREK+ 
Sbjct  720   TYDIYDIDELLFSLAKLIISHLNQNVWLLKLDADPLGTGTAILDVSLMTTLRDIRREKRP  779

Query  809   PEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSA  868
             PEYWKQP  RD  ARA++ ELER +  L+ P HPE++ SW+EF  AI +FGVVVEA P  
Sbjct  780   PEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFASWKEFASAIPEFGVVVEALPFH  839

Query  869   VIGHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAA  928
             V G +R N+FIEPSG+VHV ST D+++          G G      + +   + FPQT  
Sbjct  840   VAGVIRMNIFIEPSGDVHVMSTNDVLS----------GNGTTLSQRQRRPAAFVFPQTLV  889

Query  929   PYEAIRGASTAIGKLLADECVF-GYSSIDYLVFQEDKT----HAARLWAMALHPYLTDSA  983
             P+EAI GAS+A+G++L +E  F GY+S+D  + QE+       A RLWA++L PYLTDSA
Sbjct  890   PHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKAERLWAVSLFPYLTDSA  949

Query  984   STFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQE  1043
             +TFA FH L+RG LN ++G Y                                 +L  +E
Sbjct  950   ATFAAFHALHRGVLNPATGRY---------------------------------NLTARE  976

Query  1044  AT----HSGLVS-----LEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVE  1094
             +T     S LVS     L++ GA R+Y V+EY+FHPNVS M Y+AFFHTCRLHGVCFDVE
Sbjct  977   STPPESDSALVSSVIGTLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVE  1036

Query  1095  RCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALM--DEFMGGG  1152
             RCVGSVFLLADSLTAG+FG++   +SA+ AL +LRTA EVIGREVGTQ+++  D  +G  
Sbjct  1037  RCVGSVFLLADSLTAGIFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSS  1096

Query  1153  ESETGNFADVLAVIR  1167
                +GNFA++L ++R
Sbjct  1097  VQLSGNFAEILGLLR  1111

>PHYSO_321157
Length=1180

 Score = 1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 621/1217 (51%), Positives = 822/1217 (68%), Gaps = 96/1217 (8%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfa--ssgasQPDVLAFQ  58
             M++ QQQHHVEDVGR+LLQTQEQLR+MREQM A +    ++      S+  +  +V AF 
Sbjct  1     MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  59    EILQRAEVEIRAKAELVLNGFVNTSSQ--------ASALPTVSSSANGNASPKARLRQNV  110
              ILQ+ E E+RAKAELVLNG VN+SS          + LP V+ +A     P  R R   
Sbjct  61    AILQQTEAELRAKAELVLNGMVNSSSSAQNNQSQSGTLLPAVTVAA----PPSTRHRSGY  116

Query  111   TSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPV--QR---ITKGQLVKKK  165
                  A+  S  AS  P +++FR +F N +VE V   ++PSP+  QR   I  G+L++KK
Sbjct  117   AKPRVAK--SMDASSIP-MEFFREQFRNSSVE-VRQTLMPSPLHLQRHLGIHHGRLMRKK  172

Query  166   MAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFIN-------  218
               Q+ RLLPSVNK DPSAPTPEL E+DAK G+L+LV RGFLP  ADLTPAF         
Sbjct  173   TTQHCRLLPSVNKVDPSAPTPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPSGANDG  232

Query  219   NHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPS  278
             + G ++K   TRI+DR EQ +R  P T  +G+N+A+LKFD+  P T       S+    +
Sbjct  233   SGGGVMKQRATRIHDRSEQSVRPTPFTQSTGYNLAALKFDLRAPFTPPPPAPESSPPATA  292

Query  279   LQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTA  338
               R  +  +  +  G S ++    E++   +S           G +VR   Q+S+ S   
Sbjct  293   TTRRRSTRRGSAGHGPSKVTMSFPESARADKS-----------GRSVR---QSSLVSAAI  338

Query  339   AAMLSTDQSQEAESPETNLDDE----VNSGGndnadddnddTSAMDELRKNVEKIRGYNE  394
             AA   T+QS + E       ++    ++    ++ +++ D+ + M+EL  NV+KIRGYNE
Sbjct  339   AAF--TNQSDDLEDNRERFSEQPDEEISDEEQEDDENEKDEEAEMEELGANVDKIRGYNE  396

Query  395   LLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYID  454
             LLD YSLHQF+IHKGR MR+TPEFVSF+RVAQE+WGSVEE +RALE LLT+YFVPLAY D
Sbjct  397   LLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYAD  456

Query  455   GQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRM  514
             GQRL+++A+     FSKR+LLSCIVNE+QV +++RRPGQRYKG+DRKRRAA TIQ   RM
Sbjct  457   GQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRKRRAATTIQACVRM  516

Query  515   WWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWT  574
             W  +++Y R R    S   IQ  WRAF+ H +LK +L+  R +Q + WEAKM  LK  W 
Sbjct  517   WSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDNWEAKMNDLKTQWH  576

Query  575   HIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVSPFELT  632
              I G RRVV+HVPSLS+DE SR+SA+NF+V+QN+QL+R+C   +D NVD +VYV+PFELT
Sbjct  577   QIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSNVDLLVYVAPFELT  636

Query  633   ADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRN  692
             ADV+ Y +KLLQLGG+AD   RVKLV+PEQAARFPAHFSL+++LLYSPHCLRRI+ Y   
Sbjct  637   ADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYSPHCLRRIRHYTAG  696

Query  693   KEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDI  752
             K+AYLV G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +RADVNVPTGTY++
Sbjct  697   KDAYLVMGLPGTEDQRLAIALDLPILGAPPPQALPLLTRSGGKRLLIRADVNVPTGTYEL  756

Query  753   YDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYW  812
             YDE EL  +LAKL ++H++Q  W+LK+DYDP G G A++D+S M  +RE+RREKK+PEYW
Sbjct  757   YDEHELFAALAKLAVAHMDQPRWLLKLDYDPLGVGEAVVDLSGMQAMRELRREKKTPEYW  816

Query  813   KQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAP----  866
             +QP  RD A++ ++AELER   LA L TP+H E++PSW+E+ +AIS FG VVEA P    
Sbjct  817   RQPGPRDAASKLVLAELERPGVLARLATPMHTEIFPSWREYTEAISHFGCVVEAVPPTSF  876

Query  867   ---------SAVIGHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrsk  917
                      S    +VRANLFI+P G VH++STQ+++ +               G    K
Sbjct  877   VASPETASSSVEPAYVRANLFIDPDGTVHITSTQNVLAS--------------GGGLNRK  922

Query  918   TVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALH  976
             TV + FPQT AP+EA++GA TA GKLL +  V+GY S+D++VFQ+DK+  A RLWA+A+H
Sbjct  923   TVAFTFPQTVAPHEAVKGACTAAGKLLVETNVWGYVSLDFVVFQDDKSGGAPRLWALAVH  982

Query  977   PYLTDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsa  1036
             P+LTDSA++FA FHLL RG L+ASSG Y            +  +   +   +  + G   
Sbjct  983   PFLTDSAASFACFHLLARGVLDASSGGY----------RMAAANSTLAAVNSGRSGGGGT  1032

Query  1037  aDLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERC  1096
              DL+++EA+   L    +AG  R YVV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER 
Sbjct  1033  TDLLLREAS---LAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERT  1089

Query  1097  VGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMG-GGESE  1155
             +G++FLL DSLTAGVFG++   ++  GAL F+RTALEVIGRE G    M       G + 
Sbjct  1090  LGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMATSPSRPGSAR  1149

Query  1156  TGNFADVLAVIRALTGG  1172
             +GNFA VL+ +RA TGG
Sbjct  1150  SGNFAQVLSAVRASTGG  1166

>PPTG_17128
Length=1177

 Score = 1117 bits (2888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/1227 (50%), Positives = 822/1227 (67%), Gaps = 92/1227 (7%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfa--ssgasQPDVLAFQ  58
             M++ QQQ HVEDVGR+LLQTQEQLR+MREQM A +    ++      S+  +  +V AF 
Sbjct  1     MEKVQQQQHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAIVTTAEVQAFN  60

Query  59    EILQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARL-----RQNVTSL  113
              ILQ+ E E+R+KAELVLNG VN+S+ A    T S    GN  P   +      ++ +  
Sbjct  61    AILQQTETELRSKAELVLNGMVNSSNNAQNNQTQS----GNFLPAVTVAALPSTKHRSGY  116

Query  114   TAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPV-LPSPVQR---ITKGQLVKKKMAQN  169
               A +  ++ +    +++FR +F N +VE   S +  P P QR   +  G+L++KK  Q+
Sbjct  117   NGANKPRQMDASSIPMEFFREQFRNSSVEIRQSLMPSPEPWQRHFGVHHGRLMRKKTTQH  176

Query  170   ARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGS-------  222
              RLLPSVNK DPSAP PEL E+DAK G+L+LV RGFLP  ADLTPAF   +G+       
Sbjct  177   CRLLPSVNKVDPSAPAPELREEDAKHGVLNLVTRGFLPAYADLTPAFAGPNGTSNGSCGG  236

Query  223   IIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRT  282
             I+K   TRIYDR EQ +RS P T  +G+N+ASLKFD+  P T       S    P     
Sbjct  237   IMKQRATRIYDRSEQAVRSTPFTQSTGYNLASLKFDLCAPPTPPPPIPESKDLMPP----  292

Query  283   AAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNF--QGDAVRGNLQASVGSVTAAA  340
                         S    R    S+ V+  G   VT++F   G+ V+ +  A   S+ +AA
Sbjct  293   -----------ESTTRRRSVRKSSAVQ--GPNRVTMSFPKSGNKVKNSRSAHQTSLMSAA  339

Query  341   MLS-TDQSQEAESPETNL-DDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDT  398
             + + T+Q ++ ++      DD+V+    +N ++  D+ + M+EL  NV+KIRGYNELLD 
Sbjct  340   VAAFTNQGEDMDNNRGRFSDDDVSDEDQENDENGKDEDAEMEELGANVDKIRGYNELLDA  399

Query  399   YSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRL  458
             YSLHQF+IHKGR MR+TPEF+SF+RVAQE+WGSVEE +RALEALLT+YFVPLAY+DGQRL
Sbjct  400   YSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEALLTQYFVPLAYVDGQRL  459

Query  459   MTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQ  518
             + +A      FSKR+LLSCIVNEDQ+ S++RRPGQRYKG+DRKRRAA T+Q   RMW  +
Sbjct  460   LALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRKRRAATTVQACIRMWLVR  519

Query  519   KKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKG  578
             ++Y R R    +   IQ  WRA++ H +LK +L+  R ++ E+WE +M  LK  W+ I  
Sbjct  520   RRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEKWEKRMCTLKSQWSQIAA  579

Query  579   NRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGL-IDPNVD-IVYVSPFELTADVA  636
              RRVV+HVPSLS+DE  R+SA+NF+V+QN+QL+R+C + +D NVD +VYVSPFELTADV 
Sbjct  580   RRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSNVDLLVYVSPFELTADVL  639

Query  637   QYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAY  696
             QY +KLLQLGG+ D   RVK V+PEQ+ RFPAHFSL++LLLYSPHCLRRI+ Y   KEAY
Sbjct  640   QYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAY  699

Query  697   LVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDED  756
             LV G+PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +RADVNVP GTY++YDE 
Sbjct  700   LVMGLPGAEDQRLAIALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEH  759

Query  757   ELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPS  816
             EL  +LAKL ++H++Q  W++K+DYDP G G A++D+S +  +RE+RREK++PEYW+QP 
Sbjct  760   ELCAALAKLAIAHMDQPKWLIKLDYDPLGVGEAVVDLSNIQAMRELRREKRTPEYWRQPG  819

Query  817   TRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI----  870
              RD AA+ I+AELER   LA L  P+H E++P+W++++DA+  FG V+EA P   I    
Sbjct  820   PRDAAAKMILAELERPGMLARLAAPMHSEMFPTWRDYIDAVGHFGCVIEAVPPTAIAASP  879

Query  871   ---------GHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGY  921
                       +VRANLF++P G VHV+STQ+++ T               G    KTV +
Sbjct  880   EASTALVEPAYVRANLFVDPDGSVHVTSTQNVLAT-------------GGGGLNRKTVAF  926

Query  922   AFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALHPYLT  980
              FPQTAAP+EAI+GA  A GKLL +  V+GY S+D++VFQ++K++ A RLWA+A+HP+LT
Sbjct  927   TFPQTAAPHEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNGAPRLWALAVHPFLT  986

Query  981   DSASTFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLV  1040
             DSA++FA FHLL RG L+ +SG Y               + K   +           DL+
Sbjct  987   DSAASFACFHLLARGVLDTNSGAY-------------RVASKSLTTVTGRNGSGCTTDLL  1033

Query  1041  MQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSV  1100
             ++EA+   L     AGA R +VV  Y+FHP+V+TMQY+AFFH CRLHGVCFDVER +G++
Sbjct  1034  LREAS---LAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCFDVERTLGTL  1090

Query  1101  FLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNF  1159
             FLLADSLTAGVFG++   ++  GAL FLRTALEVIGRE G T  ++          +GNF
Sbjct  1091  FLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSPSRPVSGRSGNF  1150

Query  1160  ADVLAVIRALT-GGKSAKLEKIRRLRR  1185
             A VL+ +RA T GGKS +L K++R RR
Sbjct  1151  AQVLSAVRASTGGGKSDRLGKMQRRRR  1177

>PITG_18457
Length=1170

 Score = 1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/1223 (49%), Positives = 807/1223 (66%), Gaps = 91/1223 (7%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmr--fassgasQPDVLAFQ  58
             MD+ QQQHHVEDVGR+LLQTQEQLR+MREQM A +    ++      ++  +  +V AF 
Sbjct  1     MDKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHNAIVTTAEVQAFN  60

Query  59    EILQRAEVEIRAKAELVLNGFVNTSSQA--------SALPTVSSSANGNASPKARLRQNV  110
              ILQ+ E E+RAKAELVLNG VN+SS A        + LP V+ +A    +P    R   
Sbjct  61    AILQQTETELRAKAELVLNGMVNSSSSARNNQAQSGTLLPAVTVAA----APSIMHRSGY  116

Query  111   TSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSPVQR---ITKGQLVKKKMA  167
                   R+    AS  P +++FR +F N +VE   S  LP P +R   I  G+L++KK  
Sbjct  117   DKANKPRQMD--ASSIP-VEFFREQFRNNSVEIRQS--LPEPWERHFGIHHGRLMRKKTT  171

Query  168   QNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGS----I  223
             Q+ RLLPSVNK+DPS PTPEL E+DAK G+L+LV RGFLP  ADLTP F          +
Sbjct  172   QHCRLLPSVNKTDPSVPTPELREEDAKHGVLNLVTRGFLPAYADLTPVFSGTSDGSGGGV  231

Query  224   IKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTA  283
             +K   TRIY+R EQ +RS P T  +G+N+ASLKFD+  P T       +   + + +R +
Sbjct  232   MKQRATRIYNRSEQVVRSTPFTQSTGYNLASLKFDLRAPPTPPPVVPEATFPDSTTRRRS  291

Query  284   AATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLS  343
                    +G      P  +  S  + S   K            G        ++AA    
Sbjct  292   TRRSSALQG------PNPFTRSVPISSSKIK-----------NGRSAHPTSLMSAAVAAF  334

Query  344   TDQSQEAESPETNL-DDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLH  402
             T+Q ++ E+      DD+++    ++ ++D D+ + M++L  NV+KIRGYNELLD YSLH
Sbjct  335   TNQGEDTENNRDRFSDDDISDEEQESDENDKDEYAEMEKLGANVDKIRGYNELLDVYSLH  394

Query  403   QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462
             QF+IHKGR MR+TPEFVSF+RV QE+WGSVEE +RALE LL +YFVPLAY+DGQRL+ +A
Sbjct  395   QFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRALETLLAQYFVPLAYVDGQRLLALA  454

Query  463   AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522
                   FSKR+LLSCIVNEDQV S++RRPGQRYKG+DRKRRAA TI+   RMW  +++Y 
Sbjct  455   GTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRKRRAATTIEACVRMWLVRRRYA  514

Query  523   RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582
             R R    +   IQ  WRA++ H SLK +L+    ++ E+WE +M  LK  W  I G RRV
Sbjct  515   RTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEKWEKRMHNLKSHWPQIAGRRRV  574

Query  583   VIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVSPFELTADVAQYSM  640
             V+HVPSLS+DE SR+ A+NF+++QN+QL+R+C   +D NV+ ++YVSPFELT+DV+QY +
Sbjct  575   VVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSNVELLLYVSPFELTSDVSQYFL  634

Query  641   KLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTG  700
             KLLQLGG+ D   RVKLV+PEQ  RFPAHFSL++LLLYSPHCLRRI+ Y   KEAYLV G
Sbjct  635   KLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYSPHCLRRIRHYTTGKEAYLVMG  694

Query  701   IPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVF  760
             +PG ED+RLA+AL++PILG  P  ALPL+T+SG KR  +RADVNVP GTY++YDE E+  
Sbjct  695   LPGAEDQRLAMALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPNGTYELYDEHEVCA  754

Query  761   SLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDN  820
             +LAKL ++H++Q  W++K+DYDP   G A++D+S M  +RE+RREK++PEYW+QP  RD 
Sbjct  755   ALAKLAIAHMDQPRWLIKLDYDPLDVGEAVVDLSNMQAMRELRREKRTPEYWRQPGPRDA  814

Query  821   AARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI--------  870
             AA+ I+AELER   LA + TP+  E++P W+EF+DA+  FG VVEA P   I        
Sbjct  815   AAKLILAELERPGMLARIATPMQTEIFPKWREFIDAVGHFGCVVEAVPPTAIAASSEAST  874

Query  871   -----GHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQ  925
                   +VRANLF++P G VH+SSTQ+++                 G    KTV + FPQ
Sbjct  875   VLVEPAYVRANLFVDPDGSVHISSTQNVLAA-------------GGGGLNRKTVAFTFPQ  921

Query  926   TAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTH-AARLWAMALHPYLTDSAS  984
             TAAPYEAI+GA  A GKLL +  V+GY S+D++VFQ++K++ A RLWA+A+HP+LTDSA+
Sbjct  922   TAAPYEAIKGACNAAGKLLVETNVWGYVSLDFVVFQDEKSNDAPRLWALAVHPFLTDSAT  981

Query  985   TFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEA  1044
             +FA FHLL RG L+ +SG+Y                   + +    +   SA DL+++EA
Sbjct  982   SFACFHLLARGVLDTNSGVY-----------RVANKSLTTANSGRKSESGSATDLLLREA  1030

Query  1045  THSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLA  1104
                 L      GA+R +V   Y+FHP+V TMQY+AFFH CRLHGVCFDVER +G++FLLA
Sbjct  1031  L---LAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLHGVCFDVERTLGTLFLLA  1087

Query  1105  DSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNFADVL  1163
             DSLTAGVFGI+   ++  GAL FLRTALEVIGRE G T ++         S +GNFA +L
Sbjct  1088  DSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVASSPSRSVASRSGNFAQIL  1147

Query  1164  AVIRALT-GGKSAKLEKIRRLRR  1185
             + IR  T GGKS +L K+R+ +R
Sbjct  1148  SAIRVSTGGGKSDRLGKMRQRQR  1170

>PHALS_06477
Length=1166

 Score = 1043 bits (2698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/1219 (47%), Positives = 781/1219 (64%), Gaps = 107/1219 (9%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQM--AAtsttpsssmrfassgasQPDVLAFQ  58
             M++ QQ +HVEDVGR+LL+TQEQLR MREQM  AA S   + S +  SS  +  +V AF 
Sbjct  16    MEKVQQHYHVEDVGRLLLETQEQLRAMREQMTAAAASMEANKSPKRHSSVITNAEVQAFH  75

Query  59    EILQRAEVEIRAKAELVLNGFVNTSSQA--------SALPTVSSSANGNASPKARLRQNV  110
              +LQ+ E E+RAKAELVLNG +N+S+          + LP VS +A    SP    R + 
Sbjct  76    ALLQQTESELRAKAELVLNGIINSSNSVHNSQVQRNTRLPAVSVAA---PSPIKHRRGDS  132

Query  111   TSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVL-PSPVQRITKGQLVKKKMAQN  169
              +      N R+ ++   +++FR +F N  VE   S +  P   +R +  + V+KK  Q+
Sbjct  133   RADEFGHIN-RIDNNSTSMEFFRQQFRNNRVEIRQSLMTSPENWRRKSGARRVRKKTTQH  191

Query  170   ARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFIN-------NHGS  222
              RLLP VNK+DPS PTP+L E+DA  G+L+LV RGFLP  ADLTPAF         + G 
Sbjct  192   YRLLPCVNKADPSEPTPDLREEDATCGLLNLVTRGFLPAYADLTPAFAGPNGKSNGSGGC  251

Query  223   IIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRT  282
              +K+  T IYDR ++  R  P     GFN+A LKFD    ST       S+  +P+   T
Sbjct  252   ALKHRATYIYDRSKRSARCTPLVYSIGFNLAGLKFDFRTSSTP------SSAPKPNHSAT  305

Query  283   AAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAML  342
              +A+   +K  S +    Q  +S   +     V     Q + +  N   S          
Sbjct  306   VSASMPNTKFSSIM----QTVSSGPAKRNSLVVAAPRNQNEDIENNCTHSF---------  352

Query  343   STDQSQEAESPETNL-DDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSL  401
               DQ  E  S ++++  DE  S                 +L  NV KIR YN+L+D YSL
Sbjct  353   -EDQEDEEGSDDSDIIKDEGFS---------------TKDLAVNVAKIREYNDLVDAYSL  396

Query  402   HQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTV  461
             HQ +I+KGRA+R+TPEF SF+RV  ++WGSVEEV+RALEA+L +YFVPLA++DGQRL+ +
Sbjct  397   HQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILFQYFVPLAHVDGQRLIAL  456

Query  462   AAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKY  521
             A+     FS+R+LLSCIVN++QV S++RRPGQRY G+DRK RAA TIQ   RMW    +Y
Sbjct  457   ASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRAATTIQACARMWMVHHRY  516

Query  522   TRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRR  581
              + R    + + IQ  +RA++   +LK +L+  R ++  +WEA+M   K  W+ I   RR
Sbjct  517   VKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEARMYEFKSQWSQIAARRR  576

Query  582   VVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGL-IDPNVDI-VYVSPFELTADVAQYS  639
             +V+HVPS+S+ E SR++A+NF+V+QN+QL+R+C   +D  VD+ VYVSP+ELTADV+QY 
Sbjct  577   IVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDLLVYVSPYELTADVSQYF  636

Query  640   MKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVT  699
              KLLQL G AD   RVK VYPEQAARFPAHFSL++L+LYSP+CLRRI+ Y    EAYLV 
Sbjct  637   HKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPYCLRRIRHYTAGNEAYLVM  696

Query  700   GIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELV  759
             G+PG ED+RLA+ L++PILG  P  ALPL+T+SG KR  ++AD+NVPTGTY++YDE E+ 
Sbjct  697   GLPGPEDQRLAITLDLPILGALPSQALPLLTRSGGKRLLIQADINVPTGTYELYDEHEIS  756

Query  760   FSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRD  819
              +LAKL ++HI+QS W++K+DYDP G G A++D+S+M  +RE+ REK++PEYW+QP TRD
Sbjct  757   VALAKLAVAHIDQSKWLIKLDYDPLGVGEAVVDLSSMQAMRELHREKRTPEYWRQPGTRD  816

Query  820   NAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIG------  871
              AA   + E ER   LA L TP+H E+YP+W+E+  AI  FG V+EA P           
Sbjct  817   AAANLFLTEFERPGKLARLTTPIHTELYPTWREYAAAIGHFGCVIEAVPPTASAASMEEP  876

Query  872   -HVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPY  930
              ++RAN+F++P+G VH++STQ+++TT+    S                  +AFPQT AP+
Sbjct  877   TYLRANIFVDPNGTVHMTSTQNVLTTTRGGLSRKSEI-------------FAFPQTVAPH  923

Query  931   EAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALHPYLTDSASTFATF  989
              AI+GA  A+GK LA+  V+GY S+D++VFQ+ K++AA RLWA+A+HP+LT+SA+TFA F
Sbjct  924   AAIKGACNAVGKQLAETNVWGYVSLDFVVFQDIKSNAAVRLWALAIHPFLTNSAATFACF  983

Query  990   HLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGL  1049
             HLL RG L+A+SG+Y                   +   A  +    A DL+++EA     
Sbjct  984   HLLTRGCLDANSGIY----------RVPGTKKLQTACTAEQSGNHDAMDLLLREA-----  1028

Query  1050  VSLEKA---GAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADS  1106
              SL KA   GA R YVV  Y+FHPNV+  QY+ FF  CRLHGVCFDV R +G++FLLADS
Sbjct  1029  -SLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFDVSRALGTLFLLADS  1087

Query  1107  LTAGVFGIMCCSDSASGALGFLRTALEVIGREVG-TQALMDEFMGGGESETGNFADVLAV  1165
             LTAGVFGI+   ++A  AL +LRTALEVIGRE G T+ ++        S  GNFADVL+ 
Sbjct  1088  LTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVS---SSSRSVLGNFADVLST  1144

Query  1166  IRALTGGKSA-KLEKIRRL  1183
             +RA TGG S+ +L ++ R+
Sbjct  1145  VRASTGGGSSNRLGQVHRM  1163

>PHYRA_95901
Length=1075

 Score = 917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/987 (50%), Positives = 658/987 (67%), Gaps = 87/987 (9%)

Query  219   NHGSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPS  278
              HG +++   T       Q  R +PS N         K D   P+  + + +  +G    
Sbjct  156   QHGRLLRKKTT-------QHCRLLPSVN---------KVDPTAPTPELREEDAKHGVLNL  199

Query  279   LQRTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTA  338
             + R++      +K GS ++  R    +  +  R  +         +   NL A    + +
Sbjct  200   VTRSSG-----TKDGSGVMKQR----ATRIYDRSEQPARATPFTQSTGYNLAALKFDLRS  250

Query  339   AAMLSTDQSQE-AESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLD  397
                   D+S +  E    ++D E++      AD+D D+ + M+EL  NV+KIRGYN+LLD
Sbjct  251   TGTGKNDRSNDDMEGNREHIDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLD  310

Query  398   TYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQR  457
              YSLHQF+IHKGR+MR+TPEFVSF+RVAQE+WGSVEE +RALE LLT+YFVPLAY+DGQR
Sbjct  311   AYSLHQFLIHKGRSMRDTPEFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQR  370

Query  458   LMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWN  517
             L+++AA     FSK +LL+CIVNE+QV S++RRPGQRYKG+DRKRRAA TIQ   RMW  
Sbjct  371   LLSLAATGQPRFSKSELLACIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSI  430

Query  518   QKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIK  577
             +++Y R R    S   IQ  WR+++ H +LK +L+  R +Q E+WEA+MQ L+  W  I 
Sbjct  431   RRRYVRSRASDISATRIQLAWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIA  490

Query  578   GNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVSPFELTADV  635
             G RRVV+HVPSLS+DE SR+SA+NF+V+QN+QL+R+C   +D +VD +VYVSPFELTADV
Sbjct  491   GRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADV  550

Query  636   AQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEA  695
             +QY +KLLQLGG+AD   RVKLV+PEQAARFP HFSL++LLLYSPHCLRRI+ Y   KEA
Sbjct  551   SQYFLKLLQLGGLADSRPRVKLVFPEQAARFPDHFSLSSLLLYSPHCLRRIRHYTAGKEA  610

Query  696   YLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDE  755
             YLV G+PG ED+RLAVAL++PILG  P  ALPL+T+SG KR  +RADVNVPTGTY++YDE
Sbjct  611   YLVMGLPGAEDQRLAVALDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDE  670

Query  756   DELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQP  815
              EL  +LAKL ++H+EQ  W+LK+DYDP G G A++D+S M  +RE+RREK++PEYW+QP
Sbjct  671   HELFAALAKLAVAHMEQPKWLLKLDYDPLGIGEAVVDLSGMQAMRELRREKRTPEYWRQP  730

Query  816   STRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVI---  870
               RD AA+ ++AELER   LA L TP+H E++P+W++F +AI  FG V+EA P A I   
Sbjct  731   GPRDAAAKLVLAELERPGVLARLATPMHTEIFPAWRDFTEAIGHFGCVIEAVPPAGIAAT  790

Query  871   ----------GHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVG  920
                        +VRANLF+ P G+  ++S+   +                      KTV 
Sbjct  791   PESSSLLVEPAYVRANLFVYPDGKNVLASSGGGLN--------------------RKTVA  830

Query  921   YAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLWAMALHPYL  979
             + FPQTAAP+EA++GA  A GKLL +  V+GY S+D++VFQ++K   + RLWA+A+HP+L
Sbjct  831   FTFPQTAAPHEAVQGACDATGKLLVETSVWGYVSLDFVVFQDEKNGGSPRLWALAVHPFL  890

Query  980   TDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDL  1039
             TDSA++FA FHLL RGA   ++                  S    ++    +    AADL
Sbjct  891   TDSAASFACFHLLARGAYRVAA------------------SNSMVNANPGRSGSGGAADL  932

Query  1040  VMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGS  1099
             +++EA+   L     AGA R +VV  Y+FHP+V+TMQYSAFFH CRLHGVCFDVER +G+
Sbjct  933   LLREAS---LTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTLGT  989

Query  1100  VFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNF  1159
             +FLLADSLTAGVFGI+   ++  GAL FLRTALEVIGREVG    M        +  GNF
Sbjct  990   LFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSR-PVSTRNGNF  1048

Query  1160  ADVLAVIRALT-GGKSAKLEKIRRLRR  1185
             A VL+ +RA T GGK  +L K+RRLRR
Sbjct  1049  AQVLSAVRASTGGGKGDRLGKMRRLRR  1075

 Score = 203 bits (516),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 129/288 (45%), Positives = 172/288 (60%), Gaps = 41/288 (14%)

Query  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmr--fassgasQPDVLAFQ  58
            M++ QQQHHVEDVGR+LLQTQEQLR+MREQM A +    ++      S+  +  +V AF 
Sbjct  1    MEKVQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAAAVEANASPMRHSAVVTTAEVQAFN  60

Query  59   EILQRAEVEIRAKAELVLNGFVNTSSQA--------SALPTVSSSANGNASPKARLRQNV  110
             ILQ+ EVE+RAKAELVL G VN+SS A        + LP V+ +    A P  R R   
Sbjct  61   AILQQTEVELRAKAELVLKGMVNSSSSAQTNQSQSGTLLPVVTVA----APPSTRHRSGY  116

Query  111  TSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPSP--VQR---ITKGQLVKKK  165
                        AS  P +++FR +FHN +VE V   ++PSP   QR   I  G+L++KK
Sbjct  117  GD----------ASSIP-IEFFREQFHNSSVE-VRQSLMPSPQHWQRHLGIQHGRLLRKK  164

Query  166  MAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIK  225
              Q+ RLLPSVNK DP+APTPEL E+DAK G+L+LV R           +   +   ++K
Sbjct  165  TTQHCRLLPSVNKVDPTAPTPELREEDAKHGVLNLVTRS----------SGTKDGSGVMK  214

Query  226  NSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSN  273
               TRIYDR EQP R+ P T  +G+N+A+LKFD+    T  +DR N +
Sbjct  215  QRATRIYDRSEQPARATPFTQSTGYNLAALKFDLRSTGTGKNDRSNDD  262

>H257_06305
Length=1099

 Score = 910 bits (2351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/1194 (42%), Positives = 710/1194 (59%), Gaps = 139/1194 (12%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
             MD+  QQ+H EDVGRILLQ Q++LR MRE++   +                 DV     I
Sbjct  1     MDKLCQQYHAEDVGRILLQAQDELRSMREKVNEKNNV---------------DVNEINAI  45

Query  61    LQRAEVEIRAKAELVLNGFVNTSSQ---ASALPTVSSSANGNASPKARLRQNVTSLTAAR  117
             L+RAE ++RAKAE+VLNG VN S +   A   P   +S +  +S  A+ R+   ++T   
Sbjct  46    LERAEADLRAKAEIVLNGVVNNSMKMLPAIEAPGGKTSLSKFSSKLAQKRELAATMT---  102

Query  118   RNSRLASDEPDLDYFR-----ARFHNPAVEFVSSPVLPS--PVQRITK-GQLVKKKMAQN  169
                R +S EP    +R      RF  P +E +     P   PV RI K G LVKKK  + 
Sbjct  103   ---RDSSYEPASPTYRQEDREPRFGGP-IEPMERDRAPGRRPVGRIIKAGSLVKKKTTKP  158

Query  170   ARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG-SIIKNSK  228
              RLLP +N++DP+AP+P+L E+DA+ G+ +LV RGFLP   D+TPAF   HG S+I+NS+
Sbjct  159   HRLLPKMNRTDPTAPSPDLVEEDARGGVHNLVTRGFLPPSVDVTPAF--THGTSVIQNSR  216

Query  229   TRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQF  288
              +IYDR  QP++SMP TNPSGFN+ASLKFD+   STT           P+    +     
Sbjct  217   VKIYDRASQPVKSMPYTNPSGFNMASLKFDM---STT-----------PATSTPSPVAAV  262

Query  289   VSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGN---LQASVGSVTAAAMLSTD  345
             VS G  S +                 V  ++   DA   +   ++   G  T        
Sbjct  263   VSGGDVSKMV----------------VTPIDISFDAPSSSHPPVEQPKGGATGG------  300

Query  346   QSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLHQFI  405
                          D+ N G           +S +  LR+NVEKIRGYNELLDTYSLHQFI
Sbjct  301   -------------DDTNGGD----------SSTIHNLRRNVEKIRGYNELLDTYSLHQFI  337

Query  406   IHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAME  465
             I KG+ + +TPEF+SF+R  +++WGSV   I+ LE +LT Y VPLAY+DGQ+LM +AAM+
Sbjct  338   IRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDGQKLMKIAAMD  397

Query  466   MAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFR  525
                    +LLSCI+N D+V SL+RRPGQRYKG      A + IQ+ +RM+  +K+  +  
Sbjct  398   ATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRMFLTKKRL-KNH  456

Query  526   HHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIH  585
             H       IQR++R++     L+++LK  R      W+A+MQR + +W  +K  RRVV+H
Sbjct  457   HGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDTMKMQRRVVVH  516

Query  586   VPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQL  645
             VPS + D+R+R+  DNFS++QN+Q++R+C + DPNVDI+Y+SPFEL+ D+ +Y ++LLQL
Sbjct  517   VPSFASDDRTRLKMDNFSIRQNLQMARMCAIADPNVDIIYISPFELSPDIQRYQVRLLQL  576

Query  646   GGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGRE  705
             GGI DP  R+++++PE   RFP HFSLTTLLLYSPHCL++I+R++R K AY+VTG  G E
Sbjct  577   GGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPHCLKKIKRFVRGKNAYIVTGNVGPE  636

Query  706   DKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKL  765
             DKRLA+AL +P+LGMDP  AL   T+SG KR FM ADVN+P G +DIYDEDEL+ SL+KL
Sbjct  637   DKRLAIALQIPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKL  696

Query  766   IMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKK-----SPEYWKQPSTRDN  820
             I + ++Q+ W++KID D   TG A ++V  M  + ++R EK+     + EY++QP  RD 
Sbjct  697   IAADVDQNEWLVKIDADQSDTGIASINVQQMQSVAKVRAEKRDMKHMAAEYFQQPDVRDA  756

Query  821   AARAIIAEL-ERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFI  879
               R+I  EL E   A  +TP  P+VY SW E      + GVV+EA PS V+  VRAN+FI
Sbjct  757   VLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEAYPSKVLSQVRANVFI  816

Query  880   EPSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGASTA  939
             EPSG VH++S  D+  + +N                       FPQT+ PY+AIRGAS A
Sbjct  817   EPSGGVHITSAHDLFMSPANKHLPQCAL---------------FPQTSVPYQAIRGASLA  861

Query  940   IGKLLADECVFGYSSIDYLVFQEDKTHAA------RLWAMALHPYLTDSASTFATFHLLN  993
             I   +  + + GY+SIDY+ F + KT         RLWAM + P LT++A +F  F  L+
Sbjct  862   IASSMFIKGIIGYASIDYMSFADPKTLVGGGRPRQRLWAMQVVPGLTNTAVSFVMFAFLS  921

Query  994   RGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVSLE  1053
                 N  +G             ++   +  S + A       A + ++     +G V   
Sbjct  922   CSQFNPITG-------KCHLQVAAPPPIAASATVAPITQAQKAVETILSARPPNGAVV--  972

Query  1054  KAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG  1113
               G +RTY+V +YI+HPN++T+ +S FF+TCRL+GV FD++R +G+ F+LADSLTAGV G
Sbjct  973   -CGPERTYMVLDYIYHPNMATLHFSTFFNTCRLNGVSFDLQRAIGAAFILADSLTAGVMG  1031

Query  1114  IMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIR  1167
             +MC  ++   A    R A+E+IG +VG QAL D   G      GNF  +LA++R
Sbjct  1032  LMCIGENDKEAFRIARQAVELIGDQVGVQALPDSLSG---ERLGNFPHLLAIVR  1082

>H310_09212
Length=1113

 Score = 897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/1206 (41%), Positives = 713/1206 (59%), Gaps = 119/1206 (10%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
             M++  QQ+H EDVGRILLQ Q++LR MRE++   +                 DV     I
Sbjct  1     MEKLCQQYHAEDVGRILLQAQDELRSMREKVHENNNL---------------DVNQIHAI  45

Query  61    LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPK--ARLRQNVTSLTAARR  118
             L+RAE ++RAKAE+VLNG VN S +   LP + +        K  ++L Q         R
Sbjct  46    LERAEADLRAKAEIVLNGVVNNSMKM--LPAIDAPGGQRYLSKFSSKLAQKRDLAATMAR  103

Query  119   NSRLASDEPDLDYFRARFHNPAVEFVSSPVLP---------SPVQRITK-GQLVKKKMAQ  168
              +      P   +  +   +P++   S P+ P          PV RI K G LVK K  +
Sbjct  104   ENTYEPGSPTYGHDTSYREHPSL---SGPIEPMERDRTPGRRPVGRIVKAGSLVKHKTTK  160

Query  169   NARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG-SIIKNS  227
               R+LP +N+ DP+AP P L + DA+ G+ +L+ RGFLP   D+TPAF   HG S+I+N+
Sbjct  161   PRRILPKMNRLDPTAPPPALLDDDARGGVHNLLTRGFLPPSVDVTPAF--THGTSVIQNT  218

Query  228   KTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTAAATQ  287
             + +IYDR  QP++SMP TNPSGFN+ASLKFD+  P+                     A  
Sbjct  219   RVKIYDRASQPVKSMPYTNPSGFNMASLKFDMVTPTPPT-----------------VANV  261

Query  288   FVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLSTDQS  347
              +++GG    S        ++   G     V F+ +  +G    S G   A+A       
Sbjct  262   PINQGGDIPPSKTSIPTPIDITFDGHANNAVPFRPEQPKGGNDPS-GKDCASA-------  313

Query  348   QEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLHQFIIH  407
                       DD   +GGND        ++++  LR+NVEKIRGYNELLDTYSLHQFII 
Sbjct  314   ----------DD--GAGGND--------STSIHNLRRNVEKIRGYNELLDTYSLHQFIIR  353

Query  408   KGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMA  467
             KG+ + +TPEF+SF+R  +++WGSV + I+ LEA+LT Y VPLAY+DGQ+LM +AAM+  
Sbjct  354   KGKTLADTPEFISFQRTTEDLWGSVSKSIQELEAMLTNYSVPLAYVDGQKLMKIAAMDGT  413

Query  468   AFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHH  527
             A    +LLSCI+N D+V SL+RRPGQR+KGK     AA+ +Q+ +RM+  +K+  +  H 
Sbjct  414   ARGTMELLSCILNMDEVSSLMRRPGQRFKGKSGPDLAAVLLQSVWRMYITKKRL-KNHHG  472

Query  528   LASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVP  587
                   IQR++R++     L+++LK  R      W+A+MQR + +W  IK  RRVV+HVP
Sbjct  473   NEDAAVIQRIYRSYRCFSQLQQRLKSVREADLRIWDAQMQRFRANWDSIKMQRRVVVHVP  532

Query  588   SLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLLQLGG  647
             S S +ER+R+  +NFS++QN+Q++R+C + DPNVDI+Y+SPFEL+ D+ +Y ++LLQLGG
Sbjct  533   SFSSEERTRLKMENFSIQQNLQMARMCAIADPNVDIIYISPFELSPDIQKYQVRLLQLGG  592

Query  648   IADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDK  707
             IADP  R+++++PE   RFP HFSLTT+LLYSPHCL++I+R++R K+AY+VTG  G EDK
Sbjct  593   IADPQTRIRMLHPENVDRFPEHFSLTTVLLYSPHCLKKIKRFVRGKDAYIVTGNVGPEDK  652

Query  708   RLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIM  767
             RLA+AL +P+LGMDP  AL   T+SG KR FM ADVN+P G +DIYDEDEL+ SL+KLI 
Sbjct  653   RLAIALQLPLLGMDPDKALLYGTRSGGKRIFMAADVNIPMGAHDIYDEDELIQSLSKLIA  712

Query  768   SHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKK-----SPEYWKQPSTRDNAA  822
             + I+Q+ W++KID D   TG A L+V  M  + + R EK+     + EY++QP  RD   
Sbjct  713   ADIDQTEWLIKIDADQSNTGIASLNVDKMQSVAKFRAEKREMKHGAAEYFQQPDVRDAVL  772

Query  823   RAIIAEL-ERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEP  881
             R++ +EL E   A  VTP  PE+Y SW        + GVV+EA PS V+ HVR N+FIEP
Sbjct  773   RSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRVGVVIEAYPSKVLSHVRTNIFIEP  832

Query  882   SGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGASTAIG  941
             SG VH++S  D+     N                       FPQ++ PY+AIRGAS AI 
Sbjct  833   SGGVHITSAHDVFMCPVNKHLPQCA---------------VFPQSSVPYQAIRGASLAIA  877

Query  942   KLLADECVFGYSSIDYLVFQEDKTHAA-----RLWAMALHPYLTDSASTFATFHLLNRGA  996
               +  + + GY+SIDY+ F + K   +     RLWAM + P LT++A +F  F  L+   
Sbjct  878   SSMFIKGIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNTAVSFVMFAFLSCSQ  937

Query  997   LNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVSLEKAG  1056
              N  +G                 +   + S A      +  ++    +  S   +    G
Sbjct  938   FNPITG---------KSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAAASVCG  988

Query  1057  AQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMC  1116
              +RTY+V +YI+HPN++T+Q++ FF+TCRLHGV FD++R +G+ ++LADSLTAGV G++C
Sbjct  989   PERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGVVGLIC  1048

Query  1117  CSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIRALTGGKSAK  1176
               +S   A    R A+E+IG +VG QAL +   G      GNF  +LA++R  +   +A 
Sbjct  1049  IGESDKEAFRIARQAVELIGDQVGVQALPNSLSG---ERLGNFPHLLAIVRNKSDDPAAA  1105

Query  1177  LEKIRR  1182
               + RR
Sbjct  1106  DRRKRR  1111

>PHYCA_34475
Length=692

 Score = 820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/749 (55%), Positives = 534/749 (71%), Gaps = 77/749 (10%)

Query  390   RGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVP  449
             RGYNELLD YSLHQF+IHKGR MR+TPEF+SF RVAQE+WGSVEE +RALE LLT YFVP
Sbjct  1     RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  450   LAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQ  509
             LAY+DGQRL+++AA     FSKR+LLSCIVNE+QV + +RRPGQRYKG+DRKRRAA TIQ
Sbjct  61    LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  510   NFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRL  569
              F RMW  +++Y R R    +   IQ  WRA++ H +LK +L+  R +Q E+WEA+M RL
Sbjct  121   AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  570   KRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC-GLIDPNVD-IVYVS  627
             K  W  I  +RRVV+HVPSLS+DE SR+SA+N +V+QN+QL+R+C   +D  VD +VYVS
Sbjct  181   KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  628   PFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQ  687
             PFELT DV+QY +KLLQLGG+AD   RVKL++PEQA RFPAHFSL++LLLYSPHCLRRI+
Sbjct  241   PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPHCLRRIR  300

Query  688   RYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPT  747
              Y   KEAYLV G+PG ED+RLA+ L++PILG  P  ALPL+T+SG KR  +RADVNVP 
Sbjct  301   HYTAGKEAYLVMGLPGAEDQRLAMTLDLPILGAPPAQALPLLTRSGGKRLLIRADVNVPA  360

Query  748   GTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKK  807
             GTY++YDE EL  +LAKL ++H++Q  W+ K+DYDP G G A++D+S M  +RE+RREK+
Sbjct  361   GTYELYDEHELFSALAKLAVAHMDQPKWLFKLDYDPLGVGEAVVDLSGMQAMRELRREKR  420

Query  808   SPEYWKQPSTRDNAARAIIAELER--TLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAA  865
             +PEYW+QP  RD AA+ ++ ELER  TLA L  P+H +++PSW EF +AI  FG V+EA 
Sbjct  421   TPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFPSWLEFAEAIGHFGCVIEAV  480

Query  866   PSAVI-------------GHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkkag  912
             P   I              ++RANLF++P G VHV+ST +++ T               G
Sbjct  481   PLTAIAVTPETSTALLEPAYIRANLFVDPDGSVHVTSTLNMLAT-------------GGG  527

Query  913   ayrskTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA-RLW  971
                 +TV + FPQTAAP+EA++GA +A GKLL +  V+GY S+D++VFQ+DK++ A RLW
Sbjct  528   GLNRRTVAFTFPQTAAPHEAVKGACSAAGKLLVETNVWGYVSLDFVVFQDDKSNGAPRLW  587

Query  972   AMALHPYLTDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstkslkpshsraaga  1031
             A+A+HP+LTDSA++FA FHLL RG L+A+SG+Y                           
Sbjct  588   ALAVHPFLTDSAASFACFHLLARGVLDANSGVY---------------------------  620

Query  1032  tgtsaaDLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCF  1091
                                 +  A   R +VV  Y+FHP+V+TMQY+AFFH CRLHGVCF
Sbjct  621   -------------------RMAAASTPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGVCF  661

Query  1092  DVERCVGSVFLLADSLTAGVFGIMCCSDS  1120
             DVER +G++FLLADSLTAGVFG++   ++
Sbjct  662   DVERTLGTLFLLADSLTAGVFGVLSIGET  690

>SPRG_06354
Length=884

 Score = 792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/954 (43%), Positives = 576/954 (60%), Gaps = 102/954 (11%)

Query  224   IKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQRTA  283
             ++NSK R+YDR EQP++S P  N SGFNVASLK D+APP T        +   P+  R A
Sbjct  1     MQNSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPT------EPDAVPPT--RPA  52

Query  284   AATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAMLS  343
              A                       R R + V TV       +  L  +V          
Sbjct  53    VA-----------------------RKRKSTVATVQLSFPGAKDELVDAV----------  79

Query  344   TDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLHQ  403
                    E P T+ D  +              T  +DELR NVEKIRGYN+LLDTYSLHQ
Sbjct  80    -----PVEDPATD-DGPIEP------------TDTIDELRNNVEKIRGYNDLLDTYSLHQ  121

Query  404   FIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAA  463
             FII KG+ + ETPEF+SFKR+ +++WGSV   IR LE LL  Y VPLAYIDGQ+L+ +AA
Sbjct  122   FIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHYSVPLAYIDGQKLLKIAA  181

Query  464   MEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTR  523
             M+  + SK +LL+C++N D+V + + RPGQR+KG D +  AAI IQ+ +RM    ++  R
Sbjct  182   MDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAIVIQSVYRMH-RTRRLLR  240

Query  524   FRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVV  583
               H  +    IQRV+R +   + ++ KL+  R      WE +M     +W  IK  RRVV
Sbjct  241   QHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQMTTFHANWDKIKMQRRVV  300

Query  584   IHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMKLL  643
             +HVPS S +ER+R++ DNF+++QN+Q++RLC + DPNVD++Y+SPFEL+ D+ +Y M+LL
Sbjct  301   VHVPSFSAEERARLNMDNFAIRQNLQMARLCAIADPNVDVIYISPFELSVDIQKYMMRLL  360

Query  644   QLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPG  703
             QLGG+ADP +RV++++PE A RFP HFSL T+LLYSPHCL++I+RY+R KEAY+V G  G
Sbjct  361   QLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPHCLKKIKRYVRGKEAYIVAGTVG  420

Query  704   REDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLA  763
              EDKRLA+ L +P+LGMDP  AL   T+SG+KR F +ADVN+P G +DIYDEDEL+ SLA
Sbjct  421   PEDKRLAIRLQLPLLGMDPDRALLYGTRSGAKRLFTQADVNIPYGAHDIYDEDELILSLA  480

Query  764   KLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREK---KSPEYWKQPSTRDN  820
             KL  +++ Q +W++K+D DP  TG A +D+  +  + ++R EK   K+ EY+ QP+ ++ 
Sbjct  481   KLTAANLHQGMWLIKLDADPSDTGLAAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEG  540

Query  821   AARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIE  880
               RAI+AEL      L++P  P+VYP+WQ     +++ G V+EA P  V+  VRAN+FIE
Sbjct  541   IVRAIVAELSEQFHRLISPCFPDVYPTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIE  600

Query  881   PSGEVHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGASTAI  940
             PSG VHV+S Q+ +                    + ++VG  +P TA PY AIRGAS A+
Sbjct  601   PSGGVHVTSAQEQLM---------------HVKNKHQSVGAVYPPTAVPYAAIRGASLAV  645

Query  941   GKLLADECVFGYSSIDYLVFQEDKTHAA-------RLWAMALHPYLTDSASTFATFHLLN  993
              + +    + GY+SIDY+ F + KT          RLWA+ L P LT +A +F  F  L+
Sbjct  646   AQAMYASGIIGYASIDYVAFLDVKTVNGKAGPPHLRLWALQLLPCLTPTAMSFVLFTFLS  705

Query  994   RGALNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVSLE  1053
                L+A++G                     S +         A + ++ E++ +  +   
Sbjct  706   CATLDAATG---------RSFLPLPAPRPSSLAGPPATETQLAVEKILGESSPAATM---  753

Query  1054  KAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFG  1113
               GA+R Y+  EYIFHPN++T+QY+ FF+ CR+HGV FD+++ +G+ F+LADSLTAGV G
Sbjct  754   --GAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAAFVLADSLTAGVVG  811

Query  1114  IMCCSDSASGALGFLRTALEVIGREVGTQALMDEFMGGGESETGNFADVLAVIR  1167
             ++C  +S   A+   R ALE+IG +VG Q   D   G      GNFA VL  IR
Sbjct  812   LLCIGESDKEAVRLTRAALELIGDQVGVQPAPDALTG---ERLGNFAAVLGAIR  862

>SDRG_01764
Length=1092

 Score = 759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/804 (46%), Positives = 527/804 (66%), Gaps = 44/804 (5%)

Query  376   TSAMDELRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEV  435
             T  +DELR NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF+SFKR+ +++WGSV   
Sbjct  306   TDTIDELRNNVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMA  365

Query  436   IRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRY  495
             IR LE LL  Y VPLAYIDGQ+L+ +AAM+  + SK +LL+C++N D+V + + RPGQR+
Sbjct  366   IRELETLLINYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRF  425

Query  496   KGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVT-IQRVWRAFASHESLKRKLKFQ  554
             KG+D +  AAI +Q+ +RM   +++  +  HH  S  + IQRV+R + S + ++ KL+  
Sbjct  426   KGEDSRHAAAILLQSVYRMHLTRRRLRQ--HHGHSYASHIQRVYRTYKSVKEIQVKLRLA  483

Query  555   RAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLC  614
             R      WE +M     +W  IK  RRVV+HVPS S +ER+R++ DNF+++QN+Q++RLC
Sbjct  484   READARTWETQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARLC  543

Query  615   GLIDPNVDIVYVSPFELTADVAQYSMKLLQLGGIADPVARVKLVYPEQAARFPAHFSLTT  674
              + DPNVD++Y+SPFEL+AD+ +Y M+LLQLGG+ADP +RV++++PE A RFP HFSL T
Sbjct  544   AIADPNVDVIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLAT  603

Query  675   LLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPILGMDPLSALPLMTKSGS  734
             +LLYSPHCL++I+RY+R KEAY+V G  G EDKRLA+ L +P+LGMDP  AL   T+SG+
Sbjct  604   ILLYSPHCLKKIKRYVRGKEAYIVAGTVGPEDKRLAIRLQLPLLGMDPDRALLYGTRSGA  663

Query  735   KRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVS  794
             KR F +ADVN+P G +DIYDEDEL+ SLAKL  +++ Q +W++K+D DP  TG A +D+ 
Sbjct  664   KRLFTQADVNIPFGAHDIYDEDELILSLAKLTAANLHQGMWLIKLDADPSDTGLASIDMH  723

Query  795   TMTVLREIRREK---KSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPSWQEF  851
              +  + ++R EK   K+ EY+ QP+ ++   RAI+AEL      L++P  P+VYP+WQ  
Sbjct  724   ALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVYPTWQHM  783

Query  852   VDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVHVSSTQDIITTssnssssgggagkka  911
                +++ G V+EA P  V+  VRAN+FIEPSG VH++S Q+ +                 
Sbjct  784   RPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVHLTSAQEQLM---------------Q  828

Query  912   gayrskTVGYAFPQTAAPYEAIRGASTAIGKLLADECVFGYSSIDYLVFQEDKTHAA---  968
                + ++VG  +P T  PY AIRGAS A+ + +    + GY+SIDY+ F + KT      
Sbjct  829   AKNKHQSVGAVYPSTTVPYAAIRGASLAVAQAMYASGIIGYASIDYVAFLDVKTVNGKAG  888

Query  969   ----RLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstkslkps  1024
                 RLWA+ L P LT +A +F  F  L+   L+A++G         S          P+
Sbjct  889   PPHLRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATG--------RSFLPQPAPHPSPA  940

Query  1025  hsraagatgtsaaDLVMQEATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTC  1084
               +        A + ++ E+  S  V     G +R Y+  EYIFHPN++T+QY+ FF+ C
Sbjct  941   TGQLPVTETQLAVEKILSESPRSSNV-----GPERAYIAHEYIFHPNMATLQYAVFFNMC  995

Query  1085  RLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGREVGTQAL  1144
             R+HGV FD+++ +G+ F+LADSLTAGV G++C  +S   A+   R ALE+IG +VG Q  
Sbjct  996   RVHGVSFDLQKSIGAAFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQPA  1055

Query  1145  MDEFMGGGESETGNFADVLAVIRA  1168
              D   G      GNFA VL  IR+
Sbjct  1056  PDALTG---ERLGNFAAVLGAIRS  1076

 Score = 192 bits (487),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 161/273 (59%), Gaps = 36/273 (13%)

Query  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
            MD+  QQ+HVEDVGRILLQ Q++LR MREQ+  ++                 D+ A Q I
Sbjct  1    MDRLAQQYHVEDVGRILLQAQDELRNMREQVLTSNNI---------------DIDALQAI  45

Query  61   LQRAEVEIRAKAELVLNGFVNTSSQASALPTVSSSANGNASPKARLRQNVTSLTAARRNS  120
            L+RAE+++R+KAE+VLNG VN + +   LP + +   G  S    + +  + L   R  +
Sbjct  46   LERAELDLRSKAEIVLNGVVNNTMKT--LPVIEAPGGGQPS----VSKFSSKLAKQRELA  99

Query  121  RLASDEPDLDYFRARFHNPAVEF---VSSPVLP---------SPVQRITK-GQLVKKKMA  167
               + +  LD  R R  +P       +  PV+P          P+ R  + G+L+KKK+ 
Sbjct  100  DAMARDGSLDDHRTR-SSPVERLRQQLGQPVVPVERDRPPGKRPIGRTMQVGRLIKKKVT  158

Query  168  QNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHGSIIKNS  227
               RLLP VN+ DP AP P+L + DAK G+L+LVNRGF+P  ADL+ AF +  G II+NS
Sbjct  159  GPQRLLPKVNRIDPLAPVPDLEDDDAKRGVLNLVNRGFIPTSADLSLAFTHGDG-IIQNS  217

Query  228  KTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIA  260
            K R+YDR EQP++S P  N S FNVASLK D+A
Sbjct  218  KLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLA  250

>CCI45122
Length=1105

 Score = 713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/1167 (37%), Positives = 648/1167 (56%), Gaps = 120/1167 (10%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQP--------  52
             MD  +Q+HH ED+GRILLQTQ++LR +R +++    T  + +  A+     P        
Sbjct  1     MDHLEQKHHTEDIGRILLQTQQELREIRAEISGRKQTTETYIADATPFEDYPAPIVSVNP  60

Query  53    --DVLAFQEILQRAEVEIRAKAELVLNGFVNTSSQA-SALPTVSSSANGNASPKARLRQN  109
               D+   Q IL RAE EI+AK +L+  G  +   +  + LP V       ASP  ++  +
Sbjct  61    SKDLETLQNILDRAEREIQAKVDLLYKGVAHYGRKTQTGLPFV-------ASPPRQIPSS  113

Query  110   VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPV-----LPSPVQRITKGQLV--  162
               S +  R++S     E  +D  R + H+   ++   P      L SP +R T+G L   
Sbjct  114   ANS-SLERKSS---FQELSVDLIRKQLHSVKEKYKCLPTKQHSELISP-KRPTQGLLTSK  168

Query  163   --KKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNH  220
               KK+   + R LP+V              Q  ++G  S  +R    +G       +N+ 
Sbjct  169   PSKKRYNASLRSLPTV--------------QRGEAGDFSSASRD--QIGEASNTLSVNDR  212

Query  221   GSIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQ  280
               ++      +++R E+PI++ P T     N+ S+KFD                      
Sbjct  213   --VLMQRTAHLHNRMEEPIKTTPYTTAISHNMMSVKFD----------------------  248

Query  281   RTAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAA  340
                             ++P        ++++   V+T + Q     G L A+  S++   
Sbjct  249   ---------------FMTPTSQSPCGKMQTQEKIVLTNDLQSKQRNGALLANQISLSPGG  293

Query  341   MLSTDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYS  400
                 D S+   SP  +   ++           ND T ++              E+  TY 
Sbjct  294   GCREDDSRF--SPGRDPSKKIGIIKAITPIFLNDVTKSL------------VGEISKTYD  339

Query  401   LHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMT  460
                F+IH+G   R+ PEF +F+R+A  +W SV+ V+ AL  +L+ YF+P+AYI+GQR++T
Sbjct  340   ---FVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILT  396

Query  461   VAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKK  520
             +A  +    + +DL+SCI NED+V  L+ +PGQR++G +R +RA I +Q+F RM  ++K+
Sbjct  397   LAQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKR  456

Query  521   YTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNR  580
             +   R+    V  IQR WR F++H++ K K++ +R  Q   +   M+    +W  I+  R
Sbjct  457   FLVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQR  516

Query  581   RVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSM  640
             R +IH+PS+SID R R+  + FS++QN+QL RLC +ID NV+++Y+ PFELT D+ QY M
Sbjct  517   RTIIHIPSISIDSRQRMKTEQFSIQQNLQLQRLCAVIDENVELIYICPFELTDDIVQYYM  576

Query  641   KLLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTG  700
             KLLQLGGI+D  AR+KL+ PE A+RFP+HFSL++++LYSP  L R+ R IR + AY+V G
Sbjct  577   KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPRTLNRLSRCIRGRNAYMVPG  636

Query  701   IPGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVF  760
              PG EDKR+A  L VPILG+D   +L   T SGSKR+F +A+VN      D+YDE+EL+F
Sbjct  637   FPGLEDKRVATILGVPILGLDSTKSLQATTYSGSKRYFRKANVNTLPACIDLYDENELIF  696

Query  761   SLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDN  820
             SLAKL+ SH  Q   VL++DYDPFGTG AL+D+S +  ++E+R   K+ E W QP  +  
Sbjct  697   SLAKLVASHPHQLSVVLRLDYDPFGTGIALMDISRLQSVKEVRLRTKTLESWLQPPIQAK  756

Query  821   AARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIE  880
               R ++ E++  ++  +  +HPE++PS + F+ AI  +GV++E +P    GHVRANLFIE
Sbjct  757   LIRNLVLEMQNNISSFIFVVHPEIFPSSKSFLQAIRIYGVIIELSPKKRQGHVRANLFIE  816

Query  881   PSGEVHVSSTQDII---TTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGAS  937
             PS  V VSST +I    T +            KA A + +T G  FPQT   +E ++ AS
Sbjct  817   PSRRVCVSSTHEIHSLETDTKIDDRVRKFGLDKASAAKMRTFGVTFPQTLIDHEVLKDAS  876

Query  938   TAIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNR-GA  996
              AIG+ LA + + GY S+D++V  +D+T    L+A  L P+LT++A++FA F LL+R G+
Sbjct  877   LAIGQALAKDGICGYISVDFVVCLDDQTQKKTLYATGLQPFLTNTAASFALFQLLSRGGS  936

Query  997   LNASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVS-LEKA  1055
              N+ +G           S    + +     +    +  SA DL+++EA  SG+VS +   
Sbjct  937   YNSMTG-----------SLHLPQEVPLVGVQNDPPSSLSATDLMIREARLSGIVSNVLPP  985

Query  1056  GAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIM  1115
                RTY + EY+ +P V+T+  S+FF  CR  GV FD ER  G+VFLLADSLTAGVFGIM
Sbjct  986   TPTRTYALIEYVCNPCVATLSCSSFFQHCRSRGVYFDTERDSGTVFLLADSLTAGVFGIM  1045

Query  1116  CCSDSASGALGFLRTALEVIGREVGTQ  1142
             C SD+   AL   R A+E I    GT+
Sbjct  1046  CISDTRKNALSNCRAAMEAIAGVAGTK  1072

>CCA18898
Length=1147

 Score = 706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/1167 (36%), Positives = 646/1167 (55%), Gaps = 101/1167 (9%)

Query  1     MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssm----------rfassgas  50
             M+Q +Q++H EDVGRILLQTQ++LR +R +++A      S +             ++   
Sbjct  26    MEQVEQKYHKEDVGRILLQTQQELRDIRAEISARKQAGISHVVDAHPHREDHASLANENQ  85

Query  51    QPDVLAFQEILQRAEVEIRAKAELVLNGFVNTSSQA-SALPTVSSSANGNASPKARLRQN  109
               D+    +IL RAE EI+AK +L+  G  N      + LP V+S             + 
Sbjct  86    SKDLETLHDILDRAEREIQAKVDLMFRGAANFGQMMQTGLPAVTSPP-----------RQ  134

Query  110   VTSLTAARRNSRLASDEPDLDYFRARFHNPAVEFVSSPVLPS--------PVQRITKGQL  161
             V++ T +  +   ++ E  +D  R +      ++  SP +          P Q +   + 
Sbjct  135   VSTTTKSLSDQIFSTQESKVDGTRKQLTAAKDDYKCSPSMQQSELISPKRPTQGLLTSKA  194

Query  162   VKKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGMLSLVNRGFLPVGADLTPAFINNHG  221
              KK+   + + LP+V     S  +  L++Q +++    L +R   P+ +       + + 
Sbjct  195   SKKRYNVSLKSLPAVQNGHASTSSSALADQSSETAHF-LNSRHGSPLNS--IEISQSTYD  251

Query  222   SIIKNSKTRIYDRQEQPIRSMPSTNPSGFNVASLKFDIAPPSTTVSDRENSNGSEPSLQR  281
               +     ++++R E+PIR+ P T+    ++ SLKFD                S P++ +
Sbjct  252   RALMQRTAQLHNRLEEPIRTTPCTSTISHDITSLKFDF---------------SAPTILQ  296

Query  282   TAAATQFVSKGGSSLLSPRQYENSANVRSRGAKVVTVNFQGDAVRGNLQASVGSVTAAAM  341
             +    Q              +E   +   +           + V   L        +   
Sbjct  297   SPGKVQI-------------HEQVTHFNDQALGECNCRLSTNQVSMALINGFREDNSKLS  343

Query  342   LSTDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSL  401
              S D S++   P+     ++N+                     + E  +G N      S 
Sbjct  344   PSRDHSKKMGIPKVIKSTKINT---------------------DTESHKGNNS-----SN  377

Query  402   HQFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTV  461
             H F IH+G   R   +F SF+  A +VW +VEEV+  LE LL+ YF+P+A+I+GQR++T+
Sbjct  378   HDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLERLLSVYFIPIAHINGQRILTL  437

Query  462   AAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKY  521
             +       + RDLLSC+ NE +V  L+ +PGQR++G ++  RAA+ +Q+F RM   ++ Y
Sbjct  438   SQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKCTRAAMAVQSFMRMITFRRTY  497

Query  522   TRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRR  581
                  +   V  IQ+ WR +A++++ K K++  R +Q   +   M+    +W  I+  RR
Sbjct  498   LLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIVFNEIMRSFCSNWDKIRTQRR  557

Query  582   VVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIVYVSPFELTADVAQYSMK  641
              V+H+PS+SID R R+  + FS++QN+QL RLC LID NV+++Y+ PFELT D+ QY MK
Sbjct  558   TVMHIPSISIDPRHRMKTEQFSIQQNLQLQRLCALIDENVELIYICPFELTDDIVQYYMK  617

Query  642   LLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGI  701
             LLQL GI+D  AR+KL+ PE A+RFP+HFSL+ ++L SPH ++R+ RYIR + AYLV G 
Sbjct  618   LLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSPHTMKRLSRYIRGRNAYLVPGF  677

Query  702   PGREDKRLAVALNVPILGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFS  761
             PG EDKRLA  L +PILG+DP     + T SG KR F + + N   G+ D+YDE+EL+FS
Sbjct  678   PGTEDKRLAALLRIPILGLDPAKFFQMTTHSGIKRCFKKTNANTLPGSIDLYDENELIFS  737

Query  762   LAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRDNA  821
             LAKLI ++  QS  VLK+DYDPF TGTAL+D+S +  ++ +R   ++ +YW+QP  ++  
Sbjct  738   LAKLIAANPHQSSMVLKLDYDPFRTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKL  797

Query  822   ARAIIAELERTLAHLVTPLHPEVYPSWQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEP  881
              R I+ E++  ++ LV  ++PEVYPSW+ F+ AI  +GVV+E  P    G+VRANLFIEP
Sbjct  798   IRNIVQEMQSIISSLVFMVNPEVYPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEP  857

Query  882   SGEVHVSSTQDIIT---TssnssssgggagkkagayrskTVGYAFPQTAAPYEAIRGAST  938
             S  V +SSTQ+ ++      N   +      KA A + +T+G+ FPQT   +E ++ AS 
Sbjct  858   SRRVCISSTQEFLSFENIHENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASL  917

Query  939   AIGKLLADECVFGYSSIDYLVFQEDKTHAARLWAMALHPYLTDSASTFATFHLLNR-GAL  997
              IG+ LA + + GY S+D+LV  +D+T    L+AMAL P+LT+SA++F+ F  L+R G  
Sbjct  918   VIGQALAKDGICGYISVDFLVILDDQTQNKILYAMALQPFLTNSAASFSLFQFLSRGGGY  977

Query  998   NASSGLYhlppvaaspsssstkslkpshsraagatgtsaaDLVMQEATHSGLVSLE-KAG  1056
             N+ +GL+               +     S    ++  SA DL+++EA  SG+VS E    
Sbjct  978   NSKTGLF---------HLPRAITSHGVTSDTPSSSSLSATDLMIREARLSGIVSNELPLT  1028

Query  1057  AQRTYVVSEYIFHPNVSTMQYSAFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMC  1116
               R+YV+ EY+ +PNV+T+ Y +FF  CR  GV FD+ER +G+VFLLADSLTAGV GIMC
Sbjct  1029  PTRSYVLLEYVCNPNVATLSYGSFFQNCRSRGVYFDIERDIGTVFLLADSLTAGVLGIMC  1088

Query  1117  CSDSASGALGFLRTALEVIGREVGTQA  1143
              SD+   AL   R A+E I    GT++
Sbjct  1089  ISDTRKNALLSCRAAMEAIAASAGTKS  1115

>PYAR_13581
Length=730

 Score = 367 bits (942),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 240/340 (71%), Gaps = 30/340 (9%)

Query  343  STDQSQEAESPETNLDDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYSLH  402
            STD+ +  ESP   LD E ++   D+AD    D +AMD+LRKNVEKIRGYNELLDTYSLH
Sbjct  47   STDEPEMDESPP-QLDTE-HAQHIDDADASESDANAMDDLRKNVEKIRGYNELLDTYSLH  104

Query  403  QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462
            QFIIHKGRAMRETPEF SFKRV QE+WG+V+EVIRALEALLTRYF               
Sbjct  105  QFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYF---------------  149

Query  463  AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522
               MA+F    LLSC+VNEDQV SL+RRPGQRYKGKDRKRRAA T+Q FFRM +++ ++ 
Sbjct  150  ---MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHRNRFR  206

Query  523  RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582
            R     AS   IQ  WR FA+ +SL+R+L  +RA+Q   W+ +M RL+  W  I   RRV
Sbjct  207  RVCRRGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRV  266

Query  583  VIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVD-IVYVSPFELTADVAQYSMK  641
            V+HVPSLS+DE +R+S D+F+V+QN+QL+RL  ++D  V+ +VYVSPFEL  D++     
Sbjct  267  VVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAVVDATVEYVVYVSPFELPTDLSH----  322

Query  642  LLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPH  681
                 G+A+   RVK+V PE AA FP HFSL T LLYSPH
Sbjct  323  -----GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357

 Score = 182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 130/393 (33%), Positives = 177/393 (45%), Gaps = 113/393 (29%)

Query  788   TALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPS  847
             TALLDVS +T LREIRR  K P YWKQP  RD  ARA++ ELER +  L  P H E +P 
Sbjct  388   TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447

Query  848   WQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVH-----VSSTQDIITTssnsss  902
             W+ F  AI + GVV+EA P+ V G VR N+F+ P+   H     V STQ+ +        
Sbjct  448   WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL--------  499

Query  903   sgggagkkagayrskTVGYAFPQTAAPYEAIRGASTAIGKLLADECVF-GYSSIDYLVFQ  961
                       +     + +A PQT  P++A+ GA+ AIG+LL ++  F GY+S+D L   
Sbjct  500   --------RASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVD-LQLC  550

Query  962   EDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYhlppvaaspsssstksl  1021
              D+T                     +  +LL   A++ S+ L                  
Sbjct  551   RDET---------------------SGLYLLPSPAVDTSAPL------------------  571

Query  1022  kpshsraagatgtsaaDLVMQEA---THSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYS  1078
                         + A  LV+QEA     S       + + R +V  ++  HPN+ TM  +
Sbjct  572   ------------SPATPLVLQEAHLLARSSRPLASPSASPRCFVSVDWAVHPNLCTMPTA  619

Query  1079  AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGRE  1138
             AFF  CR  GVCFDV R                            A+ +LRTA EV+ RE
Sbjct  620   AFFLACRRRGVCFDVTR---------------------------RAMQYLRTAFEVLARE  652

Query  1139  VGTQALMDEFMGGGESETGNFADVLAVIRALTG  1171
             VG+            S  GNF DVLA++R   G
Sbjct  653   VGSST---------PSSDGNFGDVLALLRHRVG  676

>PHYKE_8394
Length=428

 Score = 266 bits (679),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/222 (56%), Positives = 164/222 (74%), Gaps = 25/222 (11%)

Query  600  DNFSVKQNIQLSRLCGL-IDPNVDI-VYVSPFELTADVAQYSMKLLQLGGIADPVARVKL  657
            +NF+V+QN+QL+R+C   +D NVD+ VYVSPFELTADV+QY +KLLQLGG+AD   RVKL
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  658  VYPEQAARFPAHFSLTTLLLYSPHCLRRIQRYIRNKEAYLVTGIPGREDKRLAVALNVPI  717
            V+PEQA RFP                         K+AYLV G+PG ED+RLA+AL++PI
Sbjct  238  VFPEQALRFPT-----------------------GKDAYLVMGLPGAEDQRLAIALDLPI  274

Query  718  LGMDPLSALPLMTKSGSKRFFMRADVNVPTGTYDIYDEDELVFSLAKLIMSHIEQSVWVL  777
            LG  P  ALPL+T+SG KR  +RADVNVPTGTY++YD+ EL  +LAKL ++H++Q  W+L
Sbjct  275  LGAPPAQALPLLTRSGGKRLLIRADVNVPTGTYELYDDHELFAALAKLAVTHMDQPRWLL  334

Query  778  KIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPSTRD  819
            K+DYDP G G A++D+S M  +RE+RREK++PEYW+QP  RD
Sbjct  335  KLDYDPLGVGEAIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 24/150 (16%)

Query  1    MDQFQQQHHVEDVGRILLQTQEQLRLMREQMAAtsttpsssmrfassgasQPDVLAFQEI  60
            M++ QQQHHVEDVGR+LLQTQEQLR+MREQM A +    ++                +  
Sbjct  1    MEKMQQQHHVEDVGRLLLQTQEQLRVMREQMTAAAEAVEANAS------------PMRHS  48

Query  61   LQRAEVEIRAKAELVLNGFVNTSS--------QASALPTVSSSANGNASPKARLRQNVTS  112
              + E+E+RAKAELVLNG VN+SS          + LP V+      A P  RLR    S
Sbjct  49   TVKTEMELRAKAELVLNGMVNSSSNDQSNQNQHGTLLPAVTVG----APPSIRLRGGYDS  104

Query  113  LTAARRNSRLASDEPDLDYFRARFHNPAVE  142
            +   +  +R       +++FR RF N  VE
Sbjct  105  VGKPKMTTRKDGGSIPMEFFRERFRNSNVE  134

 Score = 39.3 bits (90),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 30/43 (70%), Gaps = 0/43 (0%)

Query  358  DDEVNSGGndnadddnddTSAMDELRKNVEKIRGYNELLDTYS  400
            DD+++      A +D D+ + M+EL  NV+KIRGYNELLD Y+
Sbjct  135  DDDLSDEDQGAAGNDRDEDAEMEELGANVDKIRGYNELLDAYT  177

 Score = 35.4 bits (80),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 14/50 (28%)

Query  885  VHVSSTQDIITTssnssssgggagkkagayrskTVGYAFPQTAAPYEAIR  934
            VHV+STQ+++ + S  +                TV Y FPQTAAP+EA++
Sbjct  390  VHVTSTQNVLASGSGLNRK--------------TVAYTFPQTAAPHEAVK  425

>PHYSO_489296
Length=1098

 Score = 39.7 bits (91),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 92/203 (45%), Gaps = 25/203 (12%)

Query  464  MEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAITIQNFFRMWWNQK  519
            ME+    ++D ++  +     G L R+  QR K K   RR    +A  IQ  FR +  +K
Sbjct  606  MELMELRRQDRMASHIGSIARGILARKFIQREKRKRYHRRVLEPSAARIQRVFRGYIVRK  665

Query  520  KYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKG-  578
            +    R  + + +T+Q++WR+ ++ +++K KL+  R      WEA   +++R +   +  
Sbjct  666  RLEDTRDQIEAAITLQQMWRSRSTVKTIKEKLRGFRLM---LWEAAAGKIQRCYLCYRAR  722

Query  579  ---NRRVVIHVPSLSIDERSRISA-DNFSVKQNIQLSRLCGLID----------PNVDIV  624
               N R + H         +  SA  ++  ++ ++  R C LI+           + +++
Sbjct  723  QELNFRRLTHQACFGKAALAVQSAWRSYCSRKQLKEFRFCSLIERKACSLTQAKEDREMI  782

Query  625  YVSPFELTAD---VAQYSMKLLQ  644
                F+  AD   V +Y  K L+
Sbjct  783  EFDIFDARADLKRVMKYKAKTLR  805

>PPTG_16221
Length=1259

 Score = 39.7 bits (91),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 73/172 (42%), Gaps = 25/172 (15%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE---SLKRKLKFQRAQQ  558
            R+ AI +Q   R W  +++Y R +     +V IQ+ WR +  H+   +L+R +   +AQ 
Sbjct  698  RKYAIVLQKNVRCWLMRRRYLRQKQQ---IVVIQKYWRRYVVHKRYLTLRRGVVLLQAQA  754

Query  559  HEQWEAKMQR-LKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQ-----NIQLSR  612
                  KM R LK D+  ++      +H       ER R      +V++        L R
Sbjct  755  RGVAARKMYRVLKFDYCIVRFQAYCRMHT------ERQRYLKKLAAVRRLQGFFRFSLLR  808

Query  613  LCGLIDPNVDIVYVSPFELTADVAQYSMKL----LQLGGIADPVARVKLVYP  660
            L  L     +  Y    EL + VAQ  MKL    +  G    P A+ + + P
Sbjct  809  LVFLRKMEKEKAYK---ELGSKVAQLQMKLDRKQVHTGAKMSPSAKNRSLSP  857

>H310_02709
Length=1390

 Score = 39.3 bits (90),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 57/120 (48%), Gaps = 20/120 (17%)

Query  451  AYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQN  510
             Y+  QR +   AM  AA + +  + C V    V            GK R +RA   IQ+
Sbjct  783  GYMVRQRYL---AMRQAAITLQCAVRCYVATHIV-----------HGKRRTKRAT-QIQS  827

Query  511  FFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLK  570
              +M   QK Y R RH   +V+ IQ + R F + ++  R L   +A++  + E ++QRLK
Sbjct  828  VVKMHRAQKAYGRIRH---AVLKIQCLVRGFIAKKTYARMLV--QAKEEAKLENQIQRLK  882

>PHYSO_360938
Length=1200

 Score = 38.9 bits (89),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 0/50 (0%)

Query  500  RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKR  549
            RKRR++I IQ  +R W    +Y R      + +T+QR  R F + + +KR
Sbjct  711  RKRRSSIRIQAIWRSWSCWNRYQRIIRRERAALTLQRTTRGFLARKQVKR  760

>PHYRA_84534
Length=1368

 Score = 38.5 bits (88),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 69/153 (45%), Gaps = 27/153 (18%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE---SLKRKLKFQRAQQ  558
            R+ AI +Q   R W  ++++ R + H   +V IQ+ WR +  H+   +L+R +   +AQ 
Sbjct  801  RKYAIVLQKNVRCWLMRRRFLRKKQH---IVAIQKYWRRYVVHKRYLTLRRGVVVLQAQA  857

Query  559  HEQWEAKMQR-LKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLI  617
                  KM R LK D+  ++      +H       ER R       +K+   + RL G  
Sbjct  858  RGVSARKMYRVLKFDYCIVRFQAYCRMHT------ERQRY------LKKLAAVRRLQGFF  905

Query  618  DPN-VDIVYVSPFE-------LTADVAQYSMKL  642
              + + +V++   E       L + VAQ  MKL
Sbjct  906  RFSLLRLVFLRKMEKEKAYKALGSKVAQLQMKL  938

>PHYCA_125363
Length=1089

 Score = 38.5 bits (88),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 66/141 (47%), Gaps = 11/141 (8%)

Query  432  VEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRP  491
            +E +IR   A   +++    Y           ME+    ++D ++  +     G L R+ 
Sbjct  579  IETLIRGFLARRLKFWRSYRYFQ-------KWMELMELRRKDRMASHIGAIARGILARKF  631

Query  492  GQRYKGKDRKRR----AAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESL  547
             +R K K   RR    +A  IQ  FR +  +K+    R  + + +T+Q++WR+ ++ +++
Sbjct  632  IRREKKKRYHRRVVEPSAARIQRVFRGYLVRKRLEDIRDQVEAAITLQQMWRSRSTIKTI  691

Query  548  KRKLKFQRAQQHEQWEAKMQR  568
            + KL+  R    E    ++QR
Sbjct  692  REKLRGFRVSLRESAAGRIQR  712

>HYAP_00989
Length=1330

 Score = 37.7 bits (86),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 0/50 (0%)

Query  500  RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKR  549
            RKRR+ + IQ  +R W   ++Y R      +VV +Q   R +A+ + +KR
Sbjct  844  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKR  893

>HYAP_12850
Length=978

 Score = 37.4 bits (85),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 0/50 (0%)

Query  500  RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKR  549
            RKRR+ + IQ  +R W   ++Y R      +VV +Q   R +A+ + +KR
Sbjct  492  RKRRSCVRIQAIWRSWSYWRRYQRVIRRQRAVVKVQSTIRGYAARKMVKR  541

>HYAP_08623
Length=1187

 Score = 37.0 bits (84),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 6/82 (7%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQ  561
            R+ AI +Q   R W  ++++ R +     +V IQ+ WR +  H   KR LK +R     Q
Sbjct  621  RKYAIVLQKNVRCWLMRRRFLRQKQQ---IVVIQKYWRRYVIH---KRYLKLRRGVVKLQ  674

Query  562  WEAKMQRLKRDWTHIKGNRRVV  583
             +A+    ++ +  +K + R+V
Sbjct  675  AQARGVSTRKMYRVLKFDYRIV  696

>PYIR_20202
Length=1555

 Score = 36.6 bits (83),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 3/46 (7%)

Query  500   RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE  545
             RK  AAI IQ+  RM   +K+Y RF+ H  ++V IQR W+ + + E
Sbjct  1366  RKITAAIKIQSVLRMALERKEY-RFQRH--AIVNIQRGWKRYLNIE  1408

>H310_09171
Length=1597

 Score = 36.6 bits (83),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 27/97 (28%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query  485  GSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASH  544
            G L R   Q+ + +   R AA+ +Q  +R W  + K  + R HLA++  +QR WR     
Sbjct  841  GHLAR---QQVRRQTATRTAAVLLQARYRGWVGRHKVRQLRQHLAAIC-VQRWWRGSQQR  896

Query  545  E----SLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIK  577
                  +   L  Q A +    +A +++LK+D   +K
Sbjct  897  RVFAAVVVAVLTIQCAWRSRVAKAHVKQLKQDAMSLK  933

>PPTG_08220
Length=1335

 Score = 36.2 bits (82),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 0/50 (0%)

Query  500  RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKR  549
            RKRR++I IQ  +R W    +Y R      + V +Q   R F + + LKR
Sbjct  849  RKRRSSIRIQAMWRSWSCWHRYQRIIRRTRAAVKLQCTTRGFLARKQLKR  898

>PPTG_23971
Length=112

 Score = 33.9 bits (76),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 4/60 (7%)

Query  138  NPAVEFVSSPVLPSPVQRITKGQLVKKKMAQNARLLPSVNKSDPSAPTPELSEQDAKSGM  197
            +P  E V SP   S V ++ +GQ+ +   A+ + LLP V +    AP P   E  AK G 
Sbjct  32   DPKAEIVHSPDFESGVVKVLRGQVNRLNRAEKSSLLPFVRR----APPPARVEDTAKVGF  87

>PITG_01615
Length=1087

 Score = 35.8 bits (81),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 55/109 (50%), Gaps = 4/109 (4%)

Query  464  MEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRR----AAITIQNFFRMWWNQK  519
            M++    + D ++  +     G L R+  QR K K   RR    +A  IQ  FR +  +K
Sbjct  601  MDLMELRRMDRMASQIGSIARGILTRKFIQREKQKRHFRRVIEPSAARIQRVFRGYIVRK  660

Query  520  KYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQR  568
            +    R  + + +T+Q++WR+ ++ ++++ KL+  R    E    ++QR
Sbjct  661  RLEGIRDQIEAAITLQQMWRSRSTVKTIREKLRGFRLALRESAAGRIQR  709

>PHYCA_53999
Length=947

 Score = 35.8 bits (81),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 23/80 (29%), Positives = 41/80 (51%), Gaps = 7/80 (9%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE---SLKRKLKFQRAQQ  558
            R+ AI +Q   R W  ++++ R +     +V IQ+ WR +  H+   +L+R +   +AQ 
Sbjct  698  RKYAIVLQKNVRCWLMRRRFLRQKQQ---IVVIQKYWRRYVVHKRYLTLRRGVVLLQAQA  754

Query  559  HEQWEAKMQR-LKRDWTHIK  577
                  KM R LK D+  ++
Sbjct  755  RGNSARKMYRVLKFDYCIVR  774

>PHYSO_318067
Length=1368

 Score = 35.8 bits (81),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 64/150 (43%), Gaps = 21/150 (14%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE---SLKRKLKFQRAQQ  558
            R+ AI +Q   R W  ++ + R +     +V IQ+ WR +  H+   +L+R +   +AQ 
Sbjct  801  RKYAIVLQKNVRCWLMRRLFLRQKQQ---IVVIQKYWRRYVVHKRYLTLRRGVVLLQAQV  857

Query  559  HEQWEAKMQR-LKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQ-----NIQLSR  612
                  KM R LK D+  ++      +H       ER R      +V++        L R
Sbjct  858  RGMSARKMYRVLKFDYCIVRFQAYCRMHT------ERQRYLKTLAAVRRLQGFFRFSLLR  911

Query  613  LCGLIDPNVDIVYVSPFELTADVAQYSMKL  642
            L  L     +  Y    EL + VAQ  MKL
Sbjct  912  LVFLRKMEKEKAYK---ELGSKVAQLQMKL  938

>PHYCA_510686
Length=932

 Score = 35.8 bits (81),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 0/50 (0%)

Query  500  RKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHESLKR  549
            RKRR++I IQ  +R W    +Y R      + VT+QR  R F + + LKR
Sbjct  446  RKRRSSIRIQTIWRSWSCWHRYQRIIRRQRAAVTLQRTTRGFLTRKQLKR  495

>SDRG_03273
Length=1325

 Score = 35.8 bits (81),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 47/200 (24%), Positives = 85/200 (43%), Gaps = 32/200 (16%)

Query  419  VSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAFSKRDLLSCI  478
            V  +RVA++ W +     +A +A +        ++  +R     AM +AA + +  + C 
Sbjct  761  VILQRVARQ-WAATTHYRKARKAAIVLQSYTRMFLTSRRYR---AMRLAAITLQCAVRCY  816

Query  479  VNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVW  538
            +    V  +            R+ + A+ IQ  F+M     KY R R+   + + +Q + 
Sbjct  817  MANAVVHGM------------RQTKGALKIQATFKMHVAYTKYMRVRN---ASIMMQCLV  861

Query  539  RAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRIS  598
            R F + +   R L   +A++  + E ++QRLK      K              D+ SR +
Sbjct  862  RGFIAKKGYARLLV--QAKEEAKLENQIQRLKDRLKEEKAR-----------ADQLSRRA  908

Query  599  ADNFSVKQNIQLSRLCGLID  618
            +   SV  +I+L    GLID
Sbjct  909  SMVGSVPLDIELEGASGLID  928

>PHYRA_80970
Length=758

 Score = 35.0 bits (79),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 55/143 (38%), Gaps = 24/143 (17%)

Query  1043  EATHSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYSAFFHTCRLH-------GVCFDVER  1095
             EAT SG  + E   AQR  +   +     +        F  C  H       G  F V  
Sbjct  149   EATDSGARAKEAFAAQRVRMRKAWCPDLRIYMKNAHPLFGICAAHRHHPYKRGDRFLV-L  207

Query  1096  CVGSVFLLADSLTAGVFGIM-CCSDSASGALGFLRTALEVIGREVGTQALMDEF------  1148
             CV    LL   L  G+F I  CC++     +  +   LE   RE+ T A  DE       
Sbjct  208   CVA---LLVAVLLCGLFAIRDCCTEVLDEPVAVVNRRLETTARELSTAAYFDESDAPPSR  264

Query  1149  MGGGESETGN------FADVLAV  1165
             + GGE+E  +      +AD  AV
Sbjct  265   LRGGETEADDVKCLPFYADCSAV  287

>PHYRA_72635
Length=476

 Score = 34.7 bits (78),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query  561  QWEAKMQRLKRDWTHI-KGNRRVVIHVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDP  619
            QW +K   +  D T   KG+ R+V H+  LSID  + +S+        +  ++L   IDP
Sbjct  182  QWSSKQVCINLDETPFSKGSLRIVYHLQDLSIDNSASLSSGGCYTGSYV--AKL--AIDP  237

Query  620  NVDI-VYVSPFELTADVAQYSMKLLQLGGIADPVARVKLV  658
            + D   Y    EL A  A Y+    Q+     P  RV+ +
Sbjct  238  DEDPQTYFRDIELQAHCAHYA----QVYNSYTPPKRVEFI  273

>PYU1_G007827
Length=1649

 Score = 34.7 bits (78),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 8/100 (8%)

Query  456  QRLMTVAAMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMW  515
            QR++    ME     KRD+L   V E++  + I+   + Y    R+  AA+TIQ+  R +
Sbjct  890  QRMLKDQEME----KKRDILKKRV-ENRAAACIQIGYKTYSSWKRRLSAAVTIQSAVRCF  944

Query  516  WNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQR  555
               K   RF++    VV +QR  R +  +  +K  L+F+R
Sbjct  945  LQHK---RFQYEYCRVVQLQRNVRIWRRNNQIKAFLRFER  981

>CCA16530
Length=1512

 Score = 34.3 bits (77),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 26/43 (60%), Gaps = 3/43 (7%)

Query  499   DRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAF  541
             +RK RAAI +Q+  RM   + +Y   R    ++V+IQR WR +
Sbjct  1303  ERKIRAAILVQSLMRMELERVEYKLQRR---AIVSIQRCWRRY  1342

>CCI44515
Length=5716

 Score = 34.3 bits (77),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 35/136 (26%), Positives = 63/136 (46%), Gaps = 12/136 (9%)

Query  464   MEMAAFSKRDLLSCIVNEDQV--GSLIRRPGQ-----RYKGKDRKRRAAITIQNFFRMWW  516
             + +AA+++  L   ++    +  G + RR  +     RY+G   +  AAI +Q   R + 
Sbjct  5250  LRIAAYNRNVLFPAVILFQSICRGFIDRREAEKIKLWRYQGT-VQFDAAILLQKHIRSFL  5308

Query  517   NQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQR--LKRDWT  574
             +++   + R+H  S   IQ VWRAF     + R+ K +   +H        R  L R + 
Sbjct  5309  SRQIVQKGRNHYFSAGKIQTVWRAFQRRRCVARQRKSRDLHKHASTIGAAVRGALARRYC  5368

Query  575   HIKGNRRVV--IHVPS  588
              +K  ++ V  + VPS
Sbjct  5369  VVKKGQKYVQEVEVPS  5384

>PYU1_G002439
Length=249

 Score = 33.5 bits (75),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 12/81 (15%)

Query  757  ELVFSLAKLIMSHIEQSVWVLKIDYDPFGTGTALLDVSTMTVLREIRREKKSPEYWKQPS  816
            ELVF  ++  +++IE S+++L       G G    +  +  V R    E++ PE WK+ S
Sbjct  177  ELVFGASQQNLAYIEASIFLL-------GFGGKTNESVSAEVARSFVIEERIPEGWKRAS  229

Query  817  TRDNAARAIIAELERTLAHLV  837
            T  +     +AE++ T+A+++
Sbjct  230  TVIS-----VAEVKATVANII  245

>PYIW_19872
Length=998

 Score = 34.3 bits (77),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 96/220 (44%), Gaps = 57/220 (26%)

Query  425  AQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVAAMEMAAF------SKRDLLSCI  478
            A+   GS EE+ + +E LL+    P   I  +R++ +A+     F       K DLL  I
Sbjct  785  AEGTLGSGEELQKQIEKLLSANEDPSDQISAKRVVKIASESTLLFHSAESVEKLDLLLEI  844

Query  479  VNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWN-------QKKYTRFRHHL---  528
                                 R+ +AAITIQ+F RM  +       QK+    ++ L   
Sbjct  845  ---------------------RQIQAAITIQSFARMLKDRNVYLEKQKELKSLKNELVEL  883

Query  529  ---ASVVTIQRVWRAFASHE-SLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRVVI  584
               A++  ++++   ++S+E  L+ K+  ++    E+  A++++L+RD            
Sbjct  884  YGEANMRKVEKILNKYSSNEDELRAKIAAKKLIVREE-HAQIEQLERD------------  930

Query  585  HVPSLSIDERSRISADNFSVKQNIQLSRLCGLIDPNVDIV  624
             + SL +     + A+  +V + +   ++C L+  N  IV
Sbjct  931  -LKSLCLSSEGGLRAE--TVNEILSDEKICSLLQQNESIV  967

>PYAP_14441
Length=1271

 Score = 33.9 bits (76),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 22/76 (29%), Positives = 40/76 (53%), Gaps = 5/76 (7%)

Query  485  GSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASH  544
            G+L RR  +R +  +R R++A +IQ   R +  +++  R R    + +T+QR++R     
Sbjct  590  GALARRFVKRVR--ERLRQSATSIQRLVRQYLAKRRMFRVRKRKNAAITVQRIFRGHLGR  647

Query  545  ---ESLKRKLKFQRAQ  557
               +S K K  F + Q
Sbjct  648  KRFQSEKDKFLFSKTQ  663

>PHYRA_80594
Length=1575

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query  504  AAITIQNFFRMW----------WNQKKYTRFRHHLASVVTIQRVWRAFASHESLKRKLKF  553
            +A+ IQ+ FR +          + + K+  F    +S + IQ  WR F    +   +L+ 
Sbjct  808  SAVVIQSLFRGYLARRRAQRARYERLKWMNFTLLNSSALKIQAFWRGFHGRLASHLRLQA  867

Query  554  QRAQQHEQWEA--KMQRLKRDWTHIKGNRRVVIHVPSLSIDERSRISA  599
            Q+AQQH++ EA  ++Q + R     +  R++      L+  +R+R+ A
Sbjct  868  QKAQQHQENEAAKRIQVIARGKLAREERRKLDQERAKLASQQRTRVKA  915

>PHYSO_516694
Length=985

 Score = 33.9 bits (76),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (57%), Gaps = 5/46 (11%)

Query  799  LREIRREKKSPEYWKQPSTRDNAARAIIAE-----LERTLAHLVTP  839
            LR + +++ +   W++PS RD + RA +A+     L+  L H  +P
Sbjct  830  LRSVLKQRSTKVLWQEPSVRDASGRAFVAKWSTRGLDSVLYHCASP  875

>PITG_17549
Length=1360

 Score = 33.9 bits (76),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 40/150 (27%), Positives = 64/150 (43%), Gaps = 21/150 (14%)

Query  502  RRAAITIQNFFRMWWNQKKYTRFRHHLASVVTIQRVWRAFASHE---SLKRKLKFQRAQQ  558
            R+ AI +Q     W  ++++ R +     +V IQ+ WR +  H+   +L+R +   +AQ 
Sbjct  799  RKYAIVLQKNVLCWLMRRRFLRQKQQ---IVVIQKYWRRYVVHKRYLTLRRGVVVLQAQA  855

Query  559  HEQWEAKMQR-LKRDWTHIKGNRRVVIHVPSLSIDERSRISADNFSVKQ-----NIQLSR  612
                  KM R LK D+  ++      +H       ER R      +V++        L R
Sbjct  856  RGVAARKMYRVLKFDYCIVRFQAYCRMHT------ERQRYLKKLAAVRRLQGFFRFSLLR  909

Query  613  LCGLIDPNVDIVYVSPFELTADVAQYSMKL  642
            L  L     +  Y    EL + VAQ  MKL
Sbjct  910  LVFLRKMEKEKAYK---ELGSKVAQLQMKL  936

Lambda      K        H        a         alpha
   0.319    0.132    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 100588896846

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40