Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_134521475364564533220.0
PYIW_199721475360963927560.0
PYAP_177619907562260925160.0
PHYKE_83911475377865823880.0
PHYCA_5561601475364964523400.0
PITG_184521475385662523070.0
HYAP_070951475361361522470.0
PYAR_135699907549448321510.0
PHALS_064811475364461521280.0
PHYSO_3489011475352649021110.0
H257_084361475364261020900.0
H310_085901475364061220890.0
PHYRA_508551475348948820850.0
PYVX_181701475351053719780.0
SPRG_141031475362863919680.0
SDRG_167201475362863919560.0
SPRG_0407412408750949711075e-144
SDRG_1440812408752849711095e-144
SDRG_038221356704944746703e-79
SDRG_150451241574944736555e-77
SDRG_111311368074944736503e-76
SDRG_03823114284974736486e-76
PYIR_17506109045094916356e-74
SDRG_12187109044624776185e-72
PHYCA_504517114284934766198e-72
PYAP_21882109045024926163e-71
PHYSO_254571109044894936135e-71
CCI11048114284964666136e-71
SPRG_11769109044534726098e-71
PHALS_08068109044974866111e-70
PPTG_09787114284934766111e-70
SPRG_05609114284964766083e-70
PHYRA_72037114284934816074e-70
PYIW_25301109045124946085e-70
CCA23647114284964666067e-70
H310_144471462305014756051e-69
PYAR_17512109045335166071e-69
PHYSO_550665114284914796013e-69
PITG_14083114284934765996e-69
H257_09722114285184805972e-68
HYAP_08763114284734665933e-68
PYAP_234351008029514786184e-68
H257_170371462304984585902e-67
PHYKE_103271090612004956121e-66
PHYRA_71927109044854955821e-66
PHALS_09136114284934795761e-65
H310_11259114285194805736e-65
PPTG_18033109045004875727e-65
PHYKE_6836114284934765612e-63
PITG_13427109044634845461e-61
PYVX_21517109044824975402e-60
PHYCA_7619109044624745268e-59
PYIR_23431114284684574918e-54
HYAP_04843109044304024783e-52
PYAR_177141008024444754565e-49
PYVX_16175114284464594401e-46
CCA22989124014944744253e-44
CCI10477124014944744182e-43
PYIR_20273124015054794043e-41
PYU1_G001737147531331273683e-40
PYAP_226451707615654714064e-40
HYAP_12621124015014793682e-36
PHYSO_556052124015004323461e-33
SPRG_199431356703432383343e-33
PYVX_21248124015024433363e-32
PHYKE_9680124014984303353e-32
PYAR_20075170764694403264e-31
PHALS_09942124014964323265e-31
PYU1_G014259109042442173115e-31
PHYRA_72215124014994323258e-31
PITG_15359124014964353241e-30
PHYCA_123621124014954323161e-29
SPRG_09825124014924823096e-29
H257_16541124014944533097e-29
H310_02523124014944443081e-28
SDRG_06945124014924823062e-28
H257_01186151564964823034e-28
CCA16670151565204853035e-28
PYAR_16840151565365022965e-27
CCI50816151568074822995e-27
PYIW_19795151565194842949e-27
H310_00561151564974822931e-26
PYIW_251901648732061852751e-26
PHYRA_47253151564814932902e-26
PYU1_G011605151565244882903e-26
PYVX_20512151565284912842e-25
PPTG_0093815665505072823e-25
PHYRA_7388315665515062814e-25
PITG_18935150674804332786e-25
PYAP_19280151565124882708e-24
PPTG_09121151565204962709e-24
SDRG_0506015665595162701e-23
SPRG_1205415665585162701e-23
SDRG_14446151564954782671e-23
PHALS_10055151565164922653e-23
PHALS_1202815665795212655e-23
PHYCA_50444515665485042611e-22
PHYCA_555180151565214992583e-22
PYIR_1413215665135042574e-22
PYIW_2025715665034912512e-21
PHYKE_980715665575112494e-21
PHYKE_2864151564864892476e-21
H310_0764115665485142451e-20
PYU1_G00569915665505112451e-20
PYIR_21896151565184932432e-20
PYIW_24688114282592792288e-20
PPTG_13000124013873862322e-19
HYAP_0414915665645162334e-19
PYAP_1914815665355202317e-19
H257_0745015665673752282e-18
HYAP_08069650262552132182e-18
PHYSO_48941815664714622253e-18
CCI3999315665505152236e-18
PYVX_2349915665195102229e-18
CCA1403015665605152211e-17
PITG_0177815664704642146e-17
PYAR_1666415665773881996e-15
PHYSO_562795151564153301941e-14
PITG_19065151564164091941e-14
SPRG_04114151563763351682e-11
HYAP_13613151564232161522e-09
PPTG_247122910367621161e-06
PITG_19802156311851561152e-05
SPRG_0423112415790531012e-04
SPRG_186431333348530860.022
PYIW_2756812401128117850.053
CCI409892416552141840.40
HYAP_080686502510057770.41
PYAP_15943241513930790.44
PITG_02760241516530790.63
PYAP_1625194218225114800.73
PYU1_G000378105671070221820.80
PYU1_G004385241656230801.2
PYVX_18330241655830801.3
PHYKE_5677241621130771.4
H310_07705241654664791.7
PPTG_05518241655430772.5
H310_0629614909759031772.6
SDRG_05159241655164754.1
SPRG_08354241655064754.3
PHYRA_48183241653229754.4
CCA2471011144686148754.7
SPRG_0452612434533464737.2
SPRG_1762613240814858707.8
PYIW_147818177733946728.1
PHYSO_261176241654130738.8
PYU1_G0099888177728446728.9
PYIR_136108177733946728.9
H257_18256553249257729.2
H257_1825513524149257729.2
H257_04036125006104962739.4
PHYSO_256448464761175104739.6
SDRG_0650112817662331729.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_13452

Length=645
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_13452                                                            1284       0.0   
PYIW_19972                                                            1066       0.0   
PYAP_17761                                                            973        0.0   
PHYKE_8391                                                            924        0.0   
PHYCA_556160                                                          905        0.0   
PITG_18452                                                            893        0.0   
HYAP_07095                                                            870        0.0   
PYAR_13569                                                            833        0.0   
PHALS_06481                                                           824        0.0   
PHYSO_348901                                                          817        0.0   
H257_08436                                                            809        0.0   
H310_08590                                                            809        0.0   
PHYRA_50855                                                           807        0.0   
PYVX_18170                                                            766        0.0   
SPRG_14103                                                            762        0.0   
SDRG_16720                                                            758        0.0   
SPRG_04074                                                            431        5e-144
SDRG_14408                                                            431        5e-144
SDRG_03822                                                            262        3e-79 
SDRG_15045                                                            256        5e-77 
SDRG_11131                                                            254        3e-76 
SDRG_03823                                                            254        6e-76 
PYIR_17506                                                            249        6e-74 
SDRG_12187                                                            242        5e-72 
PHYCA_504517                                                          243        8e-72 
PYAP_21882                                                            241        3e-71 
PHYSO_254571                                                          240        5e-71 
CCI11048                                                              240        6e-71 
SPRG_11769                                                            239        8e-71 
PHALS_08068                                                           239        1e-70 
PPTG_09787                                                            239        1e-70 
SPRG_05609                                                            238        3e-70 
PHYRA_72037                                                           238        4e-70 
PYIW_25301                                                            238        5e-70 
CCA23647                                                              238        7e-70 
H310_14447                                                            237        1e-69 
PYAR_17512                                                            238        1e-69 
PHYSO_550665                                                          236        3e-69 
PITG_14083                                                            235        6e-69 
H257_09722                                                            234        2e-68 
HYAP_08763                                                            233        3e-68 
PYAP_23435                                                            242        4e-68 
H257_17037                                                            231        2e-67 
PHYKE_10327                                                           240        1e-66 
PHYRA_71927                                                           228        1e-66 
PHALS_09136                                                           226        1e-65 
H310_11259                                                            225        6e-65 
PPTG_18033                                                            224        7e-65 
PHYKE_6836                                                            220        2e-63 
PITG_13427                                                            214        1e-61 
PYVX_21517                                                            212        2e-60 
PHYCA_7619                                                            207        8e-59 
PYIR_23431                                                            193        8e-54 
HYAP_04843                                                            188        3e-52 
PYAR_17714                                                            180        5e-49 
PYVX_16175                                                            174        1e-46 
CCA22989                                                              168        3e-44 
CCI10477                                                              165        2e-43 
PYIR_20273                                                            160        3e-41 
PYU1_G001737                                                          146        3e-40 
PYAP_22645                                                            160        4e-40 
HYAP_12621                                                            146        2e-36 
PHYSO_556052                                                          137        1e-33 
SPRG_19943                                                            133        3e-33 
PYVX_21248                                                            134        3e-32 
PHYKE_9680                                                            133        3e-32 
PYAR_20075                                                            130        4e-31 
PHALS_09942                                                           130        5e-31 
PYU1_G014259                                                          124        5e-31 
PHYRA_72215                                                           129        8e-31 
PITG_15359                                                            129        1e-30 
PHYCA_123621                                                          126        1e-29 
SPRG_09825                                                            123        6e-29 
H257_16541                                                            123        7e-29 
H310_02523                                                            123        1e-28 
SDRG_06945                                                            122        2e-28 
H257_01186                                                            121        4e-28 
CCA16670                                                              121        5e-28 
PYAR_16840                                                            118        5e-27 
CCI50816                                                              119        5e-27 
PYIW_19795                                                            117        9e-27 
H310_00561                                                            117        1e-26 
PYIW_25190                                                            110        1e-26 
PHYRA_47253                                                           116        2e-26 
PYU1_G011605                                                          116        3e-26 
PYVX_20512                                                            114        2e-25 
PPTG_00938                                                            113        3e-25 
PHYRA_73883                                                           112        4e-25 
PITG_18935                                                            111        6e-25 
PYAP_19280                                                            108        8e-24 
PPTG_09121                                                            108        9e-24 
SDRG_05060                                                            108        1e-23 
SPRG_12054                                                            108        1e-23 
SDRG_14446                                                            107        1e-23 
PHALS_10055                                                           106        3e-23 
PHALS_12028                                                           106        5e-23 
PHYCA_504445                                                          105        1e-22 
PHYCA_555180                                                          103        3e-22 
PYIR_14132                                                            103        4e-22 
PYIW_20257                                                            101        2e-21 
PHYKE_9807                                                            100        4e-21 
PHYKE_2864                                                            99.8       6e-21 
H310_07641                                                            99.0       1e-20 
PYU1_G005699                                                          99.0       1e-20 
PYIR_21896                                                            98.2       2e-20 
PYIW_24688                                                            92.4       8e-20 
PPTG_13000                                                            94.0       2e-19 
HYAP_04149                                                            94.4       4e-19 
PYAP_19148                                                            93.6       7e-19 
H257_07450                                                            92.4       2e-18 
HYAP_08069                                                            88.6       2e-18 
PHYSO_489418                                                          91.3       3e-18 
CCI39993                                                              90.5       6e-18 
PYVX_23499                                                            90.1       9e-18 
CCA14030                                                              89.7       1e-17 
PITG_01778                                                            87.0       6e-17 
PYAR_16664                                                            81.3       6e-15 
PHYSO_562795                                                          79.3       1e-14 
PITG_19065                                                            79.3       1e-14 
SPRG_04114                                                            69.3       2e-11 
HYAP_13613                                                            63.2       2e-09 
PPTG_24712                                                            49.3       1e-06 
PITG_19802                                                            48.9       2e-05 
SPRG_04231                                                            43.5       2e-04 
SPRG_18643                                                            37.7       0.022 
PYIW_27568                                                            37.4       0.053 
CCI40989                                                              37.0       0.40  
HYAP_08068                                                            34.3       0.41  
PYAP_15943                                                            35.0       0.44  
PITG_02760                                                            35.0       0.63  
PYAP_16251                                                            35.4       0.73  
PYU1_G000378                                                          36.2       0.80  
PYU1_G004385                                                          35.4       1.2   
PYVX_18330                                                            35.4       1.3   
PHYKE_5677                                                            34.3       1.4   
H310_07705                                                            35.0       1.7   
PPTG_05518                                                            34.3       2.5   
H310_06296                                                            34.3       2.6   
SDRG_05159                                                            33.5       4.1   
SPRG_08354                                                            33.5       4.3   
PHYRA_48183                                                           33.5       4.4   
CCA24710                                                              33.5       4.7   
SPRG_04526                                                            32.7       7.2   
SPRG_17626                                                            31.6       7.8   
PYIW_14781                                                            32.3       8.1   
PHYSO_261176                                                          32.7       8.8   
PYU1_G009988                                                          32.3       8.9   
PYIR_13610                                                            32.3       8.9   
H257_18256                                                            32.3       9.2   
H257_18255                                                            32.3       9.2   
H257_04036                                                            32.7       9.4   
PHYSO_256448                                                          32.7       9.6   
SDRG_06501                                                            32.3       9.7   

>PYIR_13452
Length=645

 Score = 1284 bits (3322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/645 (100%), Positives = 645/645 (100%), Gaps = 0/645 (0%)

Query  1    MTDEEDAQLQASGRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVV  60
            MTDEEDAQLQASGRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVV
Sbjct  1    MTDEEDAQLQASGRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVV  60

Query  61   TAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANT  120
            TAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANT
Sbjct  61   TAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANT  120

Query  121  RGFIGGCDDTLALFRSGVSapatlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACS  180
            RGFIGGCDDTLALFRSGVSAPATLAATPTMVAAAPAPADDAKYDYDLIVIGGGSGGLACS
Sbjct  121  RGFIGGCDDTLALFRSGVSAPATLAATPTMVAAAPAPADDAKYDYDLIVIGGGSGGLACS  180

Query  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFG  240
            KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFG
Sbjct  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFG  240

Query  241  WTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  300
            WTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG
Sbjct  241  WTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG  300

Query  301  TKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFM  360
            TKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFM
Sbjct  301  TKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFM  360

Query  361  KGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKW  420
            KGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKW
Sbjct  361  KGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKW  420

Query  421  VSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIG  480
            VSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIG
Sbjct  421  VSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIG  480

Query  481  DVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKY  540
            DVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKY
Sbjct  481  DVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKY  540

Query  541  GEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAI  600
            GEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAI
Sbjct  541  GEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAI  600

Query  601  GLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
            GLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC
Sbjct  601  GLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645

>PYIW_19972
Length=609

 Score = 1066 bits (2756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/639 (84%), Positives = 565/639 (88%), Gaps = 31/639 (5%)

Query  7    AQLQASGRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVL  66
            A+LQASG KREA     M   NIKETLV  GGP  YH+AGWRGCGFYKKASDV+ AMRVL
Sbjct  2    AELQASGTKREAT----MATVNIKETLVRGGGPPTYHIAGWRGCGFYKKASDVMQAMRVL  57

Query  67   YPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANTRGFIGG  126
            YPD VD E+HEFPDREAFR WL+AS+   +    FGADSKA TH SSPF          G
Sbjct  58   YPDAVDCEIHEFPDREAFRAWLSASAA--DFAANFGADSKAATHTSSPFF---------G  106

Query  127  CDDTLALFRSGVSapatlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACSKEASKY  186
             D++                    + AAP   D+  YDYDLIVIGGGSGGLACSKEA+KY
Sbjct  107  KDES----------------PTPTMVAAPVVDDNVTYDYDLIVIGGGSGGLACSKEAAKY  150

Query  187  GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQ  246
            GKKVCVLDYVKPSP GT+WGLGGTCVNVGCIPKKLMHQSSLIGETIHKDA AFGW+VGEQ
Sbjct  151  GKKVCVLDYVKPSPGGTTWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAAAFGWSVGEQ  210

Query  247  TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT  306
             FDW+QMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT
Sbjct  211  KFDWAQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTT  270

Query  307  RDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYD  366
            RDVVIAVGGRPKPLSCEGG+LAISSDDIFWRKEAPGKTLV+GASYVALECAGFMKGMGYD
Sbjct  271  RDVVIAVGGRPKPLSCEGGELAISSDDIFWRKEAPGKTLVIGASYVALECAGFMKGMGYD  330

Query  367  VKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGE  426
            VKIMVRSILLRGFDQDMA+KIGEFME ESKIEFIRGAVPQSITKLESGQLLVKWVS+DG+
Sbjct  331  VKIMVRSILLRGFDQDMASKIGEFMEVESKIEFIRGAVPQSITKLESGQLLVKWVSSDGD  390

Query  427  TCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAP  486
             CEEAFDTVLNATGRDPDVAKL LD VGV+LNPKTGRIAVTNEQTS PNI+AIGDVIDAP
Sbjct  391  ICEEAFDTVLNATGRDPDVAKLNLDSVGVQLNPKTGRIAVTNEQTSVPNIFAIGDVIDAP  450

Query  487  ELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLE  546
            ELTPVAIQAGR+LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEK+GE+ LE
Sbjct  451  ELTPVAIQAGRMLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKFGEDKLE  510

Query  547  IYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKL  606
            IYHQNFTPLEWSLSSDR+AAGSCYVKVICDT RNKHVVGFHYLGPNAGEVTQAIGLAMKL
Sbjct  511  IYHQNFTPLEWSLSSDRQAAGSCYVKVICDTTRNKHVVGFHYLGPNAGEVTQAIGLAMKL  570

Query  607  GFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
            GFTYD MVNVVGIHPTTAEIFTTLEVTKSSGESAA+GGC
Sbjct  571  GFTYDDMVNVVGIHPTTAEIFTTLEVTKSSGESAAAGGC  609

>PYAP_17761
Length=622

 Score = 973 bits (2516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/609 (78%), Positives = 528/609 (87%), Gaps = 2/609 (0%)

Query  37   GGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEE  96
            G P  Y+VAGW  C +Y+KA DV  AM++LY D V  E  EF  R+AF+ WLA S+    
Sbjct  16   GAPATYYVAGWATCPWYRKARDVAQAMQLLYSDAVAVEAVEFESRDAFKAWLAESNA--A  73

Query  97   LTECFGADSKALTHKSSPFVWANTRGFIGGCDDTLALFRSGVSapatlaatptmvaaapa  156
              + FG DS ALTH SSPFVW+N RGFIGGCD TLA FRSGV+A      + +      A
Sbjct  74   FAQAFGTDSPALTHTSSPFVWSNARGFIGGCDATLAHFRSGVAARPLAGPSASPTMTPVA  133

Query  157  paddaKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGC  216
              +   YDYDL+VIGGGSGGLACSKEA+KYGKKVCVLDYVKPSP+GT+WGLGGTCVNVGC
Sbjct  134  VDESKTYDYDLVVIGGGSGGLACSKEAAKYGKKVCVLDYVKPSPLGTTWGLGGTCVNVGC  193

Query  217  IPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKK  276
            IPKKLMHQS+LIGE +HKDA AFGW +GEQ F W+Q+++SVN+YIK INFKYKVELRDKK
Sbjct  194  IPKKLMHQSALIGELMHKDAGAFGWNMGEQKFTWTQLVESVNNYIKGINFKYKVELRDKK  253

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            VKYEN LGSFVD HT+ELWH KKGTKT+TTR VV+AVGGRP+ LSC GG+ AISSDDIFW
Sbjct  254  VKYENFLGSFVDPHTIELWHHKKGTKTITTRHVVVAVGGRPRQLSCPGGEHAISSDDIFW  313

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESK  396
            RK  PGKTLVVGASYVALECAGF+KGMGY+VK+MVRSILLRGFD+DMAN+IG+FM+ ESK
Sbjct  314  RKTEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDEDMANRIGDFMQDESK  373

Query  397  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
            IEFIRGAVP+SI KLE+GQLLVKW SADGET EE FD+VLNATGRDPDV+KL LDK GV+
Sbjct  374  IEFIRGAVPKSIEKLENGQLLVKWNSADGETVEEVFDSVLNATGRDPDVSKLNLDKAGVQ  433

Query  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKV  516
            LNPKTGRIAVTNEQTSTPN++AIGDVIDAPELTPVAIQAGRLLARRLYNNET LMDYDKV
Sbjct  434  LNPKTGRIAVTNEQTSTPNVFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKV  493

Query  517  CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICD  576
            CTAVFTPIEYGCCGLSEEA+ +KYGE+NLEIYHQ+F PLEWSLS DR AA +CYVKVICD
Sbjct  494  CTAVFTPIEYGCCGLSEEAAKDKYGEDNLEIYHQSFMPLEWSLSQDRVAANTCYVKVICD  553

Query  577  TKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSS  636
              R+K+VVGFHYLGPNAGEVTQA+GLAMK+GFTYDQMVNVVGIHPTTAE+FTTLEVTKSS
Sbjct  554  KTRDKYVVGFHYLGPNAGEVTQAMGLAMKIGFTYDQMVNVVGIHPTTAEVFTTLEVTKSS  613

Query  637  GESAASGGC  645
            G SAA+GGC
Sbjct  614  GASAAAGGC  622

>PHYKE_8391
Length=778

 Score = 924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/658 (69%), Positives = 515/658 (78%), Gaps = 31/658 (5%)

Query  15   KREARSGELMTRANIKETLV--HEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72
            K   + GE     N+ ETL        T +H++GWR C  + KA +V  AM++LYPD V 
Sbjct  125  KMPLKDGEFT--KNLAETLATASNSSVTTFHISGWRTCPSFTKAGEVAAAMQMLYPDKVS  182

Query  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWA-NTRGFIGGCDDTL  131
            FE H F DR+AF++WL+ S   +     FGADSKA+TH +SPFVW+ N   F+GGCDD L
Sbjct  183  FETHAFEDRDAFKQWLSTSK--DHFVMHFGADSKAVTHVTSPFVWSSNPIKFVGGCDDLL  240

Query  132  ALFRSGV------------------SapatlaatptmvaaapapaddaKYDYDLIVIGGG  173
            A FRSGV                  S     ++       A    ++  YDYDL+VIGGG
Sbjct  241  AFFRSGVAVGSPQGADPAEKAEAAASIEVAESSMTVTETPAVPMEEETSYDYDLVVIGGG  300

Query  174  SGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIH  233
            SGGLACSKEA+ +G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLMHQSSLIGET+H
Sbjct  301  SGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGETMH  360

Query  234  KDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  288
             D+  FGW V        TFDW Q++ +V+SYIKSINFKYKVELR K VKYEN LGSF+D
Sbjct  361  HDSANFGWNVASGEGKGATFDWKQLVSNVDSYIKSINFKYKVELRSKYVKYENFLGSFLD  420

Query  289  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-RKEAPGKTLVV  347
             HTLELWHP+KGTK +TTR VV+AVGGRPK L+C G + AISSDDIFW +K APGKTLVV
Sbjct  421  PHTLELWHPRKGTKQITTRHVVVAVGGRPKQLTCPGAEYAISSDDIFWMKKTAPGKTLVV  480

Query  348  GASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQS  407
            GASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMANKIGE+ME ++ IEFIR  VP+S
Sbjct  481  GASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQAGIEFIRKTVPES  540

Query  408  ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT  467
            ITKLE+GQLLVKW + D E+CEE FDTVLNATGRDPDVAKLGLDK GVKLN KTGRI   
Sbjct  541  ITKLENGQLLVKWTTEDDESCEETFDTVLNATGRDPDVAKLGLDKAGVKLNEKTGRIWTK  600

Query  468  NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYG  527
            NEQTSTPNI+AIGDVIDAPELTPVAIQAGR L+RRLYNN T  MDYDKVCTAVFTPIEYG
Sbjct  601  NEQTSTPNIFAIGDVIDAPELTPVAIQAGRFLSRRLYNNSTVQMDYDKVCTAVFTPIEYG  660

Query  528  CCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFH  587
            CCGLSEE S E++GE+N+E+YH+NF PLEWSLS  R ++ SCYVKVICDT R+K VVGFH
Sbjct  661  CCGLSEEDSNERFGEDNVEVYHKNFVPLEWSLSESRTSSESCYVKVICDTTRDKFVVGFH  720

Query  588  YLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
            YLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  721  YLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAEAFTTLEVTKSSGATTTGGGC  778

>PHYCA_556160
Length=649

 Score = 905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/645 (70%), Positives = 514/645 (80%), Gaps = 30/645 (5%)

Query  29   IKETLVH--EGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFRE  86
            + ETLV   +     +H+AGW+ C  + KA +V TAM++LYPD V FELH F DREAF+ 
Sbjct  7    LAETLVTSPDSSVATFHIAGWKTCPSFVKAGEVATAMQMLYPDRVTFELHPFEDREAFKH  66

Query  87   WLAASSTIEELTECFGADSKALTHKSSPFVWA-NTRGFIGGCDDTLALFRSGV-------  138
            WL+ S   +E    FG DSKA  H +SPFVW+ N   F+GGCDD L  FRSGV       
Sbjct  67   WLSESQ--DEFATSFGVDSKATKHVTSPFVWSSNPTAFVGGCDDLLTYFRSGVGVGNPQG  124

Query  139  -----------SapatlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACSKEASKYG  187
                       +      +  ++   + A A++  YDYDL+VIGGGSGGLACSKEA+ +G
Sbjct  125  ATPNGSPTEKTAEADVPMSETSVEETSTADAEETNYDYDLVVIGGGSGGLACSKEAASFG  184

Query  188  KKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGE--  245
            +KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLMHQSSLIGE IH D   FGW +    
Sbjct  185  QKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVIHHDGANFGWNLSSGD  244

Query  246  ---QTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTK  302
                TF+W Q++ +V+ YIKSINFKYKVELR K VKYEN LGSFV+ HTLELWHP+KGTK
Sbjct  245  GNAPTFNWKQLVSNVDGYIKSINFKYKVELRSKYVKYENFLGSFVNPHTLELWHPRKGTK  304

Query  303  TVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-RKEAPGKTLVVGASYVALECAGFMK  361
             +TTRDVVIAVGGRPK L+C GG+ AISSDDIFW +K+ PGKTLVVGASYVALECAGF+K
Sbjct  305  QITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWMKKKEPGKTLVVGASYVALECAGFLK  364

Query  362  GMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV  421
            GMGYDVK+MVRSILLRGFDQDMA+KIGE+ME +S IEFIR  VPQSITKLE+GQLLVKW 
Sbjct  365  GMGYDVKVMVRSILLRGFDQDMADKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWT  424

Query  422  SADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGD  481
            S DGE+CEEAFDTVLNATGRDPDVAKL LDK GVKLN K+GRI V NEQTSTPNIYAIGD
Sbjct  425  SEDGESCEEAFDTVLNATGRDPDVAKLNLDKAGVKLNEKSGRIWVKNEQTSTPNIYAIGD  484

Query  482  VIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYG  541
            VIDAPELTPVAIQAGRLL+RRLYNN T  MDY+KVCTAVFTPIEYGCCG+SEE S E++G
Sbjct  485  VIDAPELTPVAIQAGRLLSRRLYNNSTVQMDYEKVCTAVFTPIEYGCCGMSEEDSKERFG  544

Query  542  EENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAI  600
            E+N+E+YH NF PLEWSLS+D R AA SCY+KVICD  R+K VVGFHYLGPNAGEVTQA+
Sbjct  545  EDNIEVYHTNFVPLEWSLSTDTRTAAESCYLKVICDKTRDKFVVGFHYLGPNAGEVTQAM  604

Query  601  GLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
            GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEVTKSSG +   GGC
Sbjct  605  GLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSGGATTGGGC  649

>PITG_18452
Length=856

 Score = 893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/625 (70%), Positives = 504/625 (81%), Gaps = 32/625 (5%)

Query  42   YHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECF  101
            +++AGW+ C  + KA +V  AM++LYPD V FE H F DR AF++WL+AS   +++T  F
Sbjct  22   FYIAGWKSCTSFVKAREVAAAMQMLYPDRVAFETHPFEDRNAFKQWLSASQ--DDITAHF  79

Query  102  GADSKALTHKSSPFVWANTRGFIGGCDDTLALFRSGVSa---------------------  140
            GADS+A  H +SPFVW++T  F+GGCD+ LA FRSG++                      
Sbjct  80   GADSRATKHVTSPFVWSSTI-FVGGCDELLAFFRSGIAVGKPQGVMPSEKQPTPSSALAP  138

Query  141  -patlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPS  199
                         ++ A  ++A YDYDL+VIGGGSGGLACSKEA+ +G+KVCVLDYVKPS
Sbjct  139  ETDGSMPDVAAETSSTAAKEEASYDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPS  198

Query  200  PVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQML  254
            P GTSWGLGGTCVNVGCIPKKLMHQSSLIGE +H D+ +FGW V         FDW Q++
Sbjct  199  PQGTSWGLGGTCVNVGCIPKKLMHQSSLIGEVLHHDSASFGWNVSSGQGSAPIFDWKQLV  258

Query  255  KSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVG  314
             +V+ YI+ INFKYKVELR K VKYEN LGSF+D HTLELWHP+KG+K +TTRDVVIAVG
Sbjct  259  TNVDGYIRGINFKYKVELRSKYVKYENFLGSFIDPHTLELWHPRKGSKQITTRDVVIAVG  318

Query  315  GRPKPLSCEGGDLAISSDDIFWRK-EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRS  373
            GRP+ L+  GG+ AISSDDIFW K + PGKTLVVGASYVALECAGF+KGMGYDVK+MVRS
Sbjct  319  GRPRELTIPGGEHAISSDDIFWMKTKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRS  378

Query  374  ILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFD  433
            ILLRGFDQDMANKIGE+ME +S IEFIR  VPQSITKLE+GQLLVKW S DGE+CEEAFD
Sbjct  379  ILLRGFDQDMANKIGEYMEVQSGIEFIRKTVPQSITKLENGQLLVKWTSEDGESCEEAFD  438

Query  434  TVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAI  493
            +VLNATGRDPD+AKL LDK GVKLN KTGRI V +EQTSTPNIYAIGDVIDAPELTPVAI
Sbjct  439  SVLNATGRDPDIAKLDLDKAGVKLNEKTGRIWVKHEQTSTPNIYAIGDVIDAPELTPVAI  498

Query  494  QAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFT  553
            QAGRLL+RRLYNN T  MDYDKVCTAVFTPIEYGCCGLSEE SI+++G++ +E+YH NF 
Sbjct  499  QAGRLLSRRLYNNATVQMDYDKVCTAVFTPIEYGCCGLSEEDSIKRFGKDKIEVYHTNFV  558

Query  554  PLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQ  612
            PLEWSLS++ R AA SCYVKVICD  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQ
Sbjct  559  PLEWSLSTETRAAAESCYVKVICDRIRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQ  618

Query  613  MVNVVGIHPTTAEIFTTLEVTKSSG  637
            MV+ VGIHPTTAE FTTLEVTKSSG
Sbjct  619  MVDTVGIHPTTAESFTTLEVTKSSG  643

>HYAP_07095
Length=613

 Score = 870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/615 (70%), Positives = 492/615 (80%), Gaps = 34/615 (6%)

Query  63   MRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVW-ANTR  121
            M V+YP  V FE H F DR+AF++WL  S++ E+    FG DSKA TH +SPFVW +N  
Sbjct  1    MHVMYPGRVAFETHAFEDRDAFKQWL--STSYEDFVTQFGLDSKATTHVTSPFVWISNPT  58

Query  122  GFIGGCDDTLALFRSGVSa------------------------patlaatptmvaaapap  157
             F+GGCDD LA+FRSG++                          A+ +            
Sbjct  59   TFVGGCDDLLAVFRSGIAVGNIQDVASTREDGETLDGTAPMDDTASASELNESRTPPIVV  118

Query  158  addaKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217
             DDA YDYDL+VIGGGSGGLACSKEA+ +GKKVCVLDYVKPSP GTSWGLGGTCVNVGCI
Sbjct  119  EDDASYDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPHGTSWGLGGTCVNVGCI  178

Query  218  PKKLMHQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVEL  272
            PKKLMHQSSLIGE +H D  +FGW VG       TFDW Q++ +V+SYIKSI+FKYKVEL
Sbjct  179  PKKLMHQSSLIGEILHHDCASFGWNVGSVNGQVPTFDWKQLVSNVSSYIKSISFKYKVEL  238

Query  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332
            R K+VKYEN+LGSFVD HTL+LWHPKKGTK +TTR VVIAVGGRP+ L+C GG+LA+SSD
Sbjct  239  RSKQVKYENVLGSFVDPHTLKLWHPKKGTKEITTRHVVIAVGGRPRQLACLGGELAVSSD  298

Query  333  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFM  391
            DIFW K+  PGKTLVVGASYVALECAGF+KGMGY VK+MVRSILLRGFDQDMA+KIGE+M
Sbjct  299  DIFWMKQKEPGKTLVVGASYVALECAGFLKGMGYAVKVMVRSILLRGFDQDMASKIGEYM  358

Query  392  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLD  451
            E +S IEFIR  VPQSITKL+SGQLLVKW++ DG+  EE FDTVLNATGRDPDVAKLGLD
Sbjct  359  EMQSGIEFIRKTVPQSITKLDSGQLLVKWITEDGDCFEETFDTVLNATGRDPDVAKLGLD  418

Query  452  KVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511
            + GVKLN KTGRI V NEQT+TPN+YAIGDVIDAPELTPVAIQAGRLL+RRLYN  T  M
Sbjct  419  EAGVKLNEKTGRIWVNNEQTTTPNVYAIGDVIDAPELTPVAIQAGRLLSRRLYNEGTVQM  478

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCY  570
            DYDK+CTAVFTPIEYGCCGLSEE S E+YG++++E+YH+NF PLEWSL+   R AA SCY
Sbjct  479  DYDKICTAVFTPIEYGCCGLSEEDSKEEYGDDSVEVYHKNFVPLEWSLAEQTRIAAESCY  538

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            VKV+CD  RN  V+GFHYLGPNAGEVTQA+GLAMKLGFTYDQ+V+ VGIHPTTAE FTTL
Sbjct  539  VKVVCDKTRNNFVLGFHYLGPNAGEVTQAMGLAMKLGFTYDQLVDTVGIHPTTAEAFTTL  598

Query  631  EVTKSSGESAASGGC  645
            E TKSSG+S   GGC
Sbjct  599  ETTKSSGDSTTGGGC  613

>PYAR_13569
Length=494

 Score = 833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/483 (83%), Positives = 441/483 (91%), Gaps = 0/483 (0%)

Query  163  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            YDYDL+VIGGGSGGLACSKEA+K+GKKV VLDYVKPSP+GT+WGLGGTCVNVGCIPKKLM
Sbjct  12   YDYDLVVIGGGSGGLACSKEAAKHGKKVMVLDYVKPSPLGTTWGLGGTCVNVGCIPKKLM  71

Query  223  HQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENL  282
            HQS+L+GE +HKDA AFGWT G Q+F W+Q++ SVN+YIK INFKYKVELRDKKVKYEN 
Sbjct  72   HQSALLGELMHKDAPAFGWTTGAQSFTWTQLVASVNNYIKGINFKYKVELRDKKVKYENF  131

Query  283  LGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPG  342
            LGSFVDAHT+ELWH KK  KTVTTR VVIAVGGRP+ L+C GG+ AISSDDIFWRK  PG
Sbjct  132  LGSFVDAHTIELWHHKKPAKTVTTRHVVIAVGGRPRALTCPGGEHAISSDDIFWRKTEPG  191

Query  343  KTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRG  402
            KTLVVGASYVALECAGF+KGMGYDVKIMVRSILLRGFDQDMAN+IG+FM+ ES+IEFIRG
Sbjct  192  KTLVVGASYVALECAGFLKGMGYDVKIMVRSILLRGFDQDMANRIGDFMQDESRIEFIRG  251

Query  403  AVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTG  462
             VP+SI K E+G+LLVKW S DG+  EE FDTVLNATGRDPDV KL LDK GV+LNPK+G
Sbjct  252  VVPKSIEKQENGKLLVKWNSPDGDEVEELFDTVLNATGRDPDVTKLNLDKAGVELNPKSG  311

Query  463  RIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFT  522
            RIA TNEQTSTPNI+AIGDVIDAPELTPVAIQAGRLLARRLYNNET LMDYDK+CTAVFT
Sbjct  312  RIAQTNEQTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYDKICTAVFT  371

Query  523  PIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKH  582
            PIEYGCCGLSEE +  KYGEENLEIYHQ+F PLEWSLS +R AA +CYVKVICD  R+KH
Sbjct  372  PIEYGCCGLSEEDAKAKYGEENLEIYHQSFMPLEWSLSEERVAAATCYVKVICDKTRDKH  431

Query  583  VVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAAS  642
            VVGFHYLGPNAGEVTQA+GLAMK+GFTYDQMVNVVGIHPTTAE+FTTLE+TKSSG SAA+
Sbjct  432  VVGFHYLGPNAGEVTQAMGLAMKVGFTYDQMVNVVGIHPTTAEVFTTLEITKSSGASAAA  491

Query  643  GGC  645
            GGC
Sbjct  492  GGC  494

>PHALS_06481
Length=644

 Score = 824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/615 (66%), Positives = 486/615 (79%), Gaps = 13/615 (2%)

Query  42   YHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTECF  101
            +++AGW+ C  + KA ++V AM++LYPD + F++  F DRE FR WL AS    +    F
Sbjct  32   FYLAGWKTCPSFIKAREIVAAMQMLYPDRLAFKILLFEDREKFRVWLKASQG--DFAVSF  89

Query  102  GADSKALTHKSSPFVWA-NTRGFIGGCDDTLALFRSGVSapatlaatptmvaaapapadd  160
            GA SKA+ H +SPFVW+ N   F+GGCDD L  FRSG++         +   A  +    
Sbjct  90   GAKSKAMKHVTSPFVWSSNPTTFVGGCDDLLLFFRSGIAVGRPQGMHTSDEVAEISSTAV  149

Query  161  aK---YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217
             +   +DYDL+VIGGG GGLACSKEA+ +G+KVCVLDYVKPSP GT+WGLGGTCVNVGCI
Sbjct  150  QEKPIFDYDLVVIGGGLGGLACSKEAASFGQKVCVLDYVKPSPQGTAWGLGGTCVNVGCI  209

Query  218  PKKLMHQSSLIGETIHKDAKAFGWTVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVEL  272
            PKKL+HQSSLIGE I  D+  FGW    +      FDW Q++ +V+ YIK+INFKYKV+L
Sbjct  210  PKKLIHQSSLIGEIIRHDSARFGWKFDNEGKTVPVFDWKQLVANVDGYIKTINFKYKVKL  269

Query  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332
            R K VKYEN LGSFVD HT++L HP+KGTK +TTR+VVIAVG RP+ L+C GG+ A+SSD
Sbjct  270  RSKNVKYENFLGSFVDPHTVKLSHPRKGTKQITTRNVVIAVGSRPRELTCPGGEYAVSSD  329

Query  333  DIFWRKEA-PGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFM  391
            DIFW KE  PGKTLV+GASYVALECAGF+KGMGY+VK+MVRSILLR FDQ+MA+KIGE+M
Sbjct  330  DIFWMKEKEPGKTLVIGASYVALECAGFLKGMGYEVKVMVRSILLRSFDQEMADKIGEYM  389

Query  392  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLD  451
            E +S I+FIR  VPQSI++LE+ QLLVKWV   G+TCEEAF+TVLNATGRDP+VA LGLD
Sbjct  390  EVQSGIKFIRKTVPQSISRLENRQLLVKWVDEKGKTCEEAFNTVLNATGRDPEVAHLGLD  449

Query  452  KVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511
            K GVKLN KTGRI V NEQTST NIYAIGDV+DAPELTPVAIQ+GRLL++RLYNN +  M
Sbjct  450  KAGVKLNEKTGRIMVKNEQTSTSNIYAIGDVVDAPELTPVAIQSGRLLSQRLYNNSSVQM  509

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCY  570
            DYDKVCT VFTPIEYGCCGLSEE S  +YGE+N+EIYH NF PLEWSLSS+ R A+ SCY
Sbjct  510  DYDKVCTTVFTPIEYGCCGLSEETSKGRYGEDNIEIYHTNFVPLEWSLSSETRTASNSCY  569

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            +KV+CD  R+K V+GFHYLGPNAGEV QA+GLAM+L FTYDQMVN VGIHP TAE  T L
Sbjct  570  IKVVCDKSRDKFVLGFHYLGPNAGEVMQAMGLAMRLRFTYDQMVNTVGIHPMTAESLTIL  629

Query  631  EVTKSSGESAASGGC  645
            EVTKSSG +   GGC
Sbjct  630  EVTKSSGGATTGGGC  644

>PHYSO_348901
Length=526

 Score = 817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/490 (80%), Positives = 432/490 (88%), Gaps = 7/490 (1%)

Query  163  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            YDYDL+VIGGGSGGLACSKEA+ +G+KVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLM
Sbjct  37   YDYDLVVIGGGSGGLACSKEAASFGQKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  96

Query  223  HQSSLIGETIHKDAKAFGWTVGE-----QTFDWSQMLKSVNSYIKSINFKYKVELRDKKV  277
            HQSSLIGE +H D+  FGW +        TF W Q++ +V+ YI+ INFKYKVELR K V
Sbjct  97   HQSSLIGELMHHDSANFGWNIASADGSASTFSWKQLVANVDGYIRGINFKYKVELRSKYV  156

Query  278  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-  336
            KYEN LGSFVDAHTLELWHP+KGTK +TTRDVVIAVGGRPK L+C GG+ AISSDDIFW 
Sbjct  157  KYENFLGSFVDAHTLELWHPRKGTKQITTRDVVIAVGGRPKELTCPGGEHAISSDDIFWM  216

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESK  396
            +K+ PGKTLVVGASYVALECAGF+KGMGYDVK+MVRSILLRGFDQDMANKIGE+ME +S 
Sbjct  217  KKKEPGKTLVVGASYVALECAGFLKGMGYDVKVMVRSILLRGFDQDMANKIGEYMEVQSG  276

Query  397  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
            IEFIR  VPQSITKLE+GQLLVKW + DGE+CEEAFDTVLNATGRDPDVAKLGLDK  VK
Sbjct  277  IEFIRKTVPQSITKLENGQLLVKWTTEDGESCEEAFDTVLNATGRDPDVAKLGLDKARVK  336

Query  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKV  516
            LN KTGRI V NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLL+RRLYNN TA MDYDK+
Sbjct  337  LNEKTGRIWVKNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYDKI  396

Query  517  CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVIC  575
            CTAVFTPIEYGCCGLSEE S E+YGE+N+E+YH+NF PLEWSLS + R AA SCY+KVIC
Sbjct  397  CTAVFTPIEYGCCGLSEEDSKERYGEDNIEVYHKNFVPLEWSLSEETRTAAESCYLKVIC  456

Query  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  635
            D  R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLE+TKS
Sbjct  457  DKTRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAETFTTLEITKS  516

Query  636  SGESAASGGC  645
            SG +   GGC
Sbjct  517  SGGTTTGGGC  526

>H257_08436
Length=642

 Score = 809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/610 (65%), Positives = 469/610 (77%), Gaps = 12/610 (2%)

Query  41   KYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTEC  100
             YHV GW+ C +Y KA+ V ++M+ L+P  V   +HE P++E+F  WL  S T  E    
Sbjct  40   NYHVVGWKQCPYYVKAASVASSMQHLFPSQVKATIHEHPNKESFVNWLNESQT--EFAHQ  97

Query  101  FGADSKALTHKSSPFVWA---NTRGFIGGCDDTLALFRSGVSapatlaatptmvaaapap  157
            F  D++ L HKSSPF +    +T  F+GGCDDTLA FR+   +  +  A+   + A    
Sbjct  98   FDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSAPASSASIHANDTS  157

Query  158  addaKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCI  217
              D KYD+DL+VIGGGSGGLACSKEASK G+KV VLDYVKPSPVG++WGLGGTCVNVGCI
Sbjct  158  DADVKYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVGCI  217

Query  218  PKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKV  277
            PKKLMHQSS+IGE +HKDA  FGW+V   TFDWS+++ SV  YI  +NFKY+V+LRDKKV
Sbjct  218  PKKLMHQSSIIGEILHKDADQFGWSVSNATFDWSKLVSSVQDYIHGLNFKYRVDLRDKKV  277

Query  278  KYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIF  335
            KYEN+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G + A+SSDDIF
Sbjct  278  KYENMLGTFKDAHTLTLTNDAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHALSSDDIF  337

Query  336  WRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETES  395
             + +APGKTLVVGASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME+ES
Sbjct  338  SKPDAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMESES  397

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455
             I FI+ +VP SI KLE+GQ  V        T ++ +DT+LNATGR PDV KL LD  GV
Sbjct  398  GIAFIKESVPTSIVKLENGQFQVTHT-----TGQDVYDTILNATGRSPDVQKLNLDAAGV  452

Query  456  KLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDK  515
             LNPK+GRI V NEQTSTPNIYA+GDVIDAPELTPVAIQAG+LL+RRL+ N T LMDY K
Sbjct  453  ALNPKSGRIHVVNEQTSTPNIYALGDVIDAPELTPVAIQAGKLLSRRLFGNGTTLMDYTK  512

Query  516  VCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVIC  575
            +CTAVFTP+EYGCCGLSEE +I   G EN+E+YHQNFTPLEWSLS DR  A  CY K+I 
Sbjct  513  ICTAVFTPVEYGCCGLSEEDAIASAGRENVEVYHQNFTPLEWSLSHDRPLAKECYAKLIV  572

Query  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  635
            DT + K V+GFHYLGPNAGEVTQAIG+A+KL  TYD  +N VGIHPTTAEIFTTLE+TK 
Sbjct  573  DTTQQKRVLGFHYLGPNAGEVTQAIGIAIKLNATYDDFINTVGIHPTTAEIFTTLEITKE  632

Query  636  SGESAASGGC  645
            SG  A++ GC
Sbjct  633  SGVDASASGC  642

>H310_08590
Length=640

 Score = 809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/612 (65%), Positives = 468/612 (76%), Gaps = 14/612 (2%)

Query  41   KYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAFREWLAASSTIEELTEC  100
             YHV GW+ C +Y KA+ VV++M+ L+P  V   +HE P++E+F  WL  S T  E    
Sbjct  36   NYHVVGWKQCPYYVKAASVVSSMQHLFPSQVKATIHEHPNKESFANWLNESQT--EFARQ  93

Query  101  FGADSKALTHKSSPFVWA---NTRGFIGGCDDTLALFRSGVSapatlaatptmvaaapap  157
            F  D++ L HKSSPF +    +T  F+GGCDDTLA FR+   +  +  A     A     
Sbjct  94   FDNDARPLKHKSSPFCYLEQDDTPKFVGGCDDTLAFFRARTQSAPSTGAPSAANAHVSDT  153

Query  158  add--aKYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVG  215
            +     +YD+DL+VIGGGSGGLACSKEASK G+KV VLDYVKPSPVG++WGLGGTCVNVG
Sbjct  154  SSSDETQYDWDLVVIGGGSGGLACSKEASKLGQKVLVLDYVKPSPVGSTWGLGGTCVNVG  213

Query  216  CIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDK  275
            CIPKKLMHQSS+IGE +HKDA+ FGWTV   +FDW++++ SV  YI  +NFKY+++LRDK
Sbjct  214  CIPKKLMHQSSIIGELLHKDAEQFGWTVSNASFDWTKLVSSVQDYIHGLNFKYRIDLRDK  273

Query  276  KVKYENLLGSFVDAHTLELWH--PKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDD  333
            KVKYEN+LG+F DAHTL L +   KKG   VT R  VIAVGGRPKPLSC G + AISSDD
Sbjct  274  KVKYENMLGTFKDAHTLTLTNEAKKKGPTDVTFRRAVIAVGGRPKPLSCPGWEHAISSDD  333

Query  334  IFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMET  393
            IF + EAPGKTLVVGASYVALECAGF+KG G+DV IMVRSILLRGFDQD+A +IGE+ME 
Sbjct  334  IFSKAEAPGKTLVVGASYVALECAGFLKGQGFDVTIMVRSILLRGFDQDIARRIGEYMEN  393

Query  394  ESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKV  453
            ES I FI+ +VP SI KL +GQL V     +G      +DTVLNATGR PDV  L L   
Sbjct  394  ESGIAFIKESVPTSIEKLPNGQLKVTHTHGEG-----IYDTVLNATGRSPDVQMLNLPAA  448

Query  454  GVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDY  513
            GV LNPK+GRI VTNEQTSTP+IYAIGDVIDAPELTPVAIQAG+LLARRL+ N TALMDY
Sbjct  449  GVTLNPKSGRIDVTNEQTSTPHIYAIGDVIDAPELTPVAIQAGKLLARRLFGNGTALMDY  508

Query  514  DKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKV  573
             K+CTAVFTP+EYGCCGLSEE +I   G +N+++YHQNFTPLEWSLS +R  A  CY K+
Sbjct  509  TKICTAVFTPVEYGCCGLSEEDAIASAGRDNIQVYHQNFTPLEWSLSHERPLAKECYAKL  568

Query  574  ICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVT  633
            I DT + K VVGFHYLGPNAGEVTQAIG+AMKL  TYD  VN VGIHPTTAEIFTTLE+T
Sbjct  569  IVDTTQQKRVVGFHYLGPNAGEVTQAIGVAMKLHATYDDFVNTVGIHPTTAEIFTTLEIT  628

Query  634  KSSGESAASGGC  645
            K SGE A++ GC
Sbjct  629  KESGEDASASGC  640

>PHYRA_50855
Length=489

 Score = 807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/488 (80%), Positives = 431/488 (88%), Gaps = 5/488 (1%)

Query  163  YDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            YDYDL+VIGGGSGGLACSKEA+ +GKKVCVLDYVKPSP GTSWGLGGTCVNVGCIPKKLM
Sbjct  2    YDYDLVVIGGGSGGLACSKEAASFGKKVCVLDYVKPSPQGTSWGLGGTCVNVGCIPKKLM  61

Query  223  HQSSLIGETIHKDAKAFGWTVGEQ----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVK  278
            HQSSLIGE +H D+  FGW V  +    TF+W Q++ +V++YIKSINFKYKVELR K VK
Sbjct  62   HQSSLIGEVMHHDSANFGWNVASEGSAPTFNWKQLVSNVDAYIKSINFKYKVELRSKYVK  121

Query  279  YENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW-R  337
            YEN LGSFVD HTLELWH +KGTK +TTRDVVIAVGGRPK LSC GG+ AISSDDIFW +
Sbjct  122  YENFLGSFVDPHTLELWHHRKGTKQITTRDVVIAVGGRPKELSCPGGEHAISSDDIFWMK  181

Query  338  KEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKI  397
            K+ PGKTLVVGASYVALECAGF+KGMGY+VK+MVRSILLRGFDQDMANKIGE+ME +S I
Sbjct  182  KKEPGKTLVVGASYVALECAGFLKGMGYEVKVMVRSILLRGFDQDMANKIGEYMEVQSGI  241

Query  398  EFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKL  457
            EFIR  VPQSIT LE+GQLLVKW + DGE+CEEAFDTVLNATGRDPDVAKLGLDK GVKL
Sbjct  242  EFIRKTVPQSITTLENGQLLVKWTNEDGESCEEAFDTVLNATGRDPDVAKLGLDKAGVKL  301

Query  458  NPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVC  517
            N K+GRI V NEQTST NIYA+GDVIDAPELTPVAIQAGRLL+RRLYNN TA MDY+KVC
Sbjct  302  NEKSGRIWVKNEQTSTSNIYALGDVIDAPELTPVAIQAGRLLSRRLYNNSTAQMDYEKVC  361

Query  518  TAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDT  577
            TAVFTPIEYGCCGLSEE S E++GE+N+E+YH NF PLEWSLS  R +A SCYVKVICD 
Sbjct  362  TAVFTPIEYGCCGLSEEDSKERFGEDNVEVYHTNFVPLEWSLSETRTSAESCYVKVICDK  421

Query  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSG  637
             R+K VVGFHYLGPNAGEVTQA+GLAMKLGFTYDQMV+ VGIHPTTAE FTTLEVTKSSG
Sbjct  422  TRDKFVVGFHYLGPNAGEVTQAMGLAMKLGFTYDQMVDTVGIHPTTAESFTTLEVTKSSG  481

Query  638  ESAASGGC  645
             +   GGC
Sbjct  482  GATTGGGC  489

>PYVX_18170
Length=510

 Score = 766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/537 (72%), Positives = 431/537 (80%), Gaps = 31/537 (6%)

Query  112  SSPFVW-ANTRGFIGGCDDTLALFRSGVSapatlaatptmvaaapapaddaKYDYDLIVI  170
            SSPFVW +N   F+GGCD  L  FRS V  P   +                         
Sbjct  2    SSPFVWTSNPTAFVGGCDALLDRFRSQVPRPNAASKPQANGEV-----------------  44

Query  171  GGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGE  230
                       EASK+G+KV VLDYVKPSP GT WGLGGTCVNVGCIPKKLMHQS+LIGE
Sbjct  45   -----------EASKFGQKVLVLDYVKPSPQGTKWGLGGTCVNVGCIPKKLMHQSALIGE  93

Query  231  TIHKDAKAFGWTV-GEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDA  289
             +HKDA  FGW       FDWSQ+  SV++YIK++NFKYKV+LRDKKVKYEN LG+FVD 
Sbjct  94   VMHKDAALFGWQFENAPKFDWSQLASSVSTYIKTLNFKYKVDLRDKKVKYENFLGAFVDP  153

Query  290  HTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGA  349
            HT+EL +P+K +KTVTTR VV+AVGGRP+ L C GG+L+I+SDDIFWRK APGKTLVVGA
Sbjct  154  HTIELSNPRKPSKTVTTRRVVVAVGGRPRLLPCPGGELSITSDDIFWRKTAPGKTLVVGA  213

Query  350  SYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSIT  409
            SYVALECAGF+KG GYDVK+MVRSILLRGFDQDMAN+IGE+ME E+ IEFIR  VP SIT
Sbjct  214  SYVALECAGFLKGQGYDVKVMVRSILLRGFDQDMANRIGEYMEVEAGIEFIRETVPSSIT  273

Query  410  KLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE  469
            KLE G+LLVKW   DG   EEAFDTVLNATGR+PDV KL LDK GVKLNPKTGRI VTNE
Sbjct  274  KLEDGKLLVKWTLPDGSNHEEAFDTVLNATGRNPDVDKLALDKAGVKLNPKTGRILVTNE  333

Query  470  QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCC  529
            QTSTPNI+AIGDVIDAPELTPVAIQAGRLLARRLYNNET LMDY+KVCTAVFTPIEYGCC
Sbjct  334  QTSTPNIFAIGDVIDAPELTPVAIQAGRLLARRLYNNETTLMDYEKVCTAVFTPIEYGCC  393

Query  530  GLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSCYVKVICDTKRNKHVVGFHY  588
            GLSEE SIE++GE+N+E+YHQNFTPLEW+LS D R +  +CY+KVICD  R+  VVGFHY
Sbjct  394  GLSEEESIERFGEDNIEVYHQNFTPLEWALSDDTRPSMANCYLKVICDKTRDLFVVGFHY  453

Query  589  LGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
            LGPNAGEVTQAIGLAMKLGFTY+QMV+VVGIHPTTAE FTTLEVTKSSG SAA G C
Sbjct  454  LGPNAGEVTQAIGLAMKLGFTYEQMVSVVGIHPTTAETFTTLEVTKSSGASAAGGNC  510

>SPRG_14103
Length=628

 Score = 762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/639 (61%), Positives = 471/639 (74%), Gaps = 28/639 (4%)

Query  13   GRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72
            G++   RS   M+  N             YHV GW+ C +Y++A++V ++M+ L+P  V 
Sbjct  12   GQRSTWRSSSTMSSVN-------------YHVVGWKSCPYYERAANVASSMQTLFPGQVK  58

Query  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVW----ANTRGFIGGCD  128
              +HE   +++F +WL AS         F  D++A  H +SPF +    A T+ F+GGCD
Sbjct  59   ATIHEHATKQSFNDWLEASQAT--FATQFVGDARATNHYTSPFCYLEDGAGTK-FVGGCD  115

Query  129  DTLALFRSGVSapatlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACSKEASKYGK  188
            DTLA FRS  +  A   + P     A    D A YD+DL+VIGGGSGGLA SKEA+KYG+
Sbjct  116  DTLAFFRSR-TQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQ  174

Query  189  KVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTF  248
            KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQS+++GE +HKDA+AFGW V   TF
Sbjct  175  KVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATF  234

Query  249  DWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG--TKTVTT  306
            DW++++ SV  YI  +NFKY+V+LRDKKVKYEN LG+F DAHTL L +P KG   K VT 
Sbjct  235  DWTKLVTSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTF  294

Query  307  RDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYD  366
            R  +IAVGGRPK L C G DLAISSDDIF R   PGKTLVVGASYVALECAGF+K  G+D
Sbjct  295  RRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKAQGFD  354

Query  367  VKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGE  426
            V +MVRSILLRGFD DMA +IG +ME E+KI+FI+GAVP SI +L +GQL V     +G 
Sbjct  355  VTVMVRSILLRGFDTDMAARIGTYMEEEAKIDFIKGAVPTSIEQLANGQLKVTHTFGEG-  413

Query  427  TCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAP  486
                 +DTVLNATGR+PDV+ L L   GV LNPKTGRIAVT+EQTS P+IYA+GDVID P
Sbjct  414  ----IYDTVLNATGRNPDVSGLNLPAAGVGLNPKTGRIAVTHEQTSAPHIYAVGDVIDGP  469

Query  487  ELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLE  546
            ELTPVAIQAGRLLA+RL++N   LM YDKVCTAVFTPIEYGCCGLSE+A+IE  G +NL 
Sbjct  470  ELTPVAIQAGRLLAKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAIETIGADNLG  529

Query  547  IYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKL  606
            +YHQ+FTPLEWSLS DR  A  CY K+I D  +N  VVGFHYLGPNAGEVTQA+G+AMKL
Sbjct  530  VYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAMKL  589

Query  607  GFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
              +YD  V+ VGIHPTTAEIFTTLE+TK SG  A++ GC
Sbjct  590  NASYDDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SDRG_16720
Length=628

 Score = 758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/639 (61%), Positives = 470/639 (74%), Gaps = 28/639 (4%)

Query  13   GRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72
            G++   RS   M+  N             YHV GW+ C +Y++A++V  +M+ L+P  V 
Sbjct  12   GQRSTWRSSSTMSSVN-------------YHVVGWKSCPYYERAANVAVSMQTLFPGQVK  58

Query  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVW----ANTRGFIGGCD  128
              +HE   +++F +WL  S +       F  D++A  H +SPF +    A T+ F+GGCD
Sbjct  59   ATIHEHATKQSFNDWLETSQST--FATQFVGDARATNHYTSPFCYLEDGAGTK-FVGGCD  115

Query  129  DTLALFRSGVSapatlaatptmvaaapapaddaKYDYDLIVIGGGSGGLACSKEASKYGK  188
            DTLA FRS  +  A   + P     A    D A YD+DL+VIGGGSGGLA SKEA+KYG+
Sbjct  116  DTLAFFRSR-TQSAAAPSAPARNVHANDVDDGATYDWDLVVIGGGSGGLAASKEAAKYGQ  174

Query  189  KVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTF  248
            KV VLDYVKPSP G++WGLGGTCVNVGCIPKKLMHQS+++GE +HKDA+AFGW V   TF
Sbjct  175  KVLVLDYVKPSPQGSTWGLGGTCVNVGCIPKKLMHQSAIMGELLHKDAEAFGWAVPNATF  234

Query  249  DWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKG--TKTVTT  306
            DW++++ SV  YI  +NFKY+V+LRDKKVKYEN LG+F DAHTL L +P KG   K VT 
Sbjct  235  DWTKLITSVQDYIHGLNFKYRVDLRDKKVKYENFLGTFKDAHTLTLTNPAKGKPPKDVTF  294

Query  307  RDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYD  366
            R  +IAVGGRPK L C G DLAISSDDIF R   PGKTLVVGASYVALECAGF+KG G+D
Sbjct  295  RRALIAVGGRPKSLDCPGADLAISSDDIFSRPTPPGKTLVVGASYVALECAGFLKGQGFD  354

Query  367  VKIMVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGE  426
            V +MVRSILLRGFD DMA +IG +ME E+KI FI+GAVP SI +L +GQL V     +G 
Sbjct  355  VTVMVRSILLRGFDTDMAARIGTYMEEEAKINFIKGAVPTSIEQLPNGQLKVTHTFGEG-  413

Query  427  TCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAP  486
                 +DTVLNATGR PDV+ L L   GV LNPKTGRIAVT+EQTSTP+IYA+GDVID P
Sbjct  414  ----IYDTVLNATGRYPDVSGLNLSAAGVGLNPKTGRIAVTHEQTSTPHIYAVGDVIDGP  469

Query  487  ELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLE  546
            ELTPVAIQAGRLL++RL++N   LM YDKVCTAVFTPIEYGCCGLSE+A++E  G +NL 
Sbjct  470  ELTPVAIQAGRLLSKRLFDNSATLMAYDKVCTAVFTPIEYGCCGLSEDAAVEAIGADNLG  529

Query  547  IYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKL  606
            +YHQ+FTPLEWSLS DR  A  CY K+I D  +N  VVGFHYLGPNAGEVTQA+G+A+KL
Sbjct  530  VYHQSFTPLEWSLSHDRALAKECYCKLIVDRTQNDRVVGFHYLGPNAGEVTQAVGIAIKL  589

Query  607  GFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAASGGC  645
              +Y+  V+ VGIHPTTAEIFTTLE+TK SG  A++ GC
Sbjct  590  NASYEDFVSTVGIHPTTAEIFTTLEITKESGLDASAAGC  628

>SPRG_04074
Length=509

 Score = 431 bits (1107),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 238/497 (48%), Positives = 319/497 (64%), Gaps = 22/497 (4%)

Query  162  KYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKL  221
             +DYD +VIGGGSGG+A +KEA++ G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+
Sbjct  3    NFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKI  62

Query  222  MHQSSLIGETIHKDAKAFGWTVGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            MH S ++G  +H DA   GW V E+   +W  ++++V +++K +NF Y+V LR  KV+Y 
Sbjct  63   MHYSGILGAGLH-DAAHLGWQVPEKVEHNWETLVEAVQAHVKKLNFSYRVGLRSNKVQYI  121

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK-PLSCEG-GDLAISSDDIFWRK  338
            N L  F D HTL        T+T+T   ++IA GGRP  P    G  + AI+SDD+F   
Sbjct  122  NALARFEDPHTLSYQVKNGPTQTLTAAHILIATGGRPTVPKDIPGVAEYAITSDDLFSLS  181

Query  339  EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIE  398
             APGKTLVVG SY+ALECAGF+  + Y   + VRSILLRGFD+ +A KI + M  +  ++
Sbjct  182  TAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMVAQG-MD  240

Query  399  FIRGAVPQSITKLE-SGQLLVKWVSAD-GETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
            F    +P SI K E +GQL V + +++  ET  EAFDTVL A GR  D   +GL+K GVK
Sbjct  241  FRFNTLPTSIVKDEATGQLHVSFANSETHETFTEAFDTVLYAVGRTADTFNIGLEKAGVK  300

Query  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLARRLYN-NETALMDYD  514
              P  G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T  M+YD
Sbjct  301  ALPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYD  359

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSL------------SSD  562
             + T VFTP+EYG  GLSEE +I +YG++++ +Y   F  LEW                D
Sbjct  360  LIPTTVFTPVEYGTIGLSEEEAITRYGKDDIVVYPWEFQTLEWGAVHRKKAESAQEGDYD  419

Query  563  REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPT  622
             E   +C  K++C    N+ V+GFH++GPNAGEVTQ   +A+ +G T +   NV+GIHPT
Sbjct  420  TEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPT  479

Query  623  TAEIFTTLEVTKSSGES  639
             AE F  L VTK SG S
Sbjct  480  DAESFMALTVTKESGAS  496

>SDRG_14408
Length=528

 Score = 431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 237/497 (48%), Positives = 320/497 (64%), Gaps = 22/497 (4%)

Query  162  KYDYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKL  221
             +DYD +VIGGGSGG+A +KEA++ G KV + D+VKP+  GT WGLGGTCVNVGC+PKK+
Sbjct  22   NFDYDFVVIGGGSGGMAAAKEAARLGAKVALFDFVKPTVHGTKWGLGGTCVNVGCVPKKI  81

Query  222  MHQSSLIGETIHKDAKAFGWTVGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            MH S ++G  +H DA   GW + E+   +W  ++++V +++K +NF Y+V LR  KV+Y 
Sbjct  82   MHYSGILGAGLH-DAAHLGWQLPEKVEHNWETLVETVQAHVKKLNFSYRVGLRSNKVQYI  140

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK-PLSCEG-GDLAISSDDIFWRK  338
            N L  F D HTL        T+T+T   ++IA GGRP  P    G G+ AI+SDD+F   
Sbjct  141  NALARFEDPHTLSYQIKNGPTQTLTAAHILIATGGRPTVPKEIPGVGEYAITSDDLFSLT  200

Query  339  EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIE  398
             APGKTLVVG SY+ALECAGF+  + Y   + VRSILLRGFD+ +A KI + M  +  ++
Sbjct  201  TAPGKTLVVGGSYIALECAGFLNELHYPTTVAVRSILLRGFDRQVAAKIQDIMVAQG-MD  259

Query  399  FIRGAVPQSITKLE-SGQLLVKWVSAD-GETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
            F    +P SI K + +GQL V + +++  ET  E FDTVL A GR  D   +GL+KVGVK
Sbjct  260  FRFNTLPTSIVKDDATGQLHVSFANSETNETFTEVFDTVLYAVGRTADTFNIGLEKVGVK  319

Query  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDA-PELTPVAIQAGRLLARRLYN-NETALMDYD  514
              P  G+    NE T+ P+I+A+GDV+   PELTPVAI+AG  L RRL+  N T  M+YD
Sbjct  320  ALPN-GKFETVNEATNVPHIHAVGDVLQGKPELTPVAIRAGEHLVRRLFKPNYTKTMNYD  378

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSL------------SSD  562
             + T VFTP+EYG  GLSEE +I +YG++++ +Y   F  LEW                D
Sbjct  379  LIPTTVFTPVEYGTIGLSEEEAIARYGKDDVVVYPWEFQTLEWGAVHRQKAESAQEGDYD  438

Query  563  REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPT  622
             E   +C  K++C    N+ V+GFH++GPNAGEVTQ   +A+ +G T +   NV+GIHPT
Sbjct  439  TEFPANCLSKLVCQKSANEKVLGFHFVGPNAGEVTQGFAVAVTMGATKEDFDNVIGIHPT  498

Query  623  TAEIFTTLEVTKSSGES  639
             AE F  L VTK SG S
Sbjct  499  DAESFMALTVTKESGAS  515

>SDRG_03822
Length=494

 Score = 262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 168/474 (35%), Positives = 255/474 (54%), Gaps = 21/474 (4%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+G GSGG++ +  A  YG KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSSAHRAVAYGAKVLVIERGQAN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSLIGETIHKDAKAFGWTVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++L  E +H  A+A+ +  G Q      FDW+ M    ++Y+K +N  Y   + + KV  
Sbjct  61   AALHAEMLHS-ARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  118

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
                  FVD HT+E+   +   K      ++IAVGG P      G + AISSD  F  + 
Sbjct  119  VMGAAKFVDNHTVEVNGDRYAAK-----HILIAVGGVPAMPPLPGIEHAISSDGFFALET  173

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME  + + 
Sbjct  174  QPRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVR  232

Query  399  FIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLN  458
            F+R +   SI K E G L ++   A        F+TVL A GR P    LGL+   + L+
Sbjct  233  FVRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALS  292

Query  459  PKTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TALMDYDKV  516
            P         E T+ PN++A+GDV     ELTPVAI AGR LA RL+ NE  A ++Y ++
Sbjct  293  PDQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQI  352

Query  517  CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICD  576
             T VF+    G  GL+E  ++ +YG  N+  +  +F+ + +++S++++   +  +K++C 
Sbjct  353  PTVVFSHPPIGTIGLTEPQAVAQYGAHNVTTHTSSFSNMFYAMSAEKDKVQTA-MKLVC-  410

Query  577  TKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                + VVG H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  411  IGVEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_15045
Length=494

 Score = 256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 164/473 (35%), Positives = 254/473 (54%), Gaps = 19/473 (4%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+G GSGG++ +  A  YG KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSLIGETIHKDAKAFGWT----VGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            ++L  E +H  A+A+ +     +    FDW+ M    ++Y+  +N  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
                 FVD HT+E+       +  T + ++IAVGG P      G + AISSD  F  +  
Sbjct  120  MGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALETQ  174

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEF  399
            P K  VVGA Y+A+E AG    +  +  +  R + +LR FD  + + +   ME  + ++F
Sbjct  175  PRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQF  233

Query  400  IRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNP  459
            +R +   +I K   G L ++   A        F+TVL A GR P    LGL+   + L+ 
Sbjct  234  VRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALST  293

Query  460  KTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TALMDYDKVC  517
            +        E T+ PN+YAIGDV     ELTPVAI AGR LA RL+ NE  A ++Y ++ 
Sbjct  294  EKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIP  353

Query  518  TAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDT  577
            T VF+    G  GL+E  +IE+YG  N+  +  +F+ + +++ ++++   +  +K++C  
Sbjct  354  TVVFSHPPIGTIGLTEPQAIEQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVC-I  411

Query  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
               + VVG H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  412  GVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_11131
Length=494

 Score = 254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 253/473 (53%), Gaps = 19/473 (4%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+G GSGG++ +  A  YG KV V++  + +      GLGGTCVNVGC+PKK+M  
Sbjct  4    YDYIVLGAGSGGVSTAHRAVAYGAKVLVVERGREN---DGAGLGGTCVNVGCVPKKIMFN  60

Query  225  SSLIGETIHKDAKAFGWT----VGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            ++L  E +H  A+A+ +     +    FDW+ M    ++Y+  +N  Y   + + KV   
Sbjct  61   AALHAEMLHS-ARAYAFKGVSDIQYGAFDWAAMKAKRDAYVTWLNSMYGEGMLEDKVDLV  119

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
                 FVD HT+E+       +  T + ++IAVGG P      G + AISSD  F  +  
Sbjct  120  MGAAKFVDNHTIEV-----NGERYTAKHILIAVGGVPALPPIPGIEHAISSDGFFALETQ  174

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEF  399
            P K  VVGA Y+A+E AG    +  +  +  R + +LR FD  + + +   ME  + ++F
Sbjct  175  PRKVAVVGAGYIAVELAGIFNALKSNTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVQF  233

Query  400  IRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNP  459
            +R +   +I K   G L ++   A        F+TVL A GR P    LGL+   + L+ 
Sbjct  234  VRESGINAIEKAGDGTLTLQATVAGEPQSFTGFETVLFAIGRTPRTHDLGLETTDIALST  293

Query  460  KTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TALMDYDKVC  517
            +        E T+ PN+YAIGDV     ELTPVAI AGR LA RL+ NE  A ++Y ++ 
Sbjct  294  EKFIQVDAQENTTVPNVYAIGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYSQIP  353

Query  518  TAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDT  577
            T VF+    G  GL+E  +I +YG  N+  +  +F+ + +++ ++++   +  +K++C  
Sbjct  354  TVVFSHPPIGTIGLTEAQAIAQYGAHNVTTHTSSFSNMFYAMCAEKDKVQTA-MKLVC-I  411

Query  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
               + VVG H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  412  GVEEAVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  464

>SDRG_03823
Length=497

 Score = 254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 170/473 (36%), Positives = 255/473 (54%), Gaps = 19/473 (4%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IVIGGGSGG + ++ A+ YG KV V++           G+GGTCVNVGC+PKK+M  
Sbjct  7    YDYIVIGGGSGGNSSARRAAAYGAKVLVIER---GHANDGAGMGGTCVNVGCVPKKVMFN  63

Query  225  SSLIGETIHKDAKAFGWT----VGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            +++  E +H  A A+ +     V   +FDW+ + K  ++Y+  +N  Y+  L + K+   
Sbjct  64   AAMHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNKIPLI  122

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
                 FVD HT+E+     G +  T + ++IAVGG P      G + AISSD  F  +  
Sbjct  123  YGAAKFVDNHTIEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALETQ  177

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEF  399
            P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME  + + F
Sbjct  178  PRKVAVVGAGYIAVELAGIFNALKSDTTVFCRGNQVLRTFDPIVRDLVNTEME-HAGVRF  236

Query  400  IRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNP  459
            +R +   SI K E G L ++   A        F+TVL A GR P    LGL+   + L+P
Sbjct  237  VRESGITSIEKAEDGTLTIQATVAGVAQSFAGFETVLFAIGRTPRTHDLGLETTDIALSP  296

Query  460  KTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TALMDYDKVC  517
                     E T+ PN++A+GDV     ELTPVAI AGR LA RL+ NE  A ++Y ++ 
Sbjct  297  DQFIQVDAQENTTVPNVHAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACVNYHQIP  356

Query  518  TAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDT  577
            T VF+    G  GL+E  +IE+YG  N+++Y   F  + +++S   E   +  +K++C  
Sbjct  357  TVVFSHPPIGTIGLTEPQAIEQYGAHNVKVYTSTFFNMFYAMSEQDEKQKTA-MKLMC-I  414

Query  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
               + V+G H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  415  GEEETVIGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  467

>PYIR_17506
Length=509

 Score = 249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 170/491 (35%), Positives = 262/491 (53%), Gaps = 37/491 (8%)

Query  165  YDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            YD +VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  39   YDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  89

Query  224  QSSLIGETIHKDAKAFGWT------VGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKK  276
             ++ +  T+H+DA  +G+       +G+   F WS++ +  ++YI  +N  Y+  L + K
Sbjct  90   LAANMNHTLHRDAFYYGFESKDGSHIGDNVEFHWSKLKERRDAYILRLNGIYERNLGNSK  149

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            V       +F     +E+       K ++ R+V+IAVGG+P      G +  I SD  F 
Sbjct  150  VDLIQGTAAFNAQGEVEV-----DGKVISARNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  204

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETES  395
             +E P K  VVGA Y+A+E AG + G+G D  I  R   +LR FD+ + + + + M  + 
Sbjct  205  LEELPNKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKDGVLRTFDELVRDTLHDAMAKDG  264

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455
             +   +  V +    L+  + L   V ADG      FDTV+ A GR P  + L +   G+
Sbjct  265  IVVRPQSNVARIEKTLDGKKTL---VLADGSE-HAGFDTVIYAAGRIPLTSNLNISAAGI  320

Query  456  KLNPKTGRIAVTNEQTSTP-NIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDY  513
            + + K G I V   QT++  N++A+GDV     LTPVAI AGR L+ RL+   E A + Y
Sbjct  321  ETD-KHGFIKVDEYQTTSKNNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMEDAKISY  379

Query  514  DKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGS-----  568
            + + T VF+    G  GL+E+ + EKYG+  ++ Y   F  + + L ++ +A G+     
Sbjct  380  NNIPTVVFSHPPIGTIGLTEKEAREKYGDAQIKTYTSRFVNMYYGLVNELDAEGNTKPKP  439

Query  569  -CYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
               +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N V IHPT  E  
Sbjct  440  MTAMKLVCLGKDEK-VVGLHIIGMAADEILQGFGVAVKMGATKADFDNCVAIHPTAGEEL  498

Query  628  TTLEVTKSSGE  638
             TL     SG+
Sbjct  499  VTLAPWGLSGQ  509

>SDRG_12187
Length=462

 Score = 242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 250/477 (52%), Gaps = 35/477 (7%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+V+GGGSGG+A ++ A+ YGKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  225  SSLIGETIHKDAKAFGW-TVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ +  ++  DA A+G+  V   T DW+ + +  ++Y+  +N  Y   L+   V +   L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYSRNLQGSGVDFAQGL  115

Query  284  GSF-------VDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
             SF       +DA  L+              +V++AVGG+P      G +  ISSD  F 
Sbjct  116  CSFGSDGRVQIDATPLD----------AEATNVLVAVGGQPVMPDIPGIEHCISSDGFFE  165

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETES  395
              E P +  VVGA Y+A+E AG ++G+G D  I  R   +LR FD  +   + +  + + 
Sbjct  166  LDERPARVAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFDDMLQAVLHDAFQRDG  225

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455
                    + +      +G L V   + +  +    FD VL ATGR P    LGL+  G+
Sbjct  226  ITLQPHSTIARVDKDPTTGSLSVTTTAGEHHS---GFDCVLVATGRTPMTKDLGLEHRGI  282

Query  456  KLNPKTGRIAVTNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDY  513
            +L+P  G I V   Q TS P ++A+GDV+D   LTPVAI AGR LA RL+     A  DY
Sbjct  283  QLSPN-GFIPVDAYQATSAPGVFALGDVVDTAALTPVAIAAGRRLADRLFGGLHDAKADY  341

Query  514  DKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKV  573
              + + VF+    G  GL+E+ + + Y ++ L++Y   F  + +SL        +  +K+
Sbjct  342  TNIPSVVFSHPPIGTIGLTEQEARKVYRDDELKVYSSKFVNMHYSLYEHAHEKPTTAMKL  401

Query  574  ICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            IC     K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  402  ICVGPSEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  457

>PHYCA_504517
Length=493

 Score = 243 bits (619),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 171/476 (36%), Positives = 261/476 (55%), Gaps = 24/476 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++   E ++++ K +     ++ F     DW+ M    ++YIK +N  Y+  L +  V +
Sbjct  64   TAAHVEHLNRN-KDYSINTADKEFQFGDFDWNNMKIKRDAYIKRLNGIYERNLGNANVDH  122

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
               +   V    +++     G K  T + V++A GG P      G +  I SD  F  ++
Sbjct  123  VQGIAKLVAKDKIQV-----GDKVYTGKHVLVAPGGVPSVPDLPGMENVIDSDGFFKLEQ  177

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++ ++
Sbjct  178  QPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVK  236

Query  399  FIRGAVPQSITKLESGQLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDKVGVKL  457
            F+R      + K ++G+L    V+ +GE  +   FDT+L A GR+P    LGL++VGVKL
Sbjct  237  FVRNMRAARVEKQDNGKLTF-VVTINGEEQKFPDFDTILYAVGREPRTKDLGLEEVGVKL  295

Query  458  NPKTGRIAV-TNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-ALMDYD  514
            + + G I V   E TS P +YAIGD  +   ELTPVAI AGR L+ RL+  E  A ++Y 
Sbjct  296  S-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574
            ++ T +F+    G  G +E  ++EKYGEEN+++Y   F  L  S+ +D E  G   +K++
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAVEKYGEENVKVYTSKFVNLLHSM-ADPERKGKTAMKLV  413

Query  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                  + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  414  T-VGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PYAP_21882
Length=502

 Score = 241 bits (616),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/492 (34%), Positives = 255/492 (52%), Gaps = 38/492 (8%)

Query  165  YDLIVIGGGSGGLACSKEASKYGK-KVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            YD +VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  31   YDYLVIGAGSGGMASSRRAATYANTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  81

Query  224  QSSLIGETIHKDAKAFGW--TVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVELRDKK  276
             ++ +G T+H+D   +G+  T GE       F W ++ +  ++Y+  +N  Y   L + K
Sbjct  82   LAANLGHTLHRDLFHYGFESTKGEHLAHETQFHWKKLKERRDAYVLRLNGIYGRNLDNSK  141

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            V       +F     +E+       K +  ++V+IAVGG+P      G +  I SD  F 
Sbjct  142  VDLFRGTATFNAKGNVEV-----DGKEIAAKNVLIAVGGKPLIPDIPGKEHCIDSDGFFE  196

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETES  395
             +E P K  VVGA Y+A+E AG + G+G D  I  R   +LRGFD+ +   + + M  E 
Sbjct  197  LEEQPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRKEGVLRGFDELIRTTLHDAMAKEG  256

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455
                   +V + I   +  + L   V ADG      FD+V+ A GR P    L L+  G+
Sbjct  257  VNLRPHSSVTKVIKAADGTKTL---VLADGSE-HSGFDSVIYAAGRVPLTESLNLEAAGI  312

Query  456  KLNPKTGRIAVTNEQTSTP--NIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMD  512
            + +   G I +   Q +T   NI+A+GDV   P LTPVAI AGR LA RL+   + A   
Sbjct  313  ETDDH-GFIKIDEYQRTTAKTNIFAVGDVCGTPALTPVAIAAGRRLADRLFGGMKDAKAS  371

Query  513  YDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGS----  568
            Y+ + T VF+    G  GL+E+ +  K+G++ +++Y   F  + + + ++    G     
Sbjct  372  YENIPTVVFSHPPIGTVGLTEDHARAKFGDDQIKVYTSRFVNMHYGIINEFGEDGQQKPK  431

Query  569  --CYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEI  626
                +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     + V IHPT AE 
Sbjct  432  PMTAMKLVCQGKDEK-VVGVHIIGMAADEMLQGFGVAVKMGATKADFDSCVAIHPTAAEE  490

Query  627  FTTLEVTKSSGE  638
              T+     SG+
Sbjct  491  LVTMAPWGLSGQ  502

>PHYSO_254571
Length=489

 Score = 240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 171/493 (35%), Positives = 251/493 (51%), Gaps = 53/493 (11%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            +YD +VIG GSGG+A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  15   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQSR---------LGGTCVNVGCVPKKLM  65

Query  223  HQSSLIGETIHKDAKAFGWT-------VGEQT-FDWSQMLKSVNSYIKSINFKYKVELRD  274
              ++ +   +H D   +G+        +G++T FDW ++    ++Y+  +N  Y+  L +
Sbjct  66   FIAADMSHKLHHDFLHYGFEDEETGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNLAN  125

Query  275  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDI  334
             KV        F D   +E+       K +  ++V+IAVGG+P      G +L I SD  
Sbjct  126  SKVALIRGSAKFNDKGNVEV-----DGKEILAKNVMIAVGGKPLIPDIPGKELCIDSDGF  180

Query  335  FWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFD-------QDMANK  386
            F  +  P K  VVGA Y+A+E AG +  +G D  I  R   +LR FD       +D   K
Sbjct  181  FELETLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAMAK  240

Query  387  IGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVA  446
             G  +   S I  +  A   + T           V ADG      +D V+ A GR P  +
Sbjct  241  DGVHLRPHSNIARVEKADDGTKT----------LVLADGSEY-SGYDVVIYAAGRVPLTS  289

Query  447  KLGLDKVGVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYN  505
             L LDK GV  + K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+ 
Sbjct  290  NLQLDKAGVDTD-KNGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFG  348

Query  506  N-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDR-  563
              + A + Y+ + T VF+    G  GL+EE +  KYG++ +++Y   F  + + L ++  
Sbjct  349  GMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRKYGDDEIKVYTSRFVNMYYGLINEMD  408

Query  564  EAAG------SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVV  617
            EA G         +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N V
Sbjct  409  EATGEPKDKPKTAMKLVCAGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCV  467

Query  618  GIHPTTAEIFTTL  630
             IHPT  E   TL
Sbjct  468  AIHPTAGEELVTL  480

>CCI11048
Length=496

 Score = 240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 160/466 (34%), Positives = 239/466 (51%), Gaps = 28/466 (6%)

Query  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIH-------  233
            + A+ YG KV +++  +        G GGTCVN GC+PKK+M+ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHREY---DGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERASDYSI  78

Query  234  -----KDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  288
                 K+  +  ++ G+  FDW +M    ++YI+ +N  Y   L + K+     +   + 
Sbjct  79   RPFTSKECASHSFSFGD--FDWGRMKTKRDAYIERLNGIYTRNLANAKIDTVKGIAKLIA  136

Query  289  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVG  348
               +++            + ++IAVGG P   S  G + AI SD  F  +  P K  VVG
Sbjct  137  KDRVQV----NQDSVYEGKHILIAVGGTPAMPSLPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  349  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQS  407
            A Y+A+E AG    +  D  +  R   +LR FD  + + + E ME +  + F+R +  + 
Sbjct  193  AGYIAVEIAGVFNTLKSDTFVFCRFDQVLRKFDPLVRDLVNEEMEKDG-VNFVRKSHLEK  251

Query  408  ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV-  466
            ITK +  +L +     +       FD ++ A GR P    LGL++VGV LN +TG I V 
Sbjct  252  ITKAKDDKLAITARIGEENQTFSDFDQIVMAVGRSPRTVGLGLEEVGVALN-ETGHIIVD  310

Query  467  TNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-ALMDYDKVCTAVFTPI  524
              E TS P +YA+GDV     ELTPVAI AGR LA RL+NNE  A + Y ++ T VF+  
Sbjct  311  AQENTSVPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLHYHQIPTVVFSHP  370

Query  525  EYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVV  584
              G  G +E  +I KYGEEN++ Y   F  L +S++ D E      +K++C     + VV
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTAMKLVC-VGSKETVV  429

Query  585  GFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            G H  G  A E+ Q  G+AMK+G T     N+V IHPT +E   T+
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>SPRG_11769
Length=453

 Score = 239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 165/472 (35%), Positives = 249/472 (53%), Gaps = 34/472 (7%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+V+GGGSGG+A ++ A+ YGKKV V++  +         LGGTCVNVGC+PKK+M+ 
Sbjct  5    YDLVVMGGGSGGIASARRAATYGKKVLVVERGR---------LGGTCVNVGCVPKKVMYA  55

Query  225  SSLIGETIHKDAKAFGW-TVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ +  ++  DA A+G+  V   T DW+ + +  ++Y+  +N  Y   L+   V + + L
Sbjct  56   AADLAHSMRHDAPAYGFPAVPNTTVDWATLKQRRDAYVTRLNGIYARNLQGSGVDFAHGL  115

Query  284  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGK  343
             SF             G+      + ++AVGG+P      G +  ISSD  F   E P +
Sbjct  116  CSF-------------GSDGRRGDERLVAVGGQPVMPDIPGIEHCISSDGFFELDERPAR  162

Query  344  TLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETESKIEFIRG  402
              VVGA Y+A+E AG ++G+G D  I  R   +LR FD DM   +         I     
Sbjct  163  VAVVGAGYIAVELAGVLRGLGSDTTIFCRQQGVLRSFD-DMLQSVLHDAFKRDGITLQPH  221

Query  403  AVPQSITKLE--SGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPK  460
            +    + K++  +G L +   + D  T    FD VL ATGR P    LGL+  G++L+P 
Sbjct  222  STVARVDKVDPATGTLSLTTTAGDYHT---GFDCVLVATGRTPMTKHLGLEHRGIELSPN  278

Query  461  TGRIAVTNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDYDKVCT  518
             G I V   Q TS P ++A+GDV++   LTPVAI AGR LA RL+     A  DY  + +
Sbjct  279  -GFIPVDAYQATSAPGVFALGDVVNTAALTPVAIAAGRRLADRLFGGLPDAKADYTSIPS  337

Query  519  AVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTK  578
             VF+    G  GL+E+ + + Y E+ +++Y   F  + +SL        +  +K+IC   
Sbjct  338  VVFSHPPIGTIGLTEQEARKVYREDEIKVYSSKFVNMHYSLYEHAHEKPTTAMKLICVGP  397

Query  579  RNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
              K +VG H +G  A E+ Q  G+A+K+G     +   + IHPT AE   TL
Sbjct  398  TEK-IVGLHVIGRGADEMLQGFGVAIKMGACKKDLDACIAIHPTAAEELVTL  448

>PHALS_08068
Length=497

 Score = 239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 252/486 (52%), Gaps = 39/486 (8%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            +YD +VIG GSGG+A ++ A+ Y G +V +++  +         LGGTCVNVGC+PKKLM
Sbjct  23   EYDYLVIGAGSGGMASARRAASYSGTRVAIVEQDR---------LGGTCVNVGCVPKKLM  73

Query  223  HQSSLIGETIHKDAKAFGW----TVGEQT----FDWSQMLKSVNSYIKSINFKYKVELRD  274
            + ++ +   +H D   +G+    T G  +    F+WS++    ++Y+  +N  Y+  L +
Sbjct  74   YIAADMNHKLHHDFLYYGFEDAATGGHLSHRMHFNWSKLKARRDAYVLRLNEIYETNLAN  133

Query  275  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDI  334
             KV        F +   +E+       K V  + ++IAVGGRP      G +L I SD  
Sbjct  134  SKVDLIRGSAKFNERGNVEV-----DDKEVRAKKILIAVGGRPLIPDIPGKELCIDSDGF  188

Query  335  FWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMET  393
            F  +  P K  +VGA Y+A+E AG +  +G    +  R   +LR FD  +   + E M  
Sbjct  189  FELETLPTKVAIVGAGYIAVELAGVLNALGSKTSVFCRKEGVLRSFDNILRTTLEEAMAN  248

Query  394  ESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKV  453
            +     +      ++ +++      K +     +    FD V+ ATGR P  + L L+K 
Sbjct  249  DG----VHLRPNSTVARVKEAADGTKTLVLTNGSEHRGFDVVICATGRVPLTSTLNLEKA  304

Query  454  GVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALM  511
            G+  +   G I V   ++T+  N+YA+GDV + P LTPVAI AGR L+ RL+   + A +
Sbjct  305  GITTD-DNGYIRVNEFQETTKNNVYAVGDVCNTPALTPVAIAAGRRLSDRLFGGMKDAKL  363

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDR-EAAG---  567
             Y+ + T +F+    G  GL+EE + +KYG+ N+++Y   F  + + L ++  EA G   
Sbjct  364  SYENIPTVIFSHPPIGTIGLTEEGARKKYGDNNIKVYSSRFVNMYYGLINETIEATGVPK  423

Query  568  ---SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTA  624
                  +K++C   + K VVG H +G  A E+ Q  G+A+K+G T     N + IHPT  
Sbjct  424  EKPKTAMKLVCAGNKEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAG  482

Query  625  EIFTTL  630
            E   TL
Sbjct  483  EELVTL  488

>PPTG_09787
Length=493

 Score = 239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 170/476 (36%), Positives = 260/476 (55%), Gaps = 24/476 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ +G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++   E ++++ K +      + F     DW  M    ++YIK +N  Y+  L + KV +
Sbjct  64   TAAHVEHLNRN-KDYSINTASKDFEFGDFDWGNMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
               +   V    +E+       +  T + V++A GG P      G +  I SD  F  ++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGVPTIPDLPGMEHVIDSDGFFKLEQ  177

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++ ++
Sbjct  178  QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRYDQVLRKFDPIVRDLVNEEME-KAGVK  236

Query  399  FIRGAVPQSITKLESGQLLVKWVSADGETCEEA-FDTVLNATGRDPDVAKLGLDKVGVKL  457
            F+R +    + K E+G+L    V+ +GE  + A FDT++ A GR+P    LGL+++GVKL
Sbjct  237  FVRNSRAVRVEKQENGKLTF-VVTVNGEEQKFADFDTIVFAIGREPRTKDLGLEEIGVKL  295

Query  458  NPKTGRIAV-TNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-ALMDYD  514
            + + G I V   E TS P +YAIGD  +   ELTPVAI AGR L+ RL+  E  A ++Y 
Sbjct  296  S-EGGFIEVDAQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574
            ++ T +F+    G  G +E  +I KYGEEN+++Y   F  L  S++ D E  G   +K++
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENIKVYTSKFVNLLHSMA-DPERKGKTAMKLV  413

Query  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                  + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  414  T-VGEKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>SPRG_05609
Length=496

 Score = 238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 170/476 (36%), Positives = 254/476 (53%), Gaps = 25/476 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IVIGGGSGG + ++ A+ YG KV +++           G+GGTCVNVGC+PKK+M  
Sbjct  6    YDYIVIGGGSGGNSSARRAAAYGAKVLLIER---GHANDGAGMGGTCVNVGCVPKKIMFN  62

Query  225  SSLIGETIHKDAKAFGWT----VGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            ++L  E +H  A A+ +     V   +FDW+ + K  ++Y+  +N  Y+  L + ++   
Sbjct  63   AALHAEMLHS-AHAYTFKNIQDVEYGSFDWAALKKKRDAYVARLNGIYERNLGNNQIPLV  121

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
                 FVD HT+E+     G +  T + ++IAVGG P      G + AISSD  F  +  
Sbjct  122  YGAAKFVDNHTVEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALETQ  176

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEF  399
            P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME  + + F
Sbjct  177  PRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNTEME-HAGVHF  235

Query  400  IRGAVPQSITKLESGQLLVKWVSADGETCEEA---FDTVLNATGRDPDVAKLGLDKVGVK  456
            +R +   SI K   G       S DG    ++   F+TVL A GR P    LGL+   + 
Sbjct  236  VRESGITSIEKAVDGY---ADDSGDGGGVPQSFPGFETVLFAIGRTPRTHDLGLETTDIA  292

Query  457  LNPKTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNE-TALMDYD  514
            L+          E TS PN+YA+GDV     ELTPVAI AGR LA RL+ NE  A ++Y 
Sbjct  293  LSADKFIQVDAQENTSVPNVYAVGDVTTTGWELTPVAIAAGRRLADRLFGNEPNACINYH  352

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574
            ++ T VF+    G  GL+E  +I +YG  N+++Y  +F  + +++S   +   +  +K+I
Sbjct  353  QIPTVVFSHPPIGTIGLTEPQAIAQYGANNVKVYTSSFFNMFYAMSEQDDKQKTA-MKLI  411

Query  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            C     + VVG H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  412  C-IGEEETVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  466

>PHYRA_72037
Length=493

 Score = 238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 172/481 (36%), Positives = 254/481 (53%), Gaps = 34/481 (7%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGETIHKDAK----------AFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRD  274
            ++   E +H++            AFG       FDW+ M K  ++YI  +N  Y+  L +
Sbjct  64   AAAHVEHLHRNEDYSIKTATRDFAFG------DFDWANMKKKRDAYILRLNGIYERNLGN  117

Query  275  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDI  334
             KV +   + + V    +E+       K  T + V++A GG P      G +    SD  
Sbjct  118  AKVDHVQGIATLVAKDQVEV-----AGKVYTGKHVLVAPGGVPFVPDLPGMEHVTDSDGF  172

Query  335  FWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMET  393
            F  ++ P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + ME 
Sbjct  173  FRLEQQPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNDEME-  231

Query  394  ESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDK  452
            ++ ++F+R      + K + G+L    V+ DGE  +   FD +L A GR+P    LGL+K
Sbjct  232  KAGVKFVRNTRAVRVDKQDDGKLTF-VVTVDGEEQKFPDFDVILYAIGREPRTKDLGLEK  290

Query  453  VGVKLNPKTGRIAV-TNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-A  509
            VGVKL    G I V   E TS P +YAIGD      ELTPVAI AGR L+ RL+  E  A
Sbjct  291  VGVKL-ADGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDA  349

Query  510  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC  569
             ++Y ++ T +F+    G  G +E  ++ K+GEEN+++Y   F  L  S++ D E  G  
Sbjct  350  CLNYHQIPTVIFSHPPIGTIGYTEPEAVAKFGEENVKVYSSKFVNLLHSMA-DPERKGKT  408

Query  570  YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTT  629
             +K++      + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T
Sbjct  409  AMKLVT-VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVT  467

Query  630  L  630
            +
Sbjct  468  M  468

>PYIW_25301
Length=512

 Score = 238 bits (608),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 168/494 (34%), Positives = 263/494 (53%), Gaps = 41/494 (8%)

Query  165  YDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            YD +VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M+
Sbjct  40   YDYLVIGAGSGGMASSRRAALYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIMY  90

Query  224  QSSLIGETIHKDAKAFGW------TVGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKK  276
             ++ +   +H+DA  +G+       +G+   F W ++ +  ++YI  +N  Y+  L + K
Sbjct  91   LAANMNHMLHRDAFHYGFEGKDGVRIGDNVAFHWDKLKERRDAYILRLNDIYERNLGNSK  150

Query  277  VKYENLLGSFV-DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIF  335
            V    L G+ V +AH     + +   K +  ++++IAVGG+P      G +L I SD  F
Sbjct  151  VDL--LTGTAVFNAH----GNVEMDGKEIQAKNILIAVGGKPLIPDIPGKELCIDSDGFF  204

Query  336  WRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETE  394
              ++ P K  VVGA Y+A+E AG + G+G +  I  R   +LR FD+ + + + + M  +
Sbjct  205  ELEQLPKKVAVVGAGYIAVELAGVLHGLGSNTTIFCRKDGVLRTFDELVRDTLHDAMAKD  264

Query  395  SKIEFIRGAVPQS-ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKV  453
              +  +R   PQS + ++E      K +     +    FDTV+ A GR P  ++L L   
Sbjct  265  GIV--VR---PQSNVARVEQTADGKKTLFLQNGSEHAGFDTVIYAAGRVPLTSELNLSAA  319

Query  454  GVKLNPKTGRIAVTNEQ-TSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNET-ALM  511
            G+  + K G I V   Q TS  N++A+GDV     LTPVAI AGR L+ RL+     A +
Sbjct  320  GIATD-KHGFIKVDEYQTTSKSNVFAVGDVCGTTALTPVAIAAGRRLSDRLFGGMADAKI  378

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC--  569
             YD + T VF+    G  GL+E  + EK+G+  ++ Y   F  + + L +D +A G+   
Sbjct  379  SYDNIPTVVFSHPPIGTIGLTEHEAREKHGDAQIKTYTSRFVNMYYGLVNDVDADGAAKP  438

Query  570  ----YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
                 +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N V IHPT  E
Sbjct  439  KPMTAMKLVCLGKDEK-VVGLHVIGMAADEMLQGFGVAVKMGATKADFDNCVAIHPTAGE  497

Query  626  IFTTLEVTKSSGES  639
               T+     +G+S
Sbjct  498  ELVTMAPWGLNGQS  511

>CCA23647
Length=496

 Score = 238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 161/466 (35%), Positives = 238/466 (51%), Gaps = 28/466 (6%)

Query  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIH-------  233
            + A+ YG KV +++  +        G GGTCVN GC+PKK+M+ ++   E I        
Sbjct  22   RRAATYGAKVLLIERHREY---EGAGYGGTCVNYGCVPKKVMYNAAAHVEHIERAPDYSI  78

Query  234  -----KDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  288
                 K   +  ++ G+  FDW +M    ++YI+ +N  Y   L + K+     +   + 
Sbjct  79   RPFASKGDTSHSFSFGD--FDWGRMKVKRDAYIERLNGIYTRNLANAKIDTVTGIAKLIA  136

Query  289  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVG  348
               +++            + ++IAVGG P   S  G + AI SD  F  +  P K  VVG
Sbjct  137  KDRVQV----NQDSFFEGKHILIAVGGTPAMPSIPGIEHAIDSDGFFKLETQPKKVAVVG  192

Query  349  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQS  407
            A Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++ + F+R +  + 
Sbjct  193  AGYIAVEIAGVFNTLKSDTFLFCRFDQVLRKFDPLVRDLVNEEME-KNGVNFVRKSHLEK  251

Query  408  ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV-  466
            I K E  +L +     D       FD ++ A GR P    LGL+ VGV+LN +TG I V 
Sbjct  252  IVKSEDDKLAITARIGDQSQTFSNFDQIVMAVGRSPRTVDLGLEDVGVELN-ETGHIIVD  310

Query  467  TNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-ALMDYDKVCTAVFTPI  524
              E TS P +YA+GDV     ELTPVAI AGR LA RL+NNE  A + Y ++ T VF+  
Sbjct  311  AQENTSIPGVYALGDVTTTGWELTPVAIAAGRRLADRLFNNEKEACLYYHQIPTVVFSHP  370

Query  525  EYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVV  584
              G  G +E  +I KYGEEN++ Y   F  L +S++ D E      +K++C     + VV
Sbjct  371  PLGTIGYTEPEAIAKYGEENVKCYSSKFVNLLYSMAEDPEKKKKTCMKLVC-VGSKETVV  429

Query  585  GFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            G H  G  A E+ Q  G+AMK+G T     N+V IHPT +E   T+
Sbjct  430  GLHVAGDGADEMVQGFGVAMKMGATKADFDNIVAIHPTASEELVTM  475

>H310_14447
Length=501

 Score = 237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 169/475 (36%), Positives = 257/475 (54%), Gaps = 22/475 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+GGGSGG++ +  A +YG KV V++  +   V    G+GGTCVNVGC+PKK+M+ 
Sbjct  9    YDYIVVGGGSGGVSSASRAVEYGAKVLVIERGR---VNGGAGMGGTCVNVGCVPKKIMYN  65

Query  225  SSLIGETIHKDAKAFGW----TVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            + +  E +H  AK + +     V   +FDW+ M    ++Y+  ++  Y+  L ++ + + 
Sbjct  66   AGVHAEILHS-AKDYSFKDVVNVKFGSFDWAAMKAKRDAYVNWLSAAYEEGLGEENIDHV  124

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
                 FVD HT+E+       +  T   ++IAVGG P+  +  G + A+SSD  F     
Sbjct  125  IGAAVFVDDHTVEV-----NGQRYTAPHILIAVGGMPQMPNIPGIEHAVSSDGFFDLPTQ  179

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEF  399
            P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + + + M  ++ + F
Sbjct  180  PKKVAVVGAGYIAVELAGIFNALKSDTVVFCRGNQVLRKFDPLVRDLVNDEM-AKAGVAF  238

Query  400  IRGAVPQSITKLESGQLLVKWVSADGETCEE--AFDTVLNATGRDPDVAKLGLDKVGVKL  457
            +  A  +SI K   G L V  V+  GE   E   FD +++A GR P    +GLDK  V+L
Sbjct  239  VTHAHLESIRKEADGSLTV--VAKVGEATNEFAGFDAIVSAIGRIPRTQDVGLDKTHVEL  296

Query  458  NPKTGRIAVTNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-ALMDYDK  515
            +     +    E T+   +YAIGDV     ELTPVAI AGR LA RL+  ET A + Y +
Sbjct  297  SDDGFVVVDAQENTTVDGVYAIGDVTTTGWELTPVAIAAGRRLADRLFGKETNACIHYHQ  356

Query  516  VCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVIC  575
            + T VF+    G  GL+E  +I KYG +N+ +Y   F+ + ++L++         +K++C
Sbjct  357  IPTVVFSHPPIGTIGLTEPDAIAKYGRDNVTVYTSTFSNMFYALATHSAHKPQTAMKLVC  416

Query  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                 + V+G H  G  A E+ Q  G+A+KLG       NVV IHPT AE   T+
Sbjct  417  -IGVEETVIGAHVAGLGADEMIQGFGVAIKLGAYKSDFDNVVAIHPTAAEEMVTM  470

>PYAR_17512
Length=533

 Score = 238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 167/516 (32%), Positives = 267/516 (52%), Gaps = 55/516 (11%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            +YD +VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  33   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEQAR---------LGGTCVNVGCVPKKIM  83

Query  223  HQSSLIGETIHKDAKAFGW--------TVGEQTFDWSQMLKSVNSYIKSINFKYKVELRD  274
            + ++ +G  +H+D   +G+         + E  F W+++ +  ++Y+  +N  Y+  L +
Sbjct  84   YLAANMGHLLHRDLFHYGFETKRGGGHLIDETQFHWNKLKERRDAYVLRLNGIYERNLGN  143

Query  275  KKVKYENLLGSFVDAHTLEL---WHPKKGT------------------KTVTTRDVVIAV  313
             KV+      +F     +E+     P K                    K ++ ++V+IAV
Sbjct  144  SKVELLTGTATFNAQGNVEVDGKEIPAKNVLIAVXXXXNAQGNVEVDGKEISAKNVLIAV  203

Query  314  GGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRS  373
            GG+P   +  G +  I SD  F  +E P K  VVGA Y+A+E AG + G+G D  I  R 
Sbjct  204  GGKPLIPNIPGKEHCIDSDGFFELEEMPKKVAVVGAGYIAVELAGVLHGLGSDTTIFCRK  263

Query  374  I-LLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAF  432
              +LRGFD+ + + + + M+ +  ++    ++   +TK   G   +  V  DG T    F
Sbjct  264  DGVLRGFDELIRSTLHDAMDKDG-LKLRPHSLVAKVTKQADGTKTL--VLQDG-TEHAGF  319

Query  433  DTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTP--NIYAIGDVIDAPELTP  490
            DTV+ A GR P    L L+  GV+ + + G I +   Q +T   NI+A+GDV   P LTP
Sbjct  320  DTVIYAAGRVPLTQSLNLEGAGVETDAQ-GFIKIDEYQRTTAKKNIFAVGDVCGTPALTP  378

Query  491  VAIQAGRLLARRLYNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYH  549
            VAI AGR L+ RL+   + A M Y+ + T VF+    G  GL+E+ +  K+G++ +++Y 
Sbjct  379  VAIAAGRRLSDRLFGGMKEAKMSYENIPTVVFSHPPIGTVGLTEKEARAKHGDDAVKVYS  438

Query  550  QNFTPLEWSLSSDREAAGS------CYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLA  603
              F  + + + ++    G         +K++C  K  K VVG H +G  A E+ Q  G+A
Sbjct  439  SRFVNMHYGIVNEFGNDGQQKPKPMTAMKLVCVGKEEK-VVGVHLIGMAADEILQGFGVA  497

Query  604  MKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGES  639
            +K+G T     + V IHPT AE   T+     SGE 
Sbjct  498  VKMGATKADFDSCVAIHPTAAEELVTMAPWGLSGEQ  533

>PHYSO_550665
Length=491

 Score = 236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 255/479 (53%), Gaps = 30/479 (6%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGREF---EGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGE--------TIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKK  276
            ++   E        +I+  AK F +      FDW+ M    ++YIK +N  Y+  L + +
Sbjct  64   AAAHVEHLARNKDYSINTAAKDFEFG----DFDWANMKTKRDAYIKRLNGIYERNLGNAQ  119

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            V +   +   V    +E+       K  T + V++A GG P      G +  I SD  F 
Sbjct  120  VDHVQGIAKLVAKDKVEV-----AGKVFTGKHVLVAPGGVPSVPDLPGMEHVIDSDGFFK  174

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETES  395
             ++ P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++
Sbjct  175  LEQQPKKVAVVGAGYIAVEMAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KA  233

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDKVG  454
             ++F+R      + K   G+L    V+ +GE  +   FD +L A GR+P    LGL++VG
Sbjct  234  GVKFVRNMRAARVEKQADGKLTF-VVTINGEEHKFPDFDAILYAVGREPRTKDLGLEEVG  292

Query  455  VKLNPKTGRIAV-TNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLARRLYNNET-ALM  511
            VKL+ + G I V   E TS P +YAIGD  I   ELTPVAI AGR L+ RL+  E  A +
Sbjct  293  VKLS-EGGFIEVDAQENTSVPGVYAIGDATITGWELTPVAIAAGRRLSDRLFGGEKDACL  351

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYV  571
            +Y ++ T +F+    G  G +E  ++ KYGEEN++ Y   F  L  S+ +D E  G   +
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAVAKYGEENVKCYTSKFVNLLHSM-ADPERKGKTAM  410

Query  572  KVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            K++      + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  411  KLVT-VGEQETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>PITG_14083
Length=493

 Score = 235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 169/476 (36%), Positives = 256/476 (54%), Gaps = 24/476 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATYGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++   E ++++ K +      + F     DW+ M    ++YIK +N  Y+  L + KV +
Sbjct  64   AAAHVEHLNRN-KDYSINTASKDFEFGDFDWANMKTKRDAYIKRLNGIYERNLGNAKVDH  122

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
               +   V    +E+       +  T + V++A GG P      G +  I SD  F  ++
Sbjct  123  VQGIAKLVAKDKIEV-----AGQVYTGKHVLVAPGGTPTVPDLPGMEHVIDSDGFFKLEQ  177

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++ + 
Sbjct  178  QPKKVAVVGAGYIAVELAGIFNVLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVN  236

Query  399  FIRGAVPQSITKLESGQLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDKVGVKL  457
            F+R +    + K ++G+ L   V+ DGE  +   FD+++ A GR P    LGL++VGVKL
Sbjct  237  FVRNSRAVRVEKQDNGK-LTYVVTVDGEEQKFTDFDSIVYAIGRSPRTKDLGLEEVGVKL  295

Query  458  NPKTGRIAV-TNEQTSTPNIYAIGD-VIDAPELTPVAIQAGRLLARRLYNNET-ALMDYD  514
              + G I V   E TS   +YAIGD  +   ELTPVAI AGR L+ RL+  E  A ++Y 
Sbjct  296  -AEGGFIEVDAQENTSVAGVYAIGDATVTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574
            ++ T +F+    G  G +E  +I KYGEEN+++Y   F  L  S+ +D E  G   +K++
Sbjct  355  QIPTVIFSHPPIGTIGYTEPEAIAKYGEENVKVYSSKFVNLIHSM-ADPERKGKTAMKLV  413

Query  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                  + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  414  T-VGDKETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  468

>H257_09722
Length=518

 Score = 234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 168/480 (35%), Positives = 257/480 (54%), Gaps = 28/480 (6%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+GGGSGG++ ++ A+ YG  V V++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  28   YDYIVLGGGSGGISSARRAASYGANVLVIERGREQ---GGAGLGGTCVNVGCVPKKVMYN  84

Query  225  SSLIGETIHKDAKAFGWT----VGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            ++   E +H  AKA+ +     VG  +FDW+ M    +SY+  ++  Y+  L    +   
Sbjct  85   AAFHAEILHS-AKAYAFKGVQDVGFGSFDWATMKTKRDSYVARLHGIYERNLAKDNITLV  143

Query  281  NLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEA  340
            +   SFVD HT+ +        T T   +++AVGG P+  S  G + AISSD  F  +  
Sbjct  144  SGRASFVDNHTIAV-----DGATFTAPHILVAVGGVPQLPSIPGIEHAISSDGFFGLETQ  198

Query  341  PGKTLVVGASYVALECAGFMKGMGYDVKIMVRS-ILLRGFDQDMANKIGEFMETESKIEF  399
            P K  V+GA Y+A+E AG    +  +  +  R   +LR FD  + + + + M   S ++F
Sbjct  199  PKKVAVIGAGYIAVELAGIFNALQSETVVFCRGRQVLRTFDPLVRDLVNDEMR-RSGVQF  257

Query  400  IRGAVPQSITKLESGQLLVK--WVSADGETCEE----AFDTVLNATGRDPDVAKLGLDKV  453
            +  +  QSI K   G L ++    + DG +        FD ++ A GR P  +   ++  
Sbjct  258  VPHSGVQSIRKEPDGTLTIEATLTTEDGHSTTHHAFRGFDAIVMAVGRTPRTSGF-MEHT  316

Query  454  GVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-AL  510
             +  N K G I V   E TS P +YAIGDV +   ELTPVAI AGR LA RL+  E  A 
Sbjct  317  TIIRNEK-GFIEVDGQENTSVPGVYAIGDVTNTGWELTPVAIAAGRRLADRLFGGEPDAC  375

Query  511  MDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCY  570
            + Y ++ T VF+    G  G +E  ++ K+G  N+++Y  +F  L +S+ +  E      
Sbjct  376  LHYHQIPTVVFSHPPIGTVGYTEPDAVAKFGPSNVKVYTSSFVNLFYSMLAP-ENKPKTA  434

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            +K+IC   + + VVG H  G  A E+ Q  G+A+K+G     + N+V IHPT +E F T+
Sbjct  435  MKLIC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNIVAIHPTASEEFVTM  493

>HYAP_08763
Length=473

 Score = 233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 159/466 (34%), Positives = 240/466 (52%), Gaps = 30/466 (6%)

Query  177  LACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGE------  230
            +A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  ++   E      
Sbjct  1    MASARRAATYGAKVLVIERGRQY---DGMGLGGTCVNFGCVPKKIMFNTAAHVEHLNRAK  57

Query  231  --TIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVD  288
              +IH    AFG       FDWS+M    ++YI  +   Y+  L + +V +   +  FV 
Sbjct  58   DYSIHTAEFAFG------DFDWSKMKTKRDAYINRLTGIYQRNLGNARVDHVEGIAKFVA  111

Query  289  AHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVG  348
             + +++       +  T + V+IA GG P      G +  I SDD F  ++ P K  VVG
Sbjct  112  KNKVQV-----ADRVFTGKHVLIAPGGVPLKPDLPGINHVIDSDDFFRLEQQPQKVAVVG  166

Query  349  ASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQS  407
            A Y+A+E AG    +  D  +  R   +LR F+  + + + E ME ++ + F+R      
Sbjct  167  AGYIAVEMAGIFHALKSDTTLFCRHDQVLRRFEPIVRDLVNEEME-KAGVTFVRNMSAVG  225

Query  408  ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV-  466
            + K   G+L +     + E     FDT+L A GR P    LGL+ +GVKL  + G I V 
Sbjct  226  VEKQLDGKLTLVVNVHNEEQKFTDFDTILFAVGRKPRTEDLGLEDIGVKL-AEGGFIQVD  284

Query  467  TNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLARRLYNNET-ALMDYDKVCTAVFTPI  524
              E TS P +YAIGD  +   ELTPVAI AGR LA RL+  E  A ++Y ++ + +F+  
Sbjct  285  AQENTSVPGVYAIGDATVTGWELTPVAIAAGRRLADRLFGGEKDACLNYHQIPSVIFSHP  344

Query  525  EYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVV  584
              G  G +E  ++ KYGEEN+++Y   F  L  S+ +D E  G   +K++      + VV
Sbjct  345  PIGTIGYTEPEAVAKYGEENVKVYTSKFVNLLHSM-ADPEHKGKTAMKLVT-VGEQETVV  402

Query  585  GFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            G H  G  A E+ Q  G+A+K+  T     N+V IHPT +E   T+
Sbjct  403  GVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  448

>PYAP_23435
Length=951

 Score = 242 bits (618),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 173/478 (36%), Positives = 252/478 (53%), Gaps = 28/478 (6%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV +++  +        GLGGTCVN GC+PKK+M  
Sbjct  471  YDYVVIGGGSGGMASARRAATYGAKVLLVERGRAH---DGMGLGGTCVNYGCVPKKVMFN  527

Query  225  SSLIGE--------TIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKK  276
            ++   E        +I+   KAF +      FDW+ M    ++YI  +N  Y+  + +  
Sbjct  528  AAAHVEHLARNGDYSINTAPKAFEFG----DFDWANMKTKRDAYILRLNGIYERNVGNAG  583

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            +     + + V ++ +E+       K  T + V++AVGG P   +  G + AI SD  F 
Sbjct  584  IDLVQGVATLVSSNQIEV-----DGKVFTGKHVLVAVGGVPAMPAIPGIEHAIDSDGFFK  638

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETES  395
             +  P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + + E ME   
Sbjct  639  LESQPKKVAVVGAGYIAVEIAGIFNTLKSETFLFCRYDQVLRAFDPYVRDLVNEEMEKHG  698

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGV  455
             + F+R +  + I K   G+L +       +   E FD VL A GR+P    LGLDK GV
Sbjct  699  -VNFVRRSRIEKIEKQADGKLTIHAKVDGQDQTLEGFDEVLFAIGREPRTRGLGLDKAGV  757

Query  456  KLNPKTGRIAV-TNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-ALMD  512
            KLN   G I V   E TS P +YAIGD      ELTPVAI AGR LA RL+ NE  A + 
Sbjct  758  KLN-DGGFIEVDAQENTSVPGVYAIGDATTTGWELTPVAIAAGRRLADRLFGNEPDACLH  816

Query  513  YDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVK  572
            Y ++ T VF+    G  G +E  ++ K+G + +++Y   F  L  S++ D E  G   +K
Sbjct  817  YHQIPTVVFSHPPLGTIGYTEPEAVAKFGADKVKVYTSKFVNLLHSMA-DPENKGKTAMK  875

Query  573  VICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            ++C    ++ VVG H  G  A E+ Q  G+AMK+  T     N+V IHPT AE F T+
Sbjct  876  LVC-VGDDEVVVGLHVAGEGADEMVQGFGVAMKMNATKADFDNIVAIHPTAAEEFVTM  932

>H257_17037
Length=498

 Score = 231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/458 (34%), Positives = 239/458 (52%), Gaps = 18/458 (4%)

Query  180  SKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAF  239
            +  A +YG KV V++  + +      G+GGTCVNVGC+PKK+M+ +    E +H  AK +
Sbjct  23   ASRAVEYGAKVLVIERGRAN---GGAGMGGTCVNVGCVPKKIMYNAGFHAEILHS-AKDY  78

Query  240  GW----TVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELW  295
             +     V   +FDW+ M    ++Y+  +   Y+  L ++ + +     +FVD HT+E+ 
Sbjct  79   SFKEVVNVKFGSFDWAAMKAKRDAYVNWLTGAYEEGLGEENIDHVIGAATFVDDHTVEV-  137

Query  296  HPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALE  355
                G +  T   ++IAVGG P+  +  G + AISSD  F     P K  VVGA Y+A+E
Sbjct  138  ---NGLR-FTAPHILIAVGGVPQLPTIPGIEHAISSDGFFDLPTQPKKVAVVGAGYIAVE  193

Query  356  CAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESG  414
             AG    +  D  +  R   +LR FD  + + + + M  +S + F+  +  QSI K   G
Sbjct  194  LAGIFNALKSDTVVFCRGDQVLRKFDPLVRDLVNDEM-AKSGVTFVTQSHLQSIRKEADG  252

Query  415  QLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTP  474
             L +     D       F+ +++A GR P    +GLDK  V+L+     +    E T+ P
Sbjct  253  TLTIVATVNDIRAEFPGFNAIVSAIGRIPRTFDVGLDKTTVELSTDGFVVVDAQENTTVP  312

Query  475  NIYAIGDV-IDAPELTPVAIQAGRLLARRLYNNE-TALMDYDKVCTAVFTPIEYGCCGLS  532
             +YAIGD  I   ELTPVAI AGR LA RL+ +E  A + Y ++ T +F+    G  GL+
Sbjct  313  GVYAIGDATITGWELTPVAIAAGRRLADRLFGHEANACIHYHQIPTVIFSHPPIGTIGLT  372

Query  533  EEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPN  592
            E  +I KYG+ N+  Y  +F+ L +SL    +      +K++C     + VVG H  G  
Sbjct  373  EPEAIAKYGQANVTAYTSSFSNLFYSLGKPADHKPQTAMKLVC-IGVEETVVGAHVAGLG  431

Query  593  AGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  432  ADEMIQGFGVAIKMGAYKSDFDNIVAIHPTASEEMVTM  469

>PHYKE_10327
Length=1200

 Score = 240 bits (612),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 168/495 (34%), Positives = 252/495 (51%), Gaps = 53/495 (11%)

Query  162  KYDYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKK  220
            + +YD +VIG GSGG+A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKK
Sbjct  24   QTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKK  74

Query  221  LMHQSSLIGETIH--------KDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVEL  272
            LM  ++ +G  +H        +DA + G       FDW+++    ++Y+  +N  Y+  L
Sbjct  75   LMFIAADLGHKLHHDLLHYGFEDAASGGHVSQHARFDWAKLKTRRDAYVLRLNGIYERNL  134

Query  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332
             + KV+      +F D   + +       K V  ++V+IAVGG+P      G +L I SD
Sbjct  135  ANSKVELIRGSAAFNDNGNVVV-----DGKEVRAKNVLIAVGGKPMIPDIPGKELCIDSD  189

Query  333  DIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFD-------QDMA  384
              F  +  P K  VVGA Y+A+E AG +  +G D  I  R   +LR FD       +D  
Sbjct  190  GFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM  249

Query  385  NKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPD  444
             K G  ++  S I  +  A   + T           V ADG      +D V+ A GR P 
Sbjct  250  KKDGVHLQRHSNIARVNQAADGTKT----------LVLADGSE-HSGYDVVIYAAGRVPL  298

Query  445  VAKLGLDKVGVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRL  503
             + L LDK G+  + K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL
Sbjct  299  TSTLKLDKAGIATD-KNGFIQVNKFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRL  357

Query  504  YNNE-TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD  562
            +     A + Y+ + T VF+    G  GL+EE + +KYG++++++Y   F  + + L ++
Sbjct  358  FGGMGGAKVSYENIPTVVFSHPPIGTIGLTEEQARQKYGDDSIKVYTSRFVNMYYGLINE  417

Query  563  R-EAAG------SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              E  G         +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N
Sbjct  418  MDETTGEPKDKPKTAMKLVCAGKDEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDN  476

Query  616  VVGIHPTTAEIFTTL  630
             + IHPT  E   TL
Sbjct  477  CMAIHPTAGEELVTL  491

>PHYRA_71927
Length=485

 Score = 228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 162/495 (33%), Positives = 250/495 (51%), Gaps = 53/495 (11%)

Query  162  KYDYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKK  220
            + +YD +VIG GSGG+A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKK
Sbjct  9    RTEYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKK  59

Query  221  LMHQSSLIGETIHKDAKAFGWT-------VGEQT-FDWSQMLKSVNSYIKSINFKYKVEL  272
            LM  ++ +   +  D   +G+        +G++T FDW ++    ++Y+  +N  Y+  L
Sbjct  60   LMFIAADMSHKLRHDFLHYGFEDEATGGHLGQRTHFDWPKLKARRDAYVLRLNGIYERNL  119

Query  273  RDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSD  332
             + KV+  +    F +   +E+       K +  ++V++AVGG+P      G +L I SD
Sbjct  120  ANSKVELIHGSAKFNEKGNVEV-----DGKELLAKNVLVAVGGKPLIPDIPGKELCIDSD  174

Query  333  DIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFD-------QDMA  384
              F  +  P K  VVGA Y+A+E AG +  +G D  I  R   +LR FD       +D  
Sbjct  175  GFFELEMLPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRTFDGIVRTTLEDAM  234

Query  385  NKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPD  444
             K G  +   S +  +      + T           V ADG      +D V+ A GR P 
Sbjct  235  AKDGVHLRPHSNVTRVEQVADGTKT----------LVLADGSE-HSGYDVVIYAAGRVPL  283

Query  445  VAKLGLDKVGVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRL  503
             + L LD   +  + K G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL
Sbjct  284  TSNLQLDNADIATD-KHGFIQVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRL  342

Query  504  YNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD  562
            +   + A + Y+ + T VF+    G  GL+EE +  +YG++N ++Y   F  + + L ++
Sbjct  343  FGGMKDAKVSYENIPTVVFSHPPIGTIGLTEEQARRQYGDDNTKVYASRFVNMYYGLINE  402

Query  563  -REAAG------SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              EA G         +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N
Sbjct  403  VDEATGEPKDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDN  461

Query  616  VVGIHPTTAEIFTTL  630
             + IHPT  E   TL
Sbjct  462  CIAIHPTAGEELVTL  476

>PHALS_09136
Length=493

 Score = 226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 167/479 (35%), Positives = 253/479 (53%), Gaps = 30/479 (6%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+  G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDFMVIGGGSGGMASARRAATCGAKVLVVERGREF---DGMGLGGTCVNFGCVPKKVMFN  63

Query  225  SSLIGETIHKD--------AKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKK  276
            +++  E ++++        AK F +      FDW+ M    ++YI+ +N  Y+  L + +
Sbjct  64   TAVHVEHLNRNKDYSINTCAKDFEFG----DFDWANMKTKRDAYIQRLNGIYERNLSNAQ  119

Query  277  VKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFW  336
            V     +   V    +++          T + V++A GG P      G +  I SD  F 
Sbjct  120  VDVIQGIAKIVAKDKIQV-----AGHIYTGKHVLVAPGGVPNIPDIPGKEHVIDSDGFFK  174

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETES  395
             ++ P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++
Sbjct  175  LEQQPKKVAVVGAGYIAVELAGIFNMLKSDTTLFCRHDQVLRKFDPIVRDLVNEEME-KA  233

Query  396  KIEFIRGAVPQSITKLESGQLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDKVG  454
             +EF+R      I K    +L    V+ +GE  E   FDT+L A GR P    LGL+++G
Sbjct  234  GVEFVRNMSATRIEKSNDDKLTF-VVTMNGEEQEFTNFDTILFAVGRVPRTKDLGLEEIG  292

Query  455  VKLNPKTGRIAV-TNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLARRLYNNET-ALM  511
            VKL    G I V   E T+ P +YAIGDV +   ELTPVAI AGR LA RL+  E  A +
Sbjct  293  VKL-ADGGYIEVDAQENTTVPGVYAIGDVTVTGWELTPVAIAAGRRLADRLFGGEKDACL  351

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYV  571
            +Y ++ T +F+    G  G +E  +I ++G+EN++IY   F  L  ++ +D E  G   +
Sbjct  352  NYHQIPTVIFSHPPIGTIGYTEPEAIARFGKENIKIYTSKFVNLLHAM-ADPERKGKTAM  410

Query  572  KVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            K++      + VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT +E   T+
Sbjct  411  KLVT-VGEEETVVGVHVAGEGADEMIQGFGVAVKMNATKADFDNIVAIHPTASEELVTM  468

>H310_11259
Length=519

 Score = 225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 169/480 (35%), Positives = 257/480 (54%), Gaps = 28/480 (6%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+GGGSGG+A ++ A+ YG KV V++  +        GLGGTCVNVGC+PKK+M+ 
Sbjct  29   YDYIVLGGGSGGIASARRAASYGAKVLVVERGR---TLGGAGLGGTCVNVGCVPKKVMYN  85

Query  225  SSLIGETIHKDAKAFGWTVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++ + E +H  AK + +  G Q     +FDW  M    ++Y+  ++  Y+  L    +  
Sbjct  86   AAFLAEIMHS-AKTYTFK-GVQGVEFGSFDWPAMKSKRDAYVTRLHGIYERNLAKDGISL  143

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
             + + +FVD HT+ +     G K  T   +++AVGG P+  S  G +LAISSD  F  + 
Sbjct  144  VSGVAAFVDNHTIAV----DGAK-FTAPHILVAVGGTPQLPSIPGIELAISSDGFFALET  198

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + + M   + + 
Sbjct  199  QPRKVAVVGAGYIAVELAGIFNALQTDTTLFCRHDQVLRKFDPLVRDHVNKEMR-RAGVA  257

Query  399  FIRGAVPQSITKLESGQLLVKWV--SADGETCEEAF---DTVLNATGRDPDVAKLGLDKV  453
            F+  +   SI K  +G L ++      +G    + F   D V+ A GR P     G D+ 
Sbjct  258  FVTQSGVDSIHKEANGTLTIQATIKQENGSATTQEFSGYDAVVVAIGRTPRTTDCGFDRT  317

Query  454  GVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-AL  510
             +  + K G I V   E T+ P +YAIGD      ELTPVAI AGR LA RL+  E  A 
Sbjct  318  DIVFDRK-GFIQVDGQENTTVPGVYAIGDATATGWELTPVAIAAGRRLADRLFGGEPDAC  376

Query  511  MDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCY  570
            ++Y ++ T VF+    G  G +E  +I KYG  N+++Y  +F  L ++L   ++   S  
Sbjct  377  INYHQIPTVVFSHPPIGTIGYTEPDAIAKYGPANVKVYTSSFVNLFYTLLPPKDMP-STA  435

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            +KV+C   + + VVG H  G  A E+ Q  G+A+K+G     + NV+ IHPT +E   T+
Sbjct  436  MKVVC-VGKEETVVGMHVAGMGADEMIQGFGVAVKMGAYKSDLDNVIAIHPTASEELVTM  494

>PPTG_18033
Length=500

 Score = 224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 160/487 (33%), Positives = 251/487 (52%), Gaps = 41/487 (8%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            +YD +VIG GSGG+A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKKLM
Sbjct  26   EYDYLVIGAGSGGMASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLM  76

Query  223  HQSSLIGETIHKDAKAFGWT-------VGEQT-FDWSQMLKSVNSYIKSINFKYKVELRD  274
              ++ +   +  D   +G+        +G++T FDW ++    ++Y+  +N  Y+  L +
Sbjct  77   FIAADMSHKLDHDFLHYGFEDEATGEHLGKRTHFDWMKLKARRDAYVLRLNGIYERNLAN  136

Query  275  KKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDI  334
             KV+       F +   +E+       K +  ++V+IAVGG+P      G +L I SD  
Sbjct  137  SKVELIRGSAKFNENGNVEV-----DGKELLAKNVLIAVGGKPLIPDIPGKELCIDSDGF  191

Query  335  FWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMET  393
            F  +  P K  VVGA Y+A+E AG +  +G D  I  R   +LR FD  +   + + M  
Sbjct  192  FELEILPKKVAVVGAGYIAVELAGVLNALGSDTSIFCRKEGVLRSFDDIVRTTLEDAMVK  251

Query  394  ESKIEFIRGAVPQS-ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDK  452
            +     +R   P S + ++E      K V     +    +D V+ A GR P  + L LDK
Sbjct  252  DGV--HLR---PHSNVARVEQAADGTKTVVLTDGSEYNGYDVVMYAAGRVPLTSNLQLDK  306

Query  453  VGVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETAL  510
             GV  + + G I V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+     + 
Sbjct  307  AGVTTD-EHGFIPVNEFQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGLNNSK  365

Query  511  MDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAG--  567
            + Y+ + T VF+    G  GL+E+ +  KYG++ +++Y   F  + + L ++  E+ G  
Sbjct  366  VSYENIPTVVFSHPPIGTIGLTEDQARRKYGDDAVKVYTSRFVNMYYGLINEVDESTGEP  425

Query  568  ----SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTT  623
                   +K++C  K  K VVG H +G  A E+ Q  G+A+K+G T     N + IHPT 
Sbjct  426  KDKPKTAMKLVCVGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTA  484

Query  624  AEIFTTL  630
             E   TL
Sbjct  485  GEELVTL  491

>PHYKE_6836
Length=493

 Score = 220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 165/476 (35%), Positives = 256/476 (54%), Gaps = 24/476 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ YG KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYVVIGGGSGGMASARRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            +++  E + ++ + +     ++ F     DWS M    ++YI  +N  Y+  L++++V +
Sbjct  64   TAMHVEHLARN-RDYSINTAQRDFQFGDFDWSNMKTKRDAYILRLNGIYERNLQNQQVDH  122

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
               +   V    +++       +  T +++++A GG P      G +  I SD  F  ++
Sbjct  123  VQGIAKIVAKDKIQV-----DGQVFTGKNLLVAPGGVPTIPDFPGNEHVIDSDGFFKLEQ  177

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIE  398
             P K  VVGA Y+A+E AG    +  D  +  R   +LR FD  + + + E ME ++ ++
Sbjct  178  QPKKVAVVGAGYIAVEMAGIFNTLKSDTTLFCRFDQVLRKFDPIVRDLVNEEME-KAGVK  236

Query  399  FIRGAVPQSITKLESGQLLVKWVSADG-ETCEEAFDTVLNATGRDPDVAKLGLDKVGVKL  457
            F+R +    + K   G+L    V+ DG E     FDT+L A GR P    LGL+++ VKL
Sbjct  237  FVRNSRAVRVEKQTDGKLTF-VVTVDGKEEKFPDFDTILYAVGRTPRTKDLGLEEINVKL  295

Query  458  NPKTGRIAV-TNEQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNET-ALMDYD  514
            + + G I V   E TS   +YAIGD      ELTPVAI AGR L+ RL+  E  A ++Y 
Sbjct  296  S-QDGFIEVDAQENTSVEGVYAIGDATTTGWELTPVAIAAGRRLSDRLFGGEKDACLNYH  354

Query  515  KVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI  574
            ++ T +F+    G CG +E  ++EK+G+EN++ Y   F  L  S++ D E  G   +K +
Sbjct  355  QIPTVIFSHPPIGTCGYTEPEAVEKFGQENIKTYSSKFVNLLHSMA-DPERKGKTAMK-L  412

Query  575  CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                  + VVG H  G  A E+ Q  G+AMK+  T     N+V IHPT AE   T+
Sbjct  413  VCVGEEEVVVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTAAEELVTM  468

>PITG_13427
Length=463

 Score = 214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 157/484 (32%), Positives = 247/484 (51%), Gaps = 42/484 (9%)

Query  177  LACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKD  235
            +A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +  D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLRHD  51

Query  236  AKAFGWT-------VGEQT-FDWSQMLKSVNSYIKSINFKY-KVELRDKKVKYENLLGSF  286
               +G+        +G++T FDW ++    ++Y+  +N  Y +  L + KV+    L +F
Sbjct  52   LLHYGFEDEATGGHLGKRTHFDWPKLKAGRDAYVLRLNGIYERRNLANSKVELIRGLATF  111

Query  287  VDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLV  346
             +   +E+     G K +  ++V+IAVGG+P      G +L I SD  F  +  P K  V
Sbjct  112  NEKGNVEV-----GGKELLAKNVLIAVGGKPLIPDLPGKELCIDSDGFFELETLPKKVAV  166

Query  347  VGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETESKIEFIRGAVP  405
            VGA Y+A+E AG +  +G D  +  R   +LR FD  +   + + M  E     +R   P
Sbjct  167  VGAGYIAVELAGVLNALGSDTSLFCRKEGVLRAFDDIVRTTLEDAMAKEGV--HLR---P  221

Query  406  QS-ITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRI  464
             S + ++E G    K +     +    +D V+ A GR P  + L LDK G+  + + G I
Sbjct  222  HSNVARVELGADGTKTLVLTDGSKYSGYDVVIYAAGRVPLTSNLQLDKAGITTD-EHGFI  280

Query  465  AVTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDYDKVCTAVFT  522
             V   ++TS   + A+GDV   P LTPVAI AGR L+ RL+     A + Y+ + T VF+
Sbjct  281  PVNELQETSNSKVLAVGDVCGTPALTPVAIAAGRRLSDRLFGGMNDAKVSYENIPTVVFS  340

Query  523  PIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAG------SCYVKVIC  575
                G  GL+EE +  KYG++ +++Y   F  + + L ++  E+ G         +K++C
Sbjct  341  HPPIGTIGLTEEQARRKYGDDAIKVYTSRFVNMYYGLINEVDESTGEPKDKPKTAMKLVC  400

Query  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKS  635
              K  K VVG H +G  A E+ Q  G+A+K+G T     N + IHPT  E   TL     
Sbjct  401  AGKEEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDNCIAIHPTAGEELVTLAPWGL  459

Query  636  SGES  639
            SG S
Sbjct  460  SGRS  463

>PYVX_21517
Length=482

 Score = 212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 152/497 (31%), Positives = 249/497 (50%), Gaps = 81/497 (16%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            ++DL+VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  27   EFDLLVIGAGSGGMAASRRAASYPNTRVAVVERAR---------LGGTCVNVGCVPKKIM  77

Query  223  HQSSLIGETIHKDAKAFGW--------TVGEQT-FDWSQMLKSVNSYIKSINFKYKVELR  273
            +  + +   +H+DA  +G+        ++G +  FDW ++ +  ++Y+  +N  Y+  L 
Sbjct  78   YTGASLSHALHRDAFHYGFEDAASPGKSIGARVAFDWQKLKQRRDAYVLRLNGIYERNLA  137

Query  274  DKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPK----PLSCEGGDLAI  329
            + KV+       F     +E+     G + V  + V++AVGG+P     P++  G +L I
Sbjct  138  NSKVELLTGTARFNVDGKIEV----DGVE-VRAKKVLLAVGGKPLIPDIPVAATGKELCI  192

Query  330  SSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIG  388
             SD  F  ++ P K  VVGA Y+A+E AG +  +G D  I  R   +LR FD   +    
Sbjct  193  DSDGFFELEQLPRKVAVVGAGYIAVELAGVLNALGADTTIFTRRDGVLRSFDWWNS----  248

Query  389  EFMETESKIEFIRGAVPQSITK----------LESGQLLVK----WVSADGETCEEAFDT  434
            +F+  +S+ E +R  +  ++ +          +E  +L        V ADG T    F++
Sbjct  249  QFLAGDSEQEIVRSTLQDTMAQDGVTLRPHSNIERVELAADGTKTLVLADGST-HTGFES  307

Query  435  VLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTN-EQTSTPNIYAIGDVIDAPELTPVAI  493
            V+ A GR P    LGLD  GV  + + G I V   +QT+ P+I A+GD      LTP++ 
Sbjct  308  VIYAAGRVPLTGDLGLDNAGVATDER-GHIRVDEYQQTTAPDILAVGDACGTIALTPIS-  365

Query  494  QAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFT  553
                               Y+ V T VF+    G  GL+E+ +  K+G+E ++IY   F 
Sbjct  366  -------------------YENVPTVVFSHPPIGTVGLTEKQARAKFGDEQIKIYKSTFV  406

Query  554  PLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQM  613
             + + + ++   AG            ++ +VG H +G  A E+ Q  G+A+K+G T   +
Sbjct  407  NMYYGVVNELVCAGP-----------DEKIVGLHVIGMGADEMLQGFGVAVKMGATKADL  455

Query  614  VNVVGIHPTTAEIFTTL  630
             + V IHPT AE   T+
Sbjct  456  DSCVAIHPTGAEELVTM  472

>PHYCA_7619
Length=462

 Score = 207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 151/474 (32%), Positives = 237/474 (50%), Gaps = 41/474 (9%)

Query  177  LACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKD  235
            +A ++ A+ Y G +V V++  +         LGGTCVNVGC+PKKLM  ++ +   +H D
Sbjct  1    MASARRAASYPGTRVAVVEQAR---------LGGTCVNVGCVPKKLMFIAADMSHKLHHD  51

Query  236  AKAFGWT-------VGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFV  287
               +G+        +G++T FDW ++    ++Y+  +N  Y+  L + KV        F 
Sbjct  52   FLHYGFEDEVTGGHLGKRTHFDWPKLKARRDAYVLRLNGIYERNLENSKVDLIRGSAKFN  111

Query  288  DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVV  347
                +E+       K +   +V+IAVGG+P      G +L I SD  F  +  P K  VV
Sbjct  112  QNGNVEV-----DGKEILADNVMIAVGGKPLIPDIPGKELCIDSDGFFELETLPKKVAVV  166

Query  348  GASYVALECAGFMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETESKIEFIRGAVPQ  406
            GA Y+A+E AG +  +G +  I  R   +LR FD  +   + + ME +     +      
Sbjct  167  GAGYIAVELAGVLNALGSETSIFCRKEGVLRTFDDIVPTTLEDAMEKDG----VHLCPHS  222

Query  407  SITKLESGQLLVK-WVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIA  465
            ++ ++E      +  V ADG      ++ V+ A GR P    L LDK GV  +   G I 
Sbjct  223  NVVRVEQAADNTRTLVLADGSE-HSGYEVVIYAAGRVPLTTSLQLDKAGVTTD-NHGFIQ  280

Query  466  VTN-EQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDYDKVCTAVFTP  523
            V   +QTS  N++A+GD    P LTPVAI AGR L+ RL+   + A + Y+ + T VF+ 
Sbjct  281  VDEYQQTSNSNVFAVGDACGTPALTPVAIAAGRRLSDRLFGGMKDAKISYENIPTVVFSH  340

Query  524  IEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGS------CYVKVICD  576
               G  GL+E  +  KYG++ +++Y   F  + + L ++  E  G         +K++C 
Sbjct  341  PPIGTIGLTEAQARCKYGDDEIKVYTSRFVNMYYGLINEIDEETGEPKDKPKTAMKLVCA  400

Query  577  TKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
             K  K VVG H +G  A E+ Q  G+A+K+G T     + + IHPT  E   TL
Sbjct  401  GKDEK-VVGLHMIGMAADEILQGFGVAVKMGATKADFDDCIAIHPTAGEELVTL  453

>PYIR_23431
Length=468

 Score = 193 bits (491),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 144/457 (32%), Positives = 216/457 (47%), Gaps = 43/457 (9%)

Query  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFG  240
            + A+ YG KV V++  +        GLGGTCVN GC+PKK+M  +S   E ++++A    
Sbjct  23   RRAATYGAKVLVVERGRKY---DGMGLGGTCVNYGCVPKKVMFNASAHVEHLNRNADYSI  79

Query  241  WTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELW  295
             T G + F     DW+ M    ++YI  +N  Y+  L +  V     +   V  + +E+ 
Sbjct  80   TTNGSKKFEFGDFDWANMKTKRDAYILRLNGIYERNLGNAAVDLVEGIAKVVAKNQIEV-  138

Query  296  HPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALE  355
                     T + +++AVGG+P   +  G +  I SD  F  +  P K  VVGA Y+A+E
Sbjct  139  ----NGVVYTGKHILVAVGGKPSLPNIPGIEHVIDSDGFFRLEAQPKKVAVVGAGYIAIE  194

Query  356  CAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESG  414
             AG    +  D  +  R   +LR FD  + + I E  E ++ I F+R +  + I K   G
Sbjct  195  LAGIFNTLKSDTSLFCRYDHVLRQFDPIVRDLINEESE-KAGINFVRNSRIERIDKQADG  253

Query  415  QLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTP  474
             L +       E     FDT+L A GR+P    LGL++VGVKL      +    E TS P
Sbjct  254  TLTITAKVDGEEQVLSGFDTILYAIGREPRTKDLGLEEVGVKLTDAGFIVVDAQENTSVP  313

Query  475  NIYAIGD-VIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSE  533
             IYAIGD  I   ELTP+                          T VF+    G  G +E
Sbjct  314  GIYAIGDATITGWELTPIP-------------------------TVVFSHPPLGTIGYTE  348

Query  534  EASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNA  593
              +IEK+G EN+++Y   F  L +++ +D +  G   +K++   +    V   H  G  A
Sbjct  349  PQAIEKFGAENVKVYTSKFVNLLYAM-ADPDHKGKTAMKLVTVGEDEVVVG-VHVAGEGA  406

Query  594  GEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
             E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  407  DEMIQGFGVAVKMNATKADFDNIVAIHPTAAEELVTM  443

>HYAP_04843
Length=430

 Score = 188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 129/402 (32%), Positives = 206/402 (51%), Gaps = 22/402 (5%)

Query  240  GWTVGEQT-FDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPK  298
            G ++G Q  FDW+++    ++Y++ +N  Y+  L   KV++      F     +E+    
Sbjct  20   GGSLGAQMHFDWTKLKTRRDAYVRRLNGIYERNLASSKVEFIQGSARFNKQGNVEV----  75

Query  299  KGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAG  358
               K V  ++V+IAVGG+P      G +L I SD  F     P K  V+GA Y+A+E AG
Sbjct  76   -DGKEVLAKNVMIAVGGKPMIPDIPGKELCIDSDGFFELDTLPKKVAVIGAGYIAVELAG  134

Query  359  FMKGMGYDVKIMVRSI-LLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLL  417
             +  +G +  I  R   +LR FD    + +   +E    I+ +      ++ ++E     
Sbjct  135  VLNALGSETSIFCRKEGVLRTFD----DIVRTTLEDAMAIDGLHLRPNSNVARVEQAADG  190

Query  418  VKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTN-EQTSTPNI  476
               +     +    FD V+ A GR P   KL LD  GV  N K G I V   ++TS   +
Sbjct  191  TNTLVLTDGSAHCGFDIVIYAAGRVPLTDKLDLDNAGVATN-KHGYIVVNEFQETSNSKV  249

Query  477  YAIGDVIDAPELTPVAIQAGRLLARRLYNN-ETALMDYDKVCTAVFTPIEYGCCGLSEEA  535
            +A+GDV   P LTPVA+ AGR L+ RL+ N + A + Y+ + T VF+    G  GL+E+ 
Sbjct  250  FAVGDVCGTPALTPVAVAAGRKLSDRLFGNMKDARVSYENIPTVVFSHPPIGTIGLTEKQ  309

Query  536  SIEKYGEENLEIYHQNFTPLEWSLSSD-REAAGSC------YVKVICDTKRNKHVVGFHY  588
            +  KYG++++++Y  +F  + + L ++  EA G         +K++C  K+ K VVG H 
Sbjct  310  AQGKYGDDDIKVYTSHFVNMYYGLINEVDEATGELKEKPKTAIKLVCAGKKEK-VVGLHM  368

Query  589  LGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            +G  A E+ Q  G+A+K+G T     N + IHPT +E   TL
Sbjct  369  IGMAADEILQGFGVAVKMGATKADFDNCIAIHPTASEELVTL  410

>PYAR_17714
Length=444

 Score = 180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 147/475 (31%), Positives = 226/475 (48%), Gaps = 65/475 (14%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IVIGGGSGG+A ++ A+ +G KV +++  + +      GLGGTCVN GC+PKK+M  
Sbjct  7    YDYIVIGGGSGGMASARRAAVHGAKVLLIERGRAN---DGMGLGGTCVNFGCVPKKVMWN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQ----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYE  280
            ++   E + ++A  +    G +     FDW+ M    ++YI  +N  Y+  + + K+   
Sbjct  64   AASHVEHLARNAD-YSIRSGAEFQYGDFDWANMAAKRDAYILRLNGIYERNIGNAKIDLI  122

Query  281  NLLGSFV--DAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRK  338
              + S    DA T++       T     + +++AVGG P      G + AI SDD F  K
Sbjct  123  EGIASLTAKDAVTVD-----GKTXXXXGKHILVAVGGVPAMPQIPGIEHAIDSDDFFKLK  177

Query  339  EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKI  397
              P K  VVGA Y+A+E AG    +  +  +  R   +LR FD  + + +   M+    +
Sbjct  178  TQPKKVAVVGAGYIAVEIAGVFNTLKSETHLFCRYDQVLRAFDPIVRDLVNAEMDKHG-V  236

Query  398  EFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKL  457
             F+R +   +I K   G+L V+      +T    FD VL A GR+P    LGL+ VGVKL
Sbjct  237  HFVRRSRIHAIVKQPDGKLSVQATVDGVDTVLNDFDQVLFAIGREPRTKGLGLESVGVKL  296

Query  458  NPKTGRIAVTN-EQTSTPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNETALMDYDK  515
            +   G I V   E TS   +YAIGD      ELTP                         
Sbjct  297  S-DAGFIEVDKFENTSVDGVYAIGDATTTGYELTP-------------------------  330

Query  516  VCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVIC  575
                                ++EK+G +++++Y   F  L +++ +D +      +K++C
Sbjct  331  ------------------PEAVEKFGADHVKVYTSTFVNLLYAM-ADPDHKSKTAMKLVC  371

Query  576  DTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
                N+ VVG H  G  A E+ Q  G+A+K+  T     N+V IHPT AE   T+
Sbjct  372  -VGENEQVVGVHVAGEGADEMIQGFGVAIKMNATKSDFDNIVAIHPTAAEELVTM  425

>PYVX_16175
Length=446

 Score = 174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 216/459 (47%), Gaps = 65/459 (14%)

Query  181  KEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFG  240
            + A+ +G KV +++  + +      GLGGTCVN GC+PKK+M  ++   E +++      
Sbjct  23   RRAASHGAKVLLVERGRAN---DGAGLGGTCVNYGCVPKKVMFNAAAHVEHLNRAGDYSV  79

Query  241  WTVGEQTF-----DWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELW  295
             T+GE+ F     DW  M    ++YI  +N  Y+  L + K+     +   V  + LE+ 
Sbjct  80   TTLGERKFQFGDFDWLNMKTKRDAYIARLNGIYERNLGNAKIDVVQGVARVVARNQLEV-  138

Query  296  HPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALE  355
                  K  T +++++A GG P      G + AI SD  F  ++ P K  VVGA Y+A+E
Sbjct  139  ----DGKVYTGKNLLLAPGGVPTLPPIPGIEHAIDSDGFFKLEQQPRKVAVVGAGYIAVE  194

Query  356  CAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESG  414
             AG    +  +  +  R   +LR FD  + + +   ME ++ ++F+R +    I KLE G
Sbjct  195  IAGIFNVLQSETFLFCRYDQVLRTFDPIVRDLVNAEME-KNGVQFVRRSHITRIDKLEDG  253

Query  415  QLLVKWVSADGETCE-EAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV-TNEQTS  472
            +L +     DG T     FDTVL A GR+P  A LGL+ +GV L+ K G I V   E TS
Sbjct  254  KLQIT-AEVDGATQTIGGFDTVLFAIGREPRTADLGLEAIGVDLDDK-GFIKVDAQENTS  311

Query  473  TPNIYAIGDVIDAP-ELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGL  531
               +YAIGD      ELTP                                         
Sbjct  312  AAGVYAIGDATTTGWELTP-----------------------------------------  330

Query  532  SEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGP  591
                ++ KYG EN+++Y   F  L  ++ +D +  G   +K++      + VVG H  G 
Sbjct  331  --PDAVAKYGAENVKVYTSTFVNLVHAM-ADPDHKGKTAMKLVT-VGAQETVVGVHVAGE  386

Query  592  NAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
             A E+ Q  G+A+KLG T     N+V IHPT +E   T+
Sbjct  387  GADEMIQGFGVAVKLGATKADFDNIVAIHPTASEELVTM  425

>CCA22989
Length=494

 Score = 168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 140/474 (30%), Positives = 227/474 (48%), Gaps = 33/474 (7%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDLIVIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLIVIGGGPGGYVAAIKAAQLGMKTVCIE--------SRGTLGGTCLNVGCIPSKALL  77

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             SS +  T   D KA G    +   ++ +M+K+    +K +    +   +  KV Y    
Sbjct  78   HSSHMFHTAQHDFKAIGIEASDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  284  GSFV--DAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFW  336
            G+ V  D  ++      KG +T+  ++++IA G       P P+  E G + + S     
Sbjct  138  GTIVGKDQVSVSYSDESKGKETIQAKNILIATGSEVSPLPPCPVDNEKGRI-VDSTGALV  196

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMANKIGEFMETES  395
             K  P + +VVGA  + LE     + +G +V ++   + +  G D ++     EF +T  
Sbjct  197  LKSTPKEMVVVGAGVIGLELGSVYRRLGANVTVIEYLNHVCPGLDMELGR---EFAKTLQ  253

Query  396  KIEF-IRGAVPQSITKLESGQLLVKWVSADG--ETCEEAFDTVLNATGRDPDVAKLGLDK  452
            K  F  + A   + TK+   ++ +    A G  ET  E  D VL ATGR P    LGL+ 
Sbjct  254  KQGFKFKFATKVTSTKVNEDRVTITMEDAKGGNETNMEC-DVVLVATGRRPFTQNLGLEN  312

Query  453  VGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511
            +G++ + K GRI V N  +T  PNIYAIGDVI  P L   A + G + A  +   +   +
Sbjct  313  LGIQTD-KLGRIPVDNHFRTLVPNIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKQGHV  370

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYV  571
            +Y+ +   ++T  E  C G +E    E+  EE +  Y+    P+  +  +        +V
Sbjct  371  NYNAIPGVIYTFPEVACVGRTE----EQLKEEGVS-YNVGKFPMIANSRARAVGETDGFV  425

Query  572  KVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
            KV+   K N  ++G H +  NAGE+     L ++ G + + +      HPT +E
Sbjct  426  KVLAQ-KDNDRILGIHLMTSNAGEMIAEGVLGIEYGASSEDIGRTCHAHPTLSE  478

>CCI10477
Length=494

 Score = 165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 229/474 (48%), Gaps = 33/474 (7%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDL+VIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  26   EYDLVVIGGGPGGYVAAIKAAQLGMKTACIE--------SRGSLGGTCLNVGCIPSKALL  77

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             SS +  T   D K+ G  V +   ++ +M+K+    +K +    +   +  KV Y    
Sbjct  78   HSSHLFHTAQHDFKSIGIEVSDLRLNFGKMMKAKEKSVKVLTSGIEGLFKKNKVAYIKGH  137

Query  284  GSFVDAH--TLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFW  336
            G  V  +  ++ L    KG +T+T ++++IA G       P P+  E G + + S     
Sbjct  138  GKIVAKNQVSVALSDESKGNETITAKNILIATGSEVSPLPPCPVDNEKGKI-VDSTGALV  196

Query  337  RKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMANKIGEFMETES  395
             K  P + +VVGA  + LE     + +G +V ++   + +  G D ++  +  + ++ + 
Sbjct  197  LKSIPKEMVVVGAGVIGLELGSVYRRLGANVTVVEYLNHVCPGLDMELGREFAKTLQKQG  256

Query  396  -KIEFIRGAVPQSITKLESGQLLVKWVSADG--ETCEEAFDTVLNATGRDPDVAKLGLDK  452
             K +F   A   + TK+    + +    A G  ET  E  D VL ATGR P    LGL+ 
Sbjct  257  LKFKF---ATRVTSTKVNGDNVTITMEDAKGGNETSMEC-DVVLVATGRRPFTNGLGLES  312

Query  453  VGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALM  511
            +G++ + K GRI V +  +T+ P+IYAIGDVI  P L   A + G + A  +   +   +
Sbjct  313  MGIQTD-KMGRIQVDDHFRTAIPSIYAIGDVIAGPMLAHKAEEEG-IAAVEIMLGKHGHV  370

Query  512  DYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYV  571
            +Y+ +   ++T  E  C G +E    E+  EE +  Y+    P+  +  +        +V
Sbjct  371  NYNAIPGVIYTHPEVACVGKTE----EQLKEEGIS-YNVGKFPMIANSRARAVGETDGFV  425

Query  572  KVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
            KV+   K N  ++G H +  NAGE+     L ++ G   + +      HPT +E
Sbjct  426  KVLAQ-KDNDRILGIHIMTSNAGEMIAEGVLGLEYGAASEDIGRTCHAHPTLSE  478

>PYIR_20273
Length=505

 Score = 160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 137/479 (29%), Positives = 218/479 (46%), Gaps = 35/479 (7%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKK-LM  222
            +YDL+VIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K L+
Sbjct  33   EYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALL  84

Query  223  HQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENL  282
            H + L     H  AK +G  V E + ++ +M+KS    +K++    +   +  KV Y   
Sbjct  85   HSTHLYHSAQHDFAK-YGIEVSEVSMNFGKMMKSKEKAVKTLTGGIEQLFKKNKVTYIKG  143

Query  283  LGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFWR  337
             G  V  + + +     G +TVT ++++IA G       P P+    G + + S      
Sbjct  144  HGKIVAKNEVAVALNDSGNQTVTAKNILIATGSEVSPLPPVPVDNAAGKI-VDSTGALEL  202

Query  338  KEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLR---GFDQDMANKIGEFMETE  394
            K+ P   +VVGA  + LE     K +G   K+ V   L R   G D ++  +  + ++ +
Sbjct  203  KKVPEHLVVVGAGVIGLELGSVYKRLG--AKVTVVEYLDRVCPGLDLELGKEFTKLLKKQ  260

Query  395  S-KIEFIRGAVPQSIT----KLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLG  449
                EF        +      L           A G       D VL ATGR P    LG
Sbjct  261  GLGFEFSTKVTASEVNGEKITLTXXXXXXXXXXAGGAASTIECDAVLVATGRRPYTNGLG  320

Query  450  LDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNET  508
            L+ +G++ + K GRI+V +  +T  PNI+AIGDVI  P L   A + G   A  +     
Sbjct  321  LENMGIQTD-KFGRISVDDHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACAETIAGKH-  378

Query  509  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGS  568
              ++Y+ +   ++T  E    G +E    E+  EE +  Y+    P+  +  +       
Sbjct  379  GHVNYNAIPGVIYTFPEVASVGKTE----EQLKEEGV-TYNVGKFPMLANSRARAVGEAD  433

Query  569  CYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
              VKVI D   +K ++G H +  NAGE+     L M+ G + + +      HPT +E F
Sbjct  434  GLVKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGASSEDIARTCHAHPTLSEAF  491

>PYU1_G001737
Length=133

 Score = 146 bits (368),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 4/127 (3%)

Query  13   GRKREARSGELMTRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVD  72
            GRKR A +  LM   N+++TLV  G  T YH+AGWRGC F++KA DV +AM+VLYPD + 
Sbjct  11   GRKRHASN--LMASVNLQDTLVRAGSGTTYHIAGWRGCSFFQKACDVGSAMQVLYPDHLQ  68

Query  73   FELHEFPDREAFREWLAASSTIEELTECFGADSKALTHKSSPFVWANTRGFIGGCDDTLA  132
            F +HEF DR+AFR WL  S   ++    FGA S ALTH SSPFVW+N   F+GGCD  LA
Sbjct  69   FTVHEFADRDAFRAWLDVSK--DDFATHFGATSPALTHTSSPFVWSNAGEFVGGCDALLA  126

Query  133  LFRSGVS  139
              R  +S
Sbjct  127  TIRGSIS  133

>PYAP_22645
Length=1565

 Score = 160 bits (406),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 133/471 (28%), Positives = 218/471 (46%), Gaps = 25/471 (5%)

Query  164   DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
             +YDL+VIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  1099  EYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGSLGGTCLNVGCIPSKALL  1150

Query  224   QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
              ++ +      D   +G  V +   ++  M+KS    +K++    +   +  KV Y    
Sbjct  1151  HATHMYHAAQHDFSKYGIEVSDVKMNFDGMMKSKEKAVKTLTGGIEGLFKKNKVTYVKGF  1210

Query  284   GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLA----ISSDDIFWRKE  339
             G  V A+ + +     G +T+  ++++IA G    PL     D A    + S      K+
Sbjct  1211  GKIVSANEVSVALNDAGNETLKAKNILIATGSEVAPLPPVPVDNAAGKIVDSTGALELKK  1270

Query  340   APGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMANKIGEFMETES-KI  397
              P   +V+G   + LE     K +G  V ++     +  G DQ++  +  + ++ +  + 
Sbjct  1271  VPEHLVVIGGGVIGLELGSVYKRLGAKVTVVEYADRVAPGLDQELGKEFTKLLKKQGLQF  1330

Query  398   EFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKL  457
             EF    V  S    +   L V+  +    +  EA DTVL ATGR P    LGL+++G++ 
Sbjct  1331  EF-STKVTASEVNGDKVTLTVEPAAGGASSTIEA-DTVLVATGRRPFTKGLGLEQMGIQT  1388

Query  458   NPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKV  516
             + K GRI V N  +T  PNI+AIGDVI  P L   A + G      +       ++YD +
Sbjct  1389  D-KLGRIQVDNHFRTQIPNIFAIGDVIAGPMLAHKAEEEGIACVENIAGLH-GHVNYDAI  1446

Query  517   CTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICD  576
                ++T  E    G +E    E+  EE +  Y+    P+  +  +   A    +VKVI D
Sbjct  1447  PGVIYTYPEVASVGKTE----EQLKEEGV-AYNVGKFPMMANSRARAVAESDGFVKVIAD  1501

Query  577   TKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
              K    ++G H +  NAGE+     L M+ G   + +      HPT +E F
Sbjct  1502  -KTTDRILGIHIIASNAGEMISEGVLGMEYGAASEDIGRTCHAHPTLSEAF  1551

>HYAP_12621
Length=501

 Score = 146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 130/479 (27%), Positives = 219/479 (46%), Gaps = 40/479 (8%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+VIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             S+ +  T   + K++G      T ++ QM+K+    ++++    +      KV Y   +
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGV  145

Query  284  GSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFWR  337
            G       + +    ++G  T+T +++++A G       P P+  + G + + S      
Sbjct  146  GKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGALAL  204

Query  338  KEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGFDQDMANKIGEFMETESK  396
               P   +VVGA  + LE     K +G  V ++        G D+     + EF++   K
Sbjct  205  TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDSACSGMDK---GAVKEFLKLLKK  261

Query  397  --IEFIRGAVPQSITKLESGQLLVKWVS-----ADGETCEEAFDTVLNATGRDPDVAKLG  449
              +EF  G     +T  E    +V   +      DG T +   DTVL ATGR    A LG
Sbjct  262  QGLEFQFGT---KVTASEVNGDVVTLTTEPANGGDGSTIK--CDTVLVATGRRAFTAGLG  316

Query  450  LDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNET  508
            L+++G++ + K GRI V +  QT  P ++AIGDVI    L   A + G      +     
Sbjct  317  LEQMGIQTD-KQGRIEVDHAFQTQVPGVFAIGDVIKGTMLAHKAEEEGIACVENIAGKH-  374

Query  509  ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGS  568
              ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+  +  +   A   
Sbjct  375  GHVNYGAIPNVIYTFPEFASVGKTE----EELKAEGVE-YNVGKFPMMANSRARTVAEAD  429

Query  569  CYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
              VKV+ D K +K ++G H +  NAGE+     + ++ G   + +      HPT +E F
Sbjct  430  GMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  487

>PHYSO_556052
Length=500

 Score = 137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 120/432 (28%), Positives = 198/432 (46%), Gaps = 24/432 (6%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G    E   ++ QM+K+    +K++  
Sbjct  68   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVKTLTG  127

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  128  GIESLFKKNKVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  187

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
              E G + I S      K  P   +VVGA  + LE     K +G  V ++  +     G 
Sbjct  188  DNEAGKI-IDSTGALSLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  246

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV---SADGETCEEAFDTVL  436
            D++   +  + ++ +  +EF  G     +T  E    +VK     S  G+      DTVL
Sbjct  247  DKESVKEFTKLLKKQG-LEFQFGT---KVTASEVNGDVVKLTTEPSKGGDASTIECDTVL  302

Query  437  NATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQA  495
             ATGR    A LGL+++G++ + K GRI V +  +T  P I+AIGDVI    L   A + 
Sbjct  303  VATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  361

Query  496  GRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
            G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+
Sbjct  362  GVACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  415

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              +  +   A     VKV+ D K +K ++G H +  NAGE+     + ++ G   + +  
Sbjct  416  MANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGVIGIEYGAASEDLAR  474

Query  616  VVGIHPTTAEIF  627
                HPT +E F
Sbjct  475  TCHAHPTLSEAF  486

>SPRG_19943
Length=343

 Score = 133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/238 (37%), Positives = 126/238 (53%), Gaps = 16/238 (7%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD IV+G GSGG++ +  A  YG KV V++           GLGGTCVNVGC+PKK+M  
Sbjct  21   YDYIVLGAGSGGVSSAHRAVAYGAKVLVIER---GHANDGAGLGGTCVNVGCVPKKIMFN  77

Query  225  SSLIGETIHKDAKAFGWTVGEQ-----TFDWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++L  E +H  A+A+ +  G Q      FDW+ M    ++Y+K +N  Y   + + KV  
Sbjct  78   AALHAEMLHS-ARAYAFK-GVQDIQFGAFDWAAMKAKRDAYVKWLNDMYGEGMLEDKVDL  135

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
                  FVD HT+E+     G +  T + ++IAVGG P      G + AISSD  F  + 
Sbjct  136  VMGAAKFVDNHTVEV----NGDR-YTAKHILIAVGGVPAMPPLPGIEHAISSDGFFALET  190

Query  340  APGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFDQDMANKIGEFMETESK  396
             P K  VVGA Y+A+E AG    +  D  +  R + +LR FD  + + +   ME   K
Sbjct  191  QPRKVAVVGAGYIAVELAGIFNALKSDTTLFCRGNQVLRTFDPIVRDLVNSEMEHAGK  248

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 44/86 (51%), Gaps = 6/86 (7%)

Query  550  QNFTPLEWSL-SSDREAAG----SCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAM  604
            + F P+   L +S+ E AG       +K++C     + VVG H  G  A E+ Q  G+A+
Sbjct  229  RTFDPIVRDLVNSEMEHAGKEKVQTAMKLVC-IGVEETVVGVHVAGLGADEMIQGFGVAV  287

Query  605  KLGFTYDQMVNVVGIHPTTAEIFTTL  630
            K+G       N+V IHPT +E   T+
Sbjct  288  KMGAYKSDFDNIVAIHPTASEELVTM  313

>PYVX_21248
Length=502

 Score = 134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 126/443 (28%), Positives = 207/443 (47%), Gaps = 24/443 (5%)

Query  196  VKPSPVGTSWGLGGTCVNVGCIPKK-LMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQML  254
            +K + V +   LGGTC+NVGCIP K L+H + L     H  AK +G  V     +   M+
Sbjct  59   LKTACVESRGKLGGTCLNVGCIPSKALLHSTHLYHSAQHDFAK-YGVEVEGVKANLGGMM  117

Query  255  KSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAV  313
            K+    + ++    +   +  KV Y    G  V  + + +  +  KG +TVT ++++IA 
Sbjct  118  KAKEKAVTTLTGGIESLFKKNKVTYIKGHGKIVGKNEVAVALNDDKGNQTVTAKNIMIAT  177

Query  314  GGRPKPLSCEGGDLA----ISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKI  369
            G  P PL     D +    + S       + P   +VVGA  + LE     K +G   K+
Sbjct  178  GSEPAPLPPVPVDNSKFKIVDSTGALSLPKIPEHLVVVGAGVIGLELGSVYKRLGS--KV  235

Query  370  MVRSILLR---GFDQDMANKIGEFMETESKIEF-IRGAVPQSITKLESGQLLVKWVSADG  425
             V   L R   G D +++ +  + ++ +  +EF     V  S  K ++  L V+  SA G
Sbjct  236  TVVEFLDRACPGLDLEVSKEFTKLLKKQG-LEFQFSTKVTASEVKGDNVTLTVEP-SAGG  293

Query  426  ETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVID  484
                   DTVL ATGR P    LGL+++G++ + K GR+ V +  +T  PNIYA GDVI 
Sbjct  294  SAASIECDTVLVATGRRPFTEGLGLEQMGIQTD-KQGRVEVDSHFRTQIPNIYAFGDVIK  352

Query  485  APELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEEN  544
               L   A + G   A  + + +   ++YD +   ++T  E    G +E    E+   E 
Sbjct  353  GAMLAHKAEEEGVACA-EIISGKHGHVNYDAIPGVIYTTPEVASVGKTE----EELKNEG  407

Query  545  LEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAM  604
            +  Y+    P+  +  +   A    +VK++ D K    ++G H +  NAGE+     L +
Sbjct  408  V-TYNVGKFPMMANSRARTIAEADGFVKILAD-KATDRILGVHIIAGNAGEMVAEGVLGL  465

Query  605  KLGFTYDQMVNVVGIHPTTAEIF  627
            + G + + +      HPT +E F
Sbjct  466  EYGASSEDIARTCHAHPTLSEAF  488

>PHYKE_9680
Length=498

 Score = 133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 117/430 (27%), Positives = 200/430 (47%), Gaps = 24/430 (6%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G        ++ QM+K+    +K++  
Sbjct  66   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVKANFPQMMKAKEKAVKTLTG  125

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              ++  +  KV Y    G       + +     KG +TV  ++++IA G       P P+
Sbjct  126  GIEMLFKKNKVTYIKGFGKVSAQGEVSVALTDNKGNETVKAKNIIIATGSEVTPLPPVPV  185

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
              E G + I S      K  P   +VVGA  + LE     K +G  V ++  +     G 
Sbjct  186  DNEAGKI-IDSTGALVLKRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  244

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAF---DTVL  436
            D++   +  + ++ +  ++F  G     +T  E    +VK  +   +  +EA    DTVL
Sbjct  245  DKECVKEFTKLLKKQG-LDFKFGT---KVTASEVNGDVVKLTTEAAKGGDEASIECDTVL  300

Query  437  NATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQA  495
             ATGR    A LGL+++G++ + K GR+ V +  +T  P I+AIGDVI    L   A + 
Sbjct  301  VATGRRAYTAGLGLEQMGIQTD-KLGRVEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  359

Query  496  GRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
            G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+
Sbjct  360  GIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  413

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              +  +   A     VKV+ D K +K ++G H +  NAGE+     +A++ G + + +  
Sbjct  414  MANSRARTVAEADGLVKVLSDKKTDK-MLGVHIIASNAGEMIAEGVIALEYGASSEDIAR  472

Query  616  VVGIHPTTAE  625
                HPT +E
Sbjct  473  TCHAHPTLSE  482

>PYAR_20075
Length=469

 Score = 130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 116/440 (26%), Positives = 192/440 (44%), Gaps = 46/440 (10%)

Query  196  VKPSPVGTSWGLGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLK  255
            +K + + +   LGGTC+NVGCIP K +  S+ +  T   D K +G  V +   D+  M+K
Sbjct  54   LKTACIESRGSLGGTCLNVGCIPSKALLHSTHLFHTAQHDFKKYGIEVSDVQMDFGGMMK  113

Query  256  SVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGG  315
            S    +K++    +   +  KV Y    G                 K V   +V +A+  
Sbjct  114  SKEKAVKTLTAGIESLFKKNKVTYIKGFG-----------------KIVAANEVAVALND  156

Query  316  RPKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSI  374
                    G +  + S      K+AP   +V+G   + LE     K +G  V ++     
Sbjct  157  N------NGNETIVDSTGALALKKAPEHLVVIGGGVIGLELGSVYKRLGSKVTVVEYADR  210

Query  375  LLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQL------LVKWVSADGETC  428
            +  G D ++  +  + ++ +       G   Q  TK+ + Q+      L    +A GE  
Sbjct  211  VCPGLDLELGKEFAKLLKKQ-------GLDLQFKTKVTASQVNGDKVTLTVEPAAGGEAT  263

Query  429  EEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPE  487
                DTVL ATGR P    LGL+++G++ + K GRI V    +T  P+IYAIGDVI  P 
Sbjct  264  TIEADTVLVATGRRPFTNGLGLEQMGIQTD-KMGRIQVDEHFRTQIPSIYAIGDVIAGPM  322

Query  488  LTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEI  547
            L   A + G      +       ++Y+ +   ++T  E    G +E    E+  EE +  
Sbjct  323  LAHKAEEEGIACVENIAGLH-GHVNYNAIPGVIYTHPEVASVGKTE----EQLKEEGIA-  376

Query  548  YHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLG  607
            Y+    P+  +  +     G  +VKV+ D   +K ++G H +  NAGE+     L ++ G
Sbjct  377  YNVGKFPMMANSRARAVGEGDGFVKVLADKTTDK-ILGIHIIASNAGEMISEGVLGIEYG  435

Query  608  FTYDQMVNVVGIHPTTAEIF  627
               + +      HPT +E F
Sbjct  436  AASEDIGRTCHAHPTLSEAF  455

>PHALS_09942
Length=496

 Score = 130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 118/432 (27%), Positives = 195/432 (45%), Gaps = 24/432 (6%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   + K +G    E T ++ QM+K+ +  +K++  
Sbjct  64   LGGTCLNVGCIPSKALLHSTHLLHTAQHEFKNYGIDAPEVTANFPQMMKAKDKAVKTLTS  123

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              +   +  KV Y    G       + +  H  KG +TV  ++++IA G       P P+
Sbjct  124  GIESLFKKNKVTYIKGSGKISAQGEVSVALHDHKGNETVKAKNIIIATGSEVTPLPPVPV  183

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
                G + + S      K  P   +VVGA  + LE     K +G  V ++        G 
Sbjct  184  DNAAGKI-VDSTGALELKRIPDHLVVVGAGVIGLELGSVYKRLGAKVTVVEYLDDACTGM  242

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV---SADGETCEEAFDTVL  436
            D+       + ++ +  +EF  G     +T  E    +VK     S  G+      DTVL
Sbjct  243  DKGSVKDFIKLLKKQG-LEFKFGT---KVTASEINGDVVKLTTEPSQGGDAASIECDTVL  298

Query  437  NATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQA  495
             ATGR    A LGL+++G++ + K GRI V    +T  P I+AIGDVI    L   A + 
Sbjct  299  VATGRRAFTAGLGLEQMGIQTD-KFGRIEVDEAFRTQVPGIFAIGDVIKGAMLAHKAEEE  357

Query  496  GRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
            G +    +   +   ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+
Sbjct  358  G-IACAEIIAGKHGHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  411

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              +  +         VKV+ D K +K ++G H +  NAGE+     + ++ G   + +  
Sbjct  412  MANSRARTVGESDGMVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDVAR  470

Query  616  VVGIHPTTAEIF  627
                HPT +E F
Sbjct  471  TSHAHPTLSEAF  482

>PYU1_G014259
Length=244

 Score = 124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 119/217 (55%), Gaps = 22/217 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKY-GKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLM  222
            +YD +VIG GSGG+A S+ A+ Y   +V V++  +         LGGTCVNVGC+PKK+M
Sbjct  34   EYDYLVIGAGSGGMASSRRAASYPNTRVAVVEKAR---------LGGTCVNVGCVPKKIM  84

Query  223  HQSSLIGETIHKDAKAFGW------TVGEQ-TFDWSQMLKSVNSYIKSINFKYKVELRDK  275
            + ++ +   +H+DA  +G+       +GE  +F W+++ +  ++Y+  +N  Y+  L + 
Sbjct  85   YLAADMNHMLHRDAFHYGFETQDGKRIGENVSFHWNKLKERRDAYVLRLNGIYERNLANS  144

Query  276  KVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIF  335
            KV       +F     +E+       K V  ++++IAVGG+P      G +  I SD  F
Sbjct  145  KVDLLQGTAAFNAQGNVEV-----DGKEVKAKNILIAVGGKPLIPDIPGKEHCIDSDGFF  199

Query  336  WRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVR  372
              +  P K  VVGA Y+A+E AG + G+G D  I  R
Sbjct  200  ELEVLPKKVAVVGAGYIAVELAGVLNGLGSDTTIFCR  236

>PHYRA_72215
Length=499

 Score = 129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 116/432 (27%), Positives = 196/432 (45%), Gaps = 24/432 (6%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G      T ++ QM+K+    + ++  
Sbjct  67   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPGVTANFPQMMKAKEKAVTTLTG  126

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  127  GIESLFKKNKVTYIKGYGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  186

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
                G + I S         P   +VVGA  + LE     K +G  V ++  +     G 
Sbjct  187  DNAAGKI-IDSTGALALTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEFQDAACPGM  245

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVS---ADGETCEEAFDTVL  436
            D++   +  + ++ +  ++F  G     +T  E    +VK  +     G       DTVL
Sbjct  246  DKEAVKEFTKLLKKQG-LDFKFG---TKVTASEVNGDVVKLTTEAAKGGNAATIECDTVL  301

Query  437  NATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQA  495
             ATGR    A LGL+++G++ + K GRI V +  +T  P I+AIGDVI    L   A + 
Sbjct  302  VATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  360

Query  496  GRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
            G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+
Sbjct  361  GIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFPM  414

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              +  +   A     VKV+ D K +K ++G H +  NAGE+     +A++ G + + +  
Sbjct  415  MANSRARTVAEADGLVKVLADKKTDK-MLGVHIIASNAGEMISEGVIALEYGASSEDIAR  473

Query  616  VVGIHPTTAEIF  627
                HPT +E F
Sbjct  474  TCHAHPTLSEAF  485

>PITG_15359
Length=496

 Score = 129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 117/435 (27%), Positives = 197/435 (45%), Gaps = 30/435 (7%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G    E   ++ QM+KS    +K++  
Sbjct  64   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTG  123

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  124  GIESLFKKNKVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  183

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
                G + I S      K  P   +VVGA  + LE     K +G  V ++        G 
Sbjct  184  DNAAGKI-IDSTGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVVEFLDAACPGS  242

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQL------LVKWVSADGETCEEAFD  433
            D++   +  + ++ +  ++F      Q  TK+ + ++      L    S  G+      D
Sbjct  243  DKEAVKEFTKLLKKQG-LDF------QFNTKVTASEVNGDVVKLTTEPSKGGDASSIECD  295

Query  434  TVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVA  492
            TVL ATGR    + LGL+++G++ + K GRI V +  +T  P I+AIGDVI    L   A
Sbjct  296  TVLVATGRRAFTSGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKA  354

Query  493  IQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNF  552
             + G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+   
Sbjct  355  EEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGK  408

Query  553  TPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQ  612
             P+  +  +   A     VKV+ D K +K ++G H +  NAGE+     + ++ G   + 
Sbjct  409  FPMMANSRARTIAEADGLVKVLADKKTDK-LLGVHIIAGNAGEMIAEGVIGIEYGAASED  467

Query  613  MVNVVGIHPTTAEIF  627
            +      HPT +E F
Sbjct  468  LARTCHAHPTLSEAF  482

>PHYCA_123621
Length=495

 Score = 126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 115/432 (27%), Positives = 192/432 (44%), Gaps = 24/432 (6%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G    E   ++ QM+K+    + ++  
Sbjct  63   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKAKEKAVTTLTG  122

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              +   +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  123  GIESLFKKNKVTYIKGFGKVSAQGEVSVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  182

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIM-VRSILLRGF  379
                G + I S         P   +VVGA  + LE     K +G  V ++        G 
Sbjct  183  DNAAGKI-IDSTGALSLTRVPEHLVVVGAGVIGLELGSVYKRLGSKVTVVEYLDAACPGM  241

Query  380  DQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV---SADGETCEEAFDTVL  436
            D+    +  + ++ +  ++F        +T  E    +VK     S  G+      DTVL
Sbjct  242  DKGAVKEFTKLLKKQG-LDF---KFSTKVTASEVNGDVVKLTTEPSKGGDASSIECDTVL  297

Query  437  NATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQA  495
             ATGR    A LGL+++G++ + K GRI V +  +T  P I+AIGDVI    L   A + 
Sbjct  298  VATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEEE  356

Query  496  GRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
            G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+    P+
Sbjct  357  GIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGVE-YNVGKFPM  410

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
              +  +   A     VKV+ D K +K ++G H +  NAGE+     + ++ G   + +  
Sbjct  411  MANSRARTVAEADGLVKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLAR  469

Query  616  VVGIHPTTAEIF  627
                HPT +E F
Sbjct  470  TCHAHPTLSEAF  481

>SPRG_09825
Length=492

 Score = 123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 129/482 (27%), Positives = 220/482 (46%), Gaps = 46/482 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+V+GGG GG   + +A++ G        +K + V +   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSKALL  76

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             ++        D K  G  V     D+++++ S +  +K +    +   +  KV Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKVDYIKGF  136

Query  284  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFWRK  338
            G  V  + + +   + G KTV+T++++IA G       P P+  E G + I S      K
Sbjct  137  GKIVAKNQVSVALNEGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALSLK  195

Query  339  EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIE  398
              P   +V+G   + LE       +G  + ++           + A+KI   M+ E+  E
Sbjct  196  RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETGRE  244

Query  399  FIRGAVPQSI----------TKLESGQL-LVKWVSADGETCEEAFDTVLNATGRDPDVAK  447
            F +    Q +          +K+E  ++ L    +A GE      DTVL ATGR P    
Sbjct  245  FQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFTKG  304

Query  448  LGLDKVGVKLNPKTGRIAV--TNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYN  505
            LGL+++G++ + K GRI V  +N +T+  NI+AIGD I+   L   A + G      +  
Sbjct  305  LGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAG  363

Query  506  NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREA  565
                 ++Y+ +   V+T  E    G +E    E+    N+  Y+    P+  +  +    
Sbjct  364  GH-GHVNYNAIPGVVYTFPEVASVGKTE----EELKAANVA-YNVGKFPMMANSRARTVG  417

Query  566  AGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
                +VK++   K +  ++G H +  NAGE+     L ++ G + + +      HPT +E
Sbjct  418  ETDGFVKILA-AKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSE  476

Query  626  IF  627
             F
Sbjct  477  AF  478

>H257_16541
Length=494

 Score = 123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 126/453 (28%), Positives = 202/453 (45%), Gaps = 44/453 (10%)

Query  196  VKPSPVGTSWGLGGTCVNVGCIPKK-LMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQML  254
            +K + + +   LGGTC+NVGCIP K L+H + L     H + K+ G  V   + D+ Q++
Sbjct  51   LKTACIESRGSLGGTCLNVGCIPSKALLHGTHLYHSAQH-NFKSVGIKVDNVSIDFDQLM  109

Query  255  KSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVG  314
            KS +  +K +    +   +  KV Y    G  V    + +     G +TV T++++IA G
Sbjct  110  KSKDKTVKILTGGIEGLFKKNKVDYIKGYGKVVAKGQVSVALNAGGNQTVNTKNILIATG  169

Query  315  GR-----PKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKI  369
                   P P+  EGG + I S      K  P   +VVG   + LE       +G  + +
Sbjct  170  SEVTPLPPVPVDNEGGKI-IDSTGALALKRVPKHLVVVGGGVIGLEMGSVYGRLGSKITV  228

Query  370  MVRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSIT-----KLESGQL------LV  418
            +           + A+KI   M+ E   EF +    Q +T     K+ + ++      L 
Sbjct  229  V-----------EYADKICPTMDHEVTKEFQKLLTKQGMTFKLGQKVTASKVDGDVVTLT  277

Query  419  KWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV--TNEQTSTPNI  476
               +A GE      D VL ATGR P  A LGL+++G++ + K GRI V  +N QT+   I
Sbjct  278  VEPAAGGEATTIEADCVLVATGRRPFTAGLGLEEMGIQTD-KFGRIKVNLSNFQTNVDGI  336

Query  477  YAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEAS  536
            +AIGDVI+   L   A + G  +   +       ++YD +   ++T  E    G +EE  
Sbjct  337  FAIGDVIEGAMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEE--  393

Query  537  IEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC--YVKVICDTKRNKHVVGFHYLGPNAG  594
                 E        N        +S   A G    +VKV+   K +  ++G H +  NAG
Sbjct  394  -----ELKTANVAYNVGKFPMMANSRARAVGETDGFVKVLA-AKDDDKILGIHIIASNAG  447

Query  595  EVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            E+     L ++ G + + +      HPT +E F
Sbjct  448  EMISEGVLGIEYGASAEDIGRTCHAHPTLSEAF  480

>H310_02523
Length=494

 Score = 123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 127/444 (29%), Positives = 196/444 (44%), Gaps = 48/444 (11%)

Query  207  LGGTCVNVGCIPKK-LMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSIN  265
            LGGTC+NVGCIP K L+H + L     H D K+ G  V   + D++Q++KS    +K + 
Sbjct  62   LGGTCLNVGCIPSKALLHGTHLYHAAQH-DFKSVGIKVDNVSIDFNQLMKSKEKTVKILT  120

Query  266  FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
               +   +  KV Y    G  V    L +     G +T+ T++++IA G       P P+
Sbjct  121  GGIEGLFKKNKVDYVKGFGKIVAKGQLSVALNGGGNQTLHTKNILIATGSEVTPLPPVPV  180

Query  321  SCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFD  380
              EGG + + S      K  P   +VVG   + LE       +G  + ++          
Sbjct  181  DNEGGKI-VDSTGALSLKRIPNHLVVVGGGVIGLEMGSVYGRLGSKITVV----------  229

Query  381  QDMANKIGEFMETESKIEFIRGAVPQSITKLESGQ-------------LLVKWVSADGET  427
             + A+KI   M+ E   EF +    Q +T  + GQ             L V+  +    T
Sbjct  230  -EYADKICPTMDHELTKEFQKLLTKQGMT-FKLGQKVTASKVDGDTVTLTVEPAAGGDAT  287

Query  428  CEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV--TNEQTSTPNIYAIGDVIDA  485
              EA D VL ATGR P  A LGL+ +G++ + + GRI V  +N QT+   IYAIGDVI+ 
Sbjct  288  TIEA-DCVLVATGRRPYTAGLGLEDMGIQTD-RFGRIKVNLSNFQTNVDGIYAIGDVIEG  345

Query  486  PELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENL  545
              L   A + G  +   +       ++YD +   ++T  E    G +EE       E   
Sbjct  346  AMLAHKAEEEGIAVVETIAGKH-GHVNYDAIPGVIYTFPEVASVGKTEE-------ELKA  397

Query  546  EIYHQNFTPLEWSLSSDREAAGSC--YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLA  603
                 N        +S   A G    +VKV+   K +  ++G H +  NAGE+     L 
Sbjct  398  ANVAYNVGKFPMMANSRARAVGETDGFVKVLA-AKDDDKILGIHIIASNAGEMISEGVLG  456

Query  604  MKLGFTYDQMVNVVGIHPTTAEIF  627
            ++ G + + +      HPT +E F
Sbjct  457  IEYGASAEDIGRTCHAHPTLSEAF  480

>SDRG_06945
Length=492

 Score = 122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 128/482 (27%), Positives = 219/482 (45%), Gaps = 46/482 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+V+GGG GG   + +A++ G        +K + V +   LGGTC+NVGCIP K + 
Sbjct  25   DYDLVVVGGGPGGYVAAIKAAQLG--------LKTACVESRGTLGGTCLNVGCIPSKALL  76

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             ++        D K  G  V     D+++++ S +  +K +    +   +  K+ Y    
Sbjct  77   SATHKYHAAQHDFKNVGIEVDGLRIDFAKLMASKDKSVKILTGGIEGLFKKNKIDYIKGF  136

Query  284  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFWRK  338
            G  V  + + +     G KTV+T++++IA G       P P+  E G + I S      K
Sbjct  137  GKIVAKNQVSVALNDGGNKTVSTKNILIATGSEVTPLPPVPVDNEAGKI-IDSTGALSLK  195

Query  339  EAPGKTLVVGASYVALECAGFMKGMGYDVKIMVRSILLRGFDQDMANKIGEFMETESKIE  398
              P   +V+G   + LE       +G  + ++           + A+KI   M+ E+  E
Sbjct  196  RIPEHLVVIGGGVIGLEMGSVYGRLGAKITVV-----------EYADKICPTMDFETGRE  244

Query  399  FIRGAVPQSI----------TKLESGQL-LVKWVSADGETCEEAFDTVLNATGRDPDVAK  447
            F +    Q +          +K+E  ++ L    +A GE      DTVL ATGR P    
Sbjct  245  FQKLLKKQGMNFQLGQKVTASKVEGDKVTLTVEPAAGGEATTIECDTVLVATGRRPFTKG  304

Query  448  LGLDKVGVKLNPKTGRIAV--TNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYN  505
            LGL+++G++ + K GRI V  +N +T+  NI+AIGD I+   L   A + G      +  
Sbjct  305  LGLEEMGIQTD-KFGRIQVDLSNFKTNVDNIFAIGDCIEGAMLAHKAEEEGISCVESIAG  363

Query  506  NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREA  565
                 ++Y+ +   V+T  E    G +EE  ++  G      Y+    P+  +  +    
Sbjct  364  GH-GHVNYNAIPGVVYTFPEVASVGKTEE-ELKAAGVA----YNVGKFPMMANSRARTVG  417

Query  566  AGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
                +VK++   K +  ++G H +  NAGE+     L ++ G + + +      HPT +E
Sbjct  418  ETDGFVKILA-AKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSE  476

Query  626  IF  627
             F
Sbjct  477  AF  478

>H257_01186
Length=496

 Score = 121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 129/482 (27%), Positives = 221/482 (46%), Gaps = 46/482 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDLIVIG G  GL C+ E++K GK V ++D         S  +GG CV+ G IP K   
Sbjct  28   EYDLIVIGSGPSGLQCALESAKMGKSVAIID--------KSEEIGGVCVHTGTIPSKTFR  79

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ L     +     +G +   +    S +L  VN  + S     + +L+   V+     
Sbjct  80   EAVLHLSGFNHHG-FYGKSYSRERITLSDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGK  138

Query  284  GSFVDAHTLELWHPKKGTKTVTTR--DVVIAVGGRP--KPLSCEGGDLAISSDDIF--WR  337
              F +A+ + + +     + +  R    +IA G  P   P+    G++ + SD I    +
Sbjct  139  ARFENANEVSVENGTVHREAMIYRGKKFLIACGTYPAHSPVVPVDGEVILDSDGILEASK  198

Query  338  KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETES  395
             E P   +VVGA  + +E A  +  + G  V ++  R  +L   D ++ + +   ME   
Sbjct  199  GELPKSWIVVGAGVIGMEYASMLNVLPGVAVTVVDGRPDILTFCDDEIVSALK--MEMRH  256

Query  396  K-IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAF-DTVLNATGRDPDVAKLGLDKV  453
            K   F+ G   QS+T++  G      V  D  + + +F + +L   GR  +   L L+ V
Sbjct  257  KGARFLLGETIQSVTRVAKG------VRVDFASGKSSFAEALLYCVGRQANTDALNLEGV  310

Query  454  GVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNE---TA  509
            G+  N K G + V  + QTS P+IYA GD I AP L   +++ GRL A  ++++E   T+
Sbjct  311  GLAKN-KRGLLTVNKQYQTSQPHIYAAGDCIGAPSLASTSLEQGRLAACDMWHHEDQPTS  369

Query  510  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC  569
             +D       ++T  E    G +E+  + K G  N  +    ++ L   + +  +     
Sbjct  370  QLDSGNYPYGIYTIPEISMVGKTEQ-QLTKEG-RNYAVGMAKYSELAKGMMAGGQKGA--  425

Query  570  YVKVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DQMVNVVGIHPTTAE  625
             +K++ D    + V+G H +G  A E+     + +AM    TY  D + N    +PT AE
Sbjct  426  -LKILFDPD-TQSVLGVHAIGQGATEIIHIGQVAMAMNCKITYFRDAVFN----YPTLAE  479

Query  626  IF  627
             +
Sbjct  480  AY  481

>CCA16670
Length=520

 Score = 121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 221/485 (46%), Gaps = 46/485 (9%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDLIVIG G     C+ +A+K GK V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSASNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  225  SSL-IGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKS-INFKYKVELRDKKVKYENL  282
            + L +    H       +++   T D   +L  VN  I+S ++F  + + +  ++ Y + 
Sbjct  82   AVLHLSGYRHHGFYGKSYSMKHVTID--DILYRVNRVIQSEVDF-LRTQFKSARIDYISG  138

Query  283  LGSFVDAHTLELWHP-----KKGTKTVTTRDVVIAVGGRP--KPLSCEGGDLAISSDDIF  335
               F D H + +        +K TK +     ++A G RP   P     G +   SD I 
Sbjct  139  HARFEDDHQVSIIEADGPAHEKTTKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQIL  198

Query  336  -WR-KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFM  391
             W  ++ P   +VVGA  + +E A  +  + G+ V ++  R  +L   D ++ + +   M
Sbjct  199  SWNIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEM  258

Query  392  ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAF-DTVLNATGRDPDVAKLGL  450
                   F+ G + +S+ K   G      VS   ++ ++   D +L   GR  +   L L
Sbjct  259  RNHGA-RFLLGEIIESVEKSSRG------VSVGLKSGKKVHGDALLYVVGRQANTDGLNL  311

Query  451  DKVGVKLNPKTGRIAV-TNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETA  509
            +  G+  NP+ G ++V T  QT  P+I+A+GD I AP L   +++ GRL +  ++N   A
Sbjct  312  EAAGLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNENEA  370

Query  510  LMDYDKVCTAVFT-PIEYGCCGLSEEASIEKYGEE------NLEIYHQNFTPLEWSLSSD  562
              + D + + + T    YG   + E + + K  +E      N EI    ++ L     S 
Sbjct  371  --NDDSIPSQLTTGNFPYGIYTIPEISMVGKTEKELTSLKMNYEIGVAKYSELAKGQMSG  428

Query  563  REAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPT  622
              A G   +K++ D    K + G H +G  A E+     +A+ +G T     + V  +PT
Sbjct  429  ASADG--MLKILFDPISLK-LYGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPT  485

Query  623  TAEIF  627
             AE +
Sbjct  486  LAEAY  490

>PYAR_16840
Length=536

 Score = 118 bits (296),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 127/502 (25%), Positives = 217/502 (43%), Gaps = 60/502 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++++GK+V V+D        T  G+GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAVESARHGKRVAVVD--------TRGGVGGVCVHTGTIPSKTFRE  88

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +T     +L  V   + S     K +L+  ++ Y   L 
Sbjct  89   A-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARIDYLPGLA  147

Query  285  SFVDAHTLELW-------HPKKGTKTVTTRDVVIAVGGRP--KPLSCEGGDLAISSDDIF  335
             F + H + +                V     +IA G RP   PL    G + + SD I 
Sbjct  148  RFENEHEISIQSDITAGGQDASSVSRVQADKFLIACGTRPAHNPLVPVDGKVILDSDQIL  207

Query  336  --WRKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIM-----VRSILLRGFDQDMA---  384
                +E P   +VVGA  + +E A  +  + G+ V ++     VR++L     +DM+   
Sbjct  208  SGALRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRNDVRNLLT---SRDMSLRP  264

Query  385  ---------------NKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCE  429
                           ++I   ++ E +++  R  + ++I K+E     VK     G+   
Sbjct  265  QGICPFLWQILSFCDDEIVSMLKYEMRVKGARFLLGETIEKVEKTATGVKVFLTSGKVT-  323

Query  430  EAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPEL  488
             + D +L   GR      L L+ VG+  N K G + V    QT  P+IYA+GD I AP L
Sbjct  324  -SGDALLYTVGRQASTDGLNLEAVGLGRN-KRGLLTVNKAYQTEKPHIYAVGDCIGAPSL  381

Query  489  TPVAIQAGRLLARRLYNNE---TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENL  545
               +++ GRL A  ++      T+ ++       ++T  E    G +E+    +  + N 
Sbjct  382  ASTSMEQGRLAACHMWEKRELVTSQLENGNYPYGIYTIPEISMVGKTEQQLTSE--KVNY  439

Query  546  EIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMK  605
            EI    ++ L     S   A G   +    DT R   V G H +G  A E+     +A+ 
Sbjct  440  EIGLAKYSELAKGQMSG-GAFGMLKILFDPDTLR---VHGVHAIGEGATEIIHIGQVAIA  495

Query  606  LGFTYDQMVNVVGIHPTTAEIF  627
            +G +     + V  +PT AE +
Sbjct  496  MGCSLTYFRDAVFNYPTLAEAY  517

>CCI50816
Length=807

 Score = 119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 129/482 (27%), Positives = 218/482 (45%), Gaps = 40/482 (8%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDLIVIG G     C+ +A+K GK V ++D  K S VG      G CV+ G IP K   +
Sbjct  30   YDLIVIGSGPSATNCALDAAKRGKHVAIID--KKSSVG------GVCVHTGTIPSKTFRE  81

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +      +L  VN  I+S     +V+ +  +V Y +   
Sbjct  82   A-VLHLSGYRHHGFYGKSYSMKNVTIDDILYRVNRVIQSEVDLLRVQFKSARVDYISGHA  140

Query  285  SFVDAHTLELWHP-----KKGTKTVTTRDVVIAVGGRP--KPLSCEGGDLAISSDDIF-W  336
             F D H + +        +K TK +     ++A G RP   P     G +   SD I  W
Sbjct  141  RFEDDHQVSIIEADGPAHEKITKRLRASKFLVACGTRPAHNPNIPIDGKVIFDSDQILSW  200

Query  337  R-KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMET  393
              ++ P   +VVGA  + +E A  +  + G+ V ++  R  +L   D ++ + +   M  
Sbjct  201  NIRQLPRSLIVVGAGVIGMEYASMLNVIRGHSVTVIDGREEILSFCDDEIISTLTHEMRN  260

Query  394  ESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKV  453
                 F+ G   +S+ K   G +LV   S  G+      D +L   GR  +   L L+  
Sbjct  261  HGA-RFLLGETIESVDKSSRG-VLVGLKS--GKKVHG--DALLYVVGRQANTDGLNLEAA  314

Query  454  GVKLNPKTGRIAV-TNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYN----NET  508
            G+  NP+ G ++V T  QT  P+I+A+GD I AP L   +++ GRL +  ++N    N+ 
Sbjct  315  GLSRNPR-GLLSVNTKYQTKKPHIFAVGDCIGAPSLASTSMEQGRLASCYMWNEDESNDD  373

Query  509  ALMDYDKVCT---AVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREA  565
            ++    K       ++T  E    G +E+    +  + N EI    ++ L     S   A
Sbjct  374  SIPSQLKTGNFPYGIYTIPEISMVGHTEKQLTSQ--QINYEIGVAKYSELAKGQMSGASA  431

Query  566  AGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
             G   +K++ D    K + G H +G  A E+     +A+ +G T     + V  +PT AE
Sbjct  432  DG--MLKILFDPHSLK-LFGVHAIGEGATEIIHIGQVAIAMGATLTYFRDAVFNYPTLAE  488

Query  626  IF  627
             +
Sbjct  489  AY  490

>PYIW_19795
Length=519

 Score = 117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 124/484 (26%), Positives = 211/484 (44%), Gaps = 41/484 (8%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++K GK+V V+D            +GG CV+ G IP K   +
Sbjct  37   YDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFRE  88

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +T     +L  V   + S     K +L+  +V+Y   L 
Sbjct  89   A-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGLA  147

Query  285  SFVDAHTLELWHPKKGTKT-----------VTTRDVVIAVGGRP--KPLSCEGGDLAISS  331
             F   H + +       +            +     +IA G RP   PL    G +   S
Sbjct  148  RFEGDHEISIVRDAADAEASDGEIANTVSRLHADKFLIACGTRPAHNPLVPIDGKVIFDS  207

Query  332  DDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKI  387
            D I     +E P   +VVGA  + +E A  +  + G+ V ++  R  +L   D ++ + +
Sbjct  208  DQILSGDIRELPRSLIVVGAGVIGMEYASMLNVIPGHSVTVVDGRPEILSFCDNEIISNL  267

Query  388  GEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAK  447
               M ++    F+ G   + + K E G + V + S    T     D +L   GR      
Sbjct  268  TYEMRSKGA-RFLLGETIKQVEKTEDG-VTVHFNSGKTATA----DALLYTVGRQASTDG  321

Query  448  LGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNE  507
            L L+ V +  NP+      T+ QT+  +IYA GD I AP L   +++ GRL A  +++ E
Sbjct  322  LNLEAVNLARNPRGLLTVNTSYQTNQSHIYAAGDCIGAPSLASTSMEQGRLAACHMWDQE  381

Query  508  ----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDR  563
                T+ ++       ++T  E    G +E+  + K G  N EI    ++ L     S  
Sbjct  382  EQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEG-ANYEIGIAKYSELAKGQMSGS  439

Query  564  EAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTT  623
             A G   +K++ D    K ++G H +G  A E+     +AM +G +     + V  +PT 
Sbjct  440  TAGG--MLKILFDPTTLK-LLGVHAIGEGATEIIHIGQVAMAMGCSVTYFRDAVFNYPTL  496

Query  624  AEIF  627
            AE +
Sbjct  497  AEAY  500

>H310_00561
Length=497

 Score = 117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 219/482 (45%), Gaps = 46/482 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDLIVIG G  GL C+ E++K GK V ++D         S  +GG CV+ G IP K   
Sbjct  29   EYDLIVIGSGPSGLQCALESAKMGKSVAIVD--------KSEEIGGVCVHTGTIPSKTFR  80

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ L     +     +G +   +      +L  VN  + S     + +L+   V+     
Sbjct  81   EAVLHLSGFNHHG-FYGKSYSRERITLRDILHRVNVVVSSEMDVIRAQLKAAHVQIIPGK  139

Query  284  GSFVDAHTLELWHPKKGTKTVTTR--DVVIAVGGRP--KPLSCEGGDLAISSDDIF--WR  337
              F +A+ + +     G++    R    +IA G  P   P+    G++ + SD I    +
Sbjct  140  ARFENANEVSVATEPVGSEATIYRGQKFLIACGTYPAHSPVVPVDGEVILDSDGILDASK  199

Query  338  KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETES  395
             E P   +VVGA  + +E A  +  + G  V ++  R  +L   D ++ + +   ME   
Sbjct  200  GELPRSWIVVGAGVIGMEYASMLNVLPGVSVTVVDGRPDILTFCDDEIVSALK--MEMRH  257

Query  396  K-IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAF-DTVLNATGRDPDVAKLGLDKV  453
            K   F+ G   QS+ ++  G      V  D  + + +F + +L   GR  +   L L+ V
Sbjct  258  KGARFLLGETIQSVKRVRKG------VRVDFASGKSSFAEALLYCVGRQANTDTLNLEGV  311

Query  454  GVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNE---TA  509
            G+  N K G ++V  + QT+ P+I+A GD I AP L   +++ GRL A  ++ +E   T+
Sbjct  312  GLSKN-KRGLLSVNEQYQTTQPHIFAAGDCIGAPSLASTSLEQGRLAACAMWRHEDQPTS  370

Query  510  LMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC  569
             +D       ++T  E    G +E+  + K G  N  +    ++ L   + +  +     
Sbjct  371  QLDSGNYPYGIYTIPEISMVGKTEQ-QLTKEG-RNYAVGVAKYSELAKGMMAGGQKGA--  426

Query  570  YVKVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DQMVNVVGIHPTTAE  625
             +K++ D   +  V+G H +G  A E+     + +AM    TY  D + N    +PT AE
Sbjct  427  -LKLLFDPDSHS-VLGVHAIGQGATEIIHIGQVAMAMNCKLTYFRDAVFN----YPTLAE  480

Query  626  IF  627
             +
Sbjct  481  AY  482

>PYIW_25190
Length=206

 Score = 110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 101/185 (55%), Gaps = 4/185 (2%)

Query  448  LGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDV-IDAPELTPVAIQAGRLLARRLYNN  506
            LGL+ VGVKLN     +    E TS   IYAIGD  I   ELTPVAI AGR LA RL+  
Sbjct  2    LGLEAVGVKLNDAGFIVVDAQENTSVSGIYAIGDATITGWELTPVAIAAGRRLADRLFGG  61

Query  507  ET-ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREA  565
            E  AL+ Y ++ T VF+    G  G +E  +IEK+G  N++ Y   F  L  +++ D + 
Sbjct  62   EPDALLHYHQIPTVVFSHPPLGTIGYTEPQAIEKFGAANVKSYTSKFVNLLHAMA-DPDH  120

Query  566  AGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAE  625
             G   +K++   +    VVG H  G  A E+ Q  G+AMK+  T     N+V IHPT +E
Sbjct  121  KGKTAMKLVTVGEDEV-VVGVHVAGEGADEMIQGFGVAMKMNATKADFDNIVAIHPTASE  179

Query  626  IFTTL  630
               T+
Sbjct  180  ELVTM  184

>PHYRA_47253
Length=481

 Score = 116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 129/493 (26%), Positives = 215/493 (44%), Gaps = 55/493 (11%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++K GK+V ++D            LGG CV+ G IP K   +
Sbjct  1    YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KRTRLGGVCVHTGTIPSKTFRE  52

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
             +++  + ++    +G +   +T     +L  V   + S     + +L+  +V       
Sbjct  53   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFA  111

Query  285  SFVDAHTLELWH-----PKKGTKTVTTRD---------VVIAVGGRP--KPLSCEGGDLA  328
             F   H + +        KKG    +T D          +IA G RP   PL    G + 
Sbjct  112  RFESEHEISIVRDDDDDQKKGASASSTLDSLSRVKADKFLIACGTRPAHNPLVPIDGQVV  171

Query  329  ISSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMA  384
            I SD I  R   + P   +VVGA  + +E A  +  + G+ V ++  R  +L   D+++ 
Sbjct  172  IDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSFCDREII  231

Query  385  NKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPD  444
            + +   M++     F+ G   ++I K+E+    VK     G+    + D +L   GR   
Sbjct  232  SNLTYEMQSNGA-RFLLG---ETIKKVETADNRVKVFFDSGKVL--SADALLYTVGRQAS  285

Query  445  VAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRL  503
               L L+ VG+  N + G I V  N QT  P+IYA GD I AP L   +++ GRL +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  504  YNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWS  558
            +  +     T+ ++       ++T  E    G +E+   +     N EI    ++ L   
Sbjct  345  WKPDEELAVTSQLESGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGVAKYSELAKG  402

Query  559  LSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DQMV  614
                  A G+  +K++ D    K V G H +G  A E+     + +AM    TY  D + 
Sbjct  403  QMMGAMAGGT--LKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRDAVF  459

Query  615  NVVGIHPTTAEIF  627
            N    +PT AE +
Sbjct  460  N----YPTLAEAY  468

>PYU1_G011605
Length=524

 Score = 116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 125/488 (26%), Positives = 222/488 (45%), Gaps = 46/488 (9%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+VIG G     C+ E++K GK+V ++D            +GG CV+ G IP K   
Sbjct  40   DYDLVVIGSGPSATQCAIESAKQGKRVAIVD--------KKTSVGGVCVHTGTIPSKTFR  91

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ ++  + ++    +G +   +T     +L  V   + S     K +L+  +V+Y    
Sbjct  92   EA-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNSEVDVIKAQLKAARVEYIPGF  150

Query  284  GSFVDAHTLELWH-PKKG--------TKTVT---TRDVVIAVGGRP--KPLSCEGGDLAI  329
              F + H + +   P+ G        T TV+       +IA G RP   P     G +  
Sbjct  151  ARFENDHEISIVRDPETGESQEAGEITNTVSRLRADKFLIACGTRPAHNPNVPIDGKVIF  210

Query  330  SSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQDMAN  385
             SD I     ++ P   +VVGA  + +E A  +  + G+ V ++  R  +L   D ++ +
Sbjct  211  DSDQILSGDIRDLPRSLIVVGAGVIGIEYASMLNVIPGHSVTVIDARPEILSFCDNEIIS  270

Query  386  KIGEFMETESKIEFIRGAVPQSITKLE-SGQLLVKWVSADGETCEEAFDTVLNATGRDPD  444
             +   M ++    F+ G   ++I ++E +G  +  ++++   T   + D +L   GR   
Sbjct  271  NLTYEMRSKGA-RFLLG---ETINRVEKTGNGVTVYLNSGKVT---SADAMLYTVGRQAS  323

Query  445  VAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRL  503
               L L+ V +  NP+ G + V    QT  P+IYA+GD I AP L   +++ GRL A  +
Sbjct  324  TDGLNLEAVNLSRNPR-GLLNVNKSYQTGQPHIYAVGDCIGAPSLASTSMEQGRLAACHM  382

Query  504  YNNE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSL  559
            ++ E    T+ ++       ++T  E    G +E+  + K G  N EI    ++ L    
Sbjct  383  WDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEG-VNFEIGIAKYSELAKGQ  440

Query  560  SSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGI  619
             S   A G   +K++ D    K + G H +G  A E+     +A+ +G +     + V  
Sbjct  441  MSGSTAGG--MLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAIAMGCSVTYFRDAVFN  497

Query  620  HPTTAEIF  627
            +PT AE +
Sbjct  498  YPTLAEAY  505

>PYVX_20512
Length=528

 Score = 114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 122/491 (25%), Positives = 205/491 (42%), Gaps = 47/491 (10%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+VIG G     C+ E++K GK+V ++D            +GG CV+ G IP K   
Sbjct  37   DYDLVVIGSGPSATQCAMESAKQGKRVAIVD--------KRTRVGGVCVHTGTIPSKTFR  88

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ ++  + ++    +G +   +      +L  V   + S     K +L+  +V Y    
Sbjct  89   EA-VLHLSGYRHHGFYGKSYSMKNITIDDILYRVQRVVASEVDVIKAQLKAARVDYIAGT  147

Query  284  GSFVDAHTLELWHPKKGT----------------KTVTTRDVVIAVGGRP--KPLSCEGG  325
             SF   H L +      +                  +     +IA G RP   PL    G
Sbjct  148  ASFESPHELSISMDSTDSDPDLADVLDRADGLAPSRLRADKFLIACGTRPAHNPLVPVDG  207

Query  326  DLAISSDDIFWRK--EAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  381
             +   SD I   +  + P   +VVGA  + +E A  +  + G+ V ++  R  +L   D 
Sbjct  208  KVVFDSDQILSGQIHQLPRSLIVVGAGVIGIEYASMVNVVPGHSVTVVDGRPDILSFCDT  267

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            ++ + +   M ++    F+ G   +SI K E G   VK     G+      D +L   GR
Sbjct  268  EIISNLMYEMRSKGA-RFLLGETIKSIEKSERG---VKVFFNSGKVATA--DALLYTVGR  321

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLAR  501
                  L L+ VG+  NP+       N QT   +IYA GD I AP L   +++ GRL A 
Sbjct  322  QASTDGLNLEAVGLSRNPRGLLTVNKNYQTDQAHIYAAGDCIGAPALASTSMEQGRLAAC  381

Query  502  RLYNNETAL-----MDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLE  556
             +++++  L     +D       ++T  E    G +E+  + K G  N E+    ++ L 
Sbjct  382  HMWDDQAQLQSTSQLDNGNYPYGIYTIPEISMVGKTEQ-QLTKEG-VNYEVGIAKYSELA  439

Query  557  WSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNV  616
                +   A G   +    D+     + G H +G  A E+     +A+ +G +     N 
Sbjct  440  KGQMTGAIAGGMLKILFCPDS---LELFGVHAIGEGATEIIHIGQVAIAMGCSLTYFRNA  496

Query  617  VGIHPTTAEIF  627
            V  +PT AE +
Sbjct  497  VFNYPTLAEAY  507

>PPTG_00938
Length=550

 Score = 113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 133/507 (26%), Positives = 224/507 (44%), Gaps = 64/507 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K+GK V ++D            LGG CV+ G +P K   +
Sbjct  48   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  99

Query  225  SSLIGETIHKDAKAFGWTVGEQTF---DWSQMLKSVNSYIKSIN----FKYKVELRDKKV  277
            ++L        A   G     + F   D  Q ++ V +    I      +  V+L +   
Sbjct  100  AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVENAETDITRHQLLRNGVQLINGTA  159

Query  278  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDV----------VIAVGGRP--KPLSCEGG  325
            ++     + V   + E +      K  ++ D+          ++ VG RP  +P     G
Sbjct  160  RFLPGSKNMVAVLSNESYETATDAKRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  219

Query  326  DLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  381
            +    SD++ W   K  P + ++VGA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  220  ETIFDSDELLWGKVKSVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  279

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
             ++  +   M T++   F+ G   +S+ K   G++ V   S  G+T     D +L   GR
Sbjct  280  QVSEALCYSM-TQTGTRFLTGETIKSVEKSPKGEVFVHLES--GKTV--VGDGLLYTVGR  334

Query  442  DPDVAKLGLDKVGVKLNP-KTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  499
              +V  L L+ VG  L+P K GRI V N  QT+ P+IYA GD+I  P L   +++ GRL 
Sbjct  335  QGNVEGLNLEAVG--LSPDKRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLA  392

Query  500  ARRL----------YNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYH  549
            +  +           +++  + D D+V T + +  E    G+     I   G+   ++  
Sbjct  393  SVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTK  451

Query  550  QNFTPLEWSLSSDREAAG-------SCYVKVI-C-DTKRNKHVVGFHYLGPNAGEVTQAI  600
            +   P E  ++   E A          ++K+I C DT +   + G H +G  A E+    
Sbjct  452  EQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK---IFGVHAIGEGATEIIHIG  507

Query  601  GLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             + M  G T +   N V  +PT AE +
Sbjct  508  QVVMSTGGTLEYFRNAVFNYPTLAEAY  534

>PHYRA_73883
Length=551

 Score = 112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 131/506 (26%), Positives = 222/506 (44%), Gaps = 62/506 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K+GK V ++D            LGG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  97

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            ++L        A   G     + F    +L+ V     +     + +L    V+  N   
Sbjct  98   AALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  285  SFVDAH-------TLELWHPKKGTKTVTTRDV----------VIAVGGRP--KPLSCEGG  325
             F+  +       + E +      K  T+ D+          ++ VG RP   P     G
Sbjct  158  RFLPGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKFLVCVGTRPARHPDIPFDG  217

Query  326  DLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  381
            +    SD + W   K  P + +VVGA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPGTDVTVIDGRKEILNMADK  277

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            +++  +   M  ++   F+     +S+ K ++G++ V   S  G+T     D +L   GR
Sbjct  278  EVSEGLCYSM-AQTGTRFLTEETIKSVEKADNGEIFVHLES--GKTV--VGDGLLYTVGR  332

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRL--  498
              +V  L L+ VG+  + K GRI V N  QT+ P+IYA GD+I  P L   +++ GRL  
Sbjct  333  QGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAAPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  499  --------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQ  550
                    L  ++ +++  + D D+V T + +  E    G+     I   G+   ++  +
Sbjct  392  VHMRTSKPLNNQVLSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  551  NFTPLEWSLSSDREAAG-------SCYVKVI-C-DTKRNKHVVGFHYLGPNAGEVTQAIG  601
              TP E  ++   E A          ++K+I C DT +   ++G H +G  A E+     
Sbjct  451  Q-TPYEVGMARYEELARGQMLGGVPGFLKIIFCPDTLK---ILGVHAIGEGATEIIHIGQ  506

Query  602  LAMKLGFTYDQMVNVVGIHPTTAEIF  627
            + M  G   +   N V  +PT AE +
Sbjct  507  VVMSTGGNLEYFRNAVFNYPTLAEAY  532

>PITG_18935
Length=480

 Score = 111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 115/433 (27%), Positives = 188/433 (43%), Gaps = 42/433 (10%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            LGGTC+NVGCIP K +  S+ +  T   D K++G    E   ++ QM+KS    +K++  
Sbjct  64   LGGTCLNVGCIPSKALLHSTHLLHTAQHDFKSYGIDAPEVKANFPQMMKSKEKAVKTLTG  123

Query  267  KYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPL  320
              ++  +  KV Y    G       + +  +  KG +TV  ++++IA G       P P+
Sbjct  124  GIELLFKKNKVTYIKGHGKISAQGEISVALNDNKGNETVKAKNIIIATGSEVTPLPPVPV  183

Query  321  SCEGGDLAISSDDIFWRKEAP-----GKTLVVGASYVALECAGFMKGMGYDVKIMVRSIL  375
                G + I S      K  P         V    ++   C G  K     VK   + + 
Sbjct  184  DNAAGKI-IDSTGALELKRVPEHLVVVGAGVTVVEFLDAACPGSDK---EAVKEFTKLLK  239

Query  376  LRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTV  435
             +G D     K+     T S+   + G V +  T+   G          G+      DTV
Sbjct  240  KQGLDFQFNTKV-----TASE---VNGDVVKLTTEPSKG----------GDASSIECDTV  281

Query  436  LNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQ  494
            L ATGR    + LGL+++G++ + K GRI V +  +T  P I+AIGDVI    L   A +
Sbjct  282  LVATGRRAFTSGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGDVIKGAMLAHKAEE  340

Query  495  AGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTP  554
             G      +       ++Y  +   ++T  E+   G +E    E+   E +E Y+    P
Sbjct  341  EGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGKTE----EELKAEGIE-YNVGKFP  394

Query  555  LEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMV  614
            +  +  +   A     VKV+ D K +K ++G H +  NAGE+     + ++ G   + + 
Sbjct  395  MMANSRARTIAEADGLVKVLADKKTDK-LLGVHIIAGNAGEMIAEGVIGIEYGAASEDLA  453

Query  615  NVVGIHPTTAEIF  627
                 HPT +E F
Sbjct  454  RTCHAHPTLSEAF  466

>PYAP_19280
Length=512

 Score = 108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 126/488 (26%), Positives = 219/488 (45%), Gaps = 49/488 (10%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++++GK+V V+D  K S V      GG CV+ G IP K   +
Sbjct  30   YDLVVIGSGPSATQCAVESARHGKRVAVVD--KGSSV------GGVCVHTGTIPSKTFRE  81

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
             +++  + ++    +G +   +T     +L  V   + S     K +L+  +V Y     
Sbjct  82   -AVLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVDSEVDVIKAQLKAARVDYIPGFA  140

Query  285  SFVDAHTLELWHPKKGTKT-------VTTR----DVVIAVGGRP--KPLSCEGGDLAISS  331
             F + H + +      T         + TR      +IA G RP   PL    G +   S
Sbjct  141  RFENDHEISIVREPTETNPEEEEPARLATRLQADKFLIACGTRPAHSPLVPIDGKVVFDS  200

Query  332  DDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKI  387
            D I     +E P   +VVGA  + +E A  +  + G+ V ++  R  +L   D    N++
Sbjct  201  DQILSGDIRELPRSLIVVGAGVIGMEYASMLNVVPGHSVTVIDGRQDILSFCD----NEV  256

Query  388  GEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAK  447
               ++ E +++  R  + +SI K+E     VK +   G+    + D +L   GR  +   
Sbjct  257  VSMLQHEMRVKGARFLLGESIQKVEKTAKGVKVLLNSGKVT--SADALLYTVGRQANTDG  314

Query  448  LGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNN  506
            L ++ VG+  N + G + V    QT   +IYA+GD I AP L   +++ GRL A  +++ 
Sbjct  315  LNIEAVGLSRNQR-GLLNVNKSYQTDKAHIYAVGDCIGAPALASTSMEQGRLAACHMWDG  373

Query  507  E----TALMDYDKVCTAVFTPIEYGCCGLSEEA-SIEKYGEENLEIYHQNFTPLEWSLSS  561
                 T+ ++       ++T  E    G +E+  + EK    N EI    ++     L+ 
Sbjct  374  NCDIATSQLENGNYPYGIYTIPEISMVGKTEQQLTAEKV---NYEIGIAKYS----ELAK  426

Query  562  DREAAGSC--YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGI  619
             +   GS    +K++ D    K + G H +G  A E+     +A+ +G +     + V  
Sbjct  427  GQMGGGSHNGILKILFDPDTLK-LHGVHAIGEGATEIIHIGQVAIAMGCSLTYFRDAVFN  485

Query  620  HPTTAEIF  627
            +PT AE +
Sbjct  486  YPTLAEAY  493

>PPTG_09121
Length=520

 Score = 108 bits (270),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 125/496 (25%), Positives = 216/496 (44%), Gaps = 58/496 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++K GK+V ++D            LGG CV+ G IP K   +
Sbjct  32   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  83

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +T     +L  V   + S     + +L+  +V       
Sbjct  84   A-VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFA  142

Query  285  SFVDAHTLEL------WHPKKGTKTVTTRDV-----------VIAVGGRP--KPLSCEGG  325
             F + H + +         K G  + ++ ++           +IA G RP   PL    G
Sbjct  143  RFENEHEISIVRDDNDQKKKNGAVSGSSSNLDSLSRIRADKFLIACGTRPAHNPLIPIDG  202

Query  326  DLAISSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  381
             + I SD I  R   + P   +V+GA  + +E A  +  + G+ V ++  R  +L   D 
Sbjct  203  KVVIDSDQILSRDMHQLPRSLIVLGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDS  262

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            ++ + +   M++     F+ G   +++ K+E+    VK     G+      D +L   GR
Sbjct  263  EIISNLTYEMQSNGA-RFLLG---ETVKKVETTDKRVKVFFNSGKVLSA--DALLYTVGR  316

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLA  500
                  L L+ VG+  N + G I V  N QT  P+IYA GD I AP L   +++ GRL +
Sbjct  317  QAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLAS  375

Query  501  RRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
              ++N +     T+ ++       ++T  E    G +E+   +     N EI    ++ L
Sbjct  376  CHMWNPDEELAATSQLENGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYSEL  433

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--D  611
                     A G+  +K++ D    K V G H +G  A E+     + +AM    TY  D
Sbjct  434  AKGQMMGAMAGGT--LKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTYFRD  490

Query  612  QMVNVVGIHPTTAEIF  627
             + N    +PT AE +
Sbjct  491  AVFN----YPTLAEAY  502

>SDRG_05060
Length=559

 Score = 108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 227/516 (44%), Gaps = 80/516 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K+GKKV ++D             GG CV+ G IP K   +
Sbjct  50   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  101

Query  225  SSLIGETIHKD----AKAFGWTVGE-----------QTFDWSQMLKSVNSYIKS----IN  265
            + ++  T H+       A+  T G+           Q  + ++M  + N  +++    IN
Sbjct  102  A-VLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLIN  160

Query  266  FKYKVELRDKKVKYENLLG--SFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  320
               +  L D   K   +L   S+ +A   +        K V T D  +I+VG RP   P 
Sbjct  161  GTARF-LPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  219

Query  321  SCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILL  376
                G+L   SD + W      P + +VVGA  + +E A  +  + G  V ++  R  +L
Sbjct  220  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  279

Query  377  RGFDQDMANKI-------GEFMETESKIEFIRGAVPQS--ITKLESGQLLVKWVSADGET  427
               D+++++ +       G    TE  I+F+   + +   +  L+SG+++V         
Sbjct  280  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  331

Query  428  CEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAP  486
                 D +L   GR  +V  L L+ VG++ N + G + V N  QTS P+IYA GD I  P
Sbjct  332  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  385

Query  487  ELTPVAIQAGRLLARRLYNNETA---LMDYDKVCTAVF-TPIEYGCC---GLSEEASIEK  539
             L  V+++ GRL +  +  +E       D D   T+ F T +  G     G+     I  
Sbjct  386  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  445

Query  540  YGEENLEIYHQNFTPLEWSLSSDREAAGSC-------YVKVI-CDTKRNKHVVGFHYLGP  591
             G+   ++  +N  P E  ++   E A          ++K+I C +     ++G H +G 
Sbjct  446  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  502

Query  592  NAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             A E+     + M  G T +   N V  +PT AE +
Sbjct  503  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  538

>SPRG_12054
Length=558

 Score = 108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 227/516 (44%), Gaps = 80/516 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K+GKKV ++D             GG CV+ G IP K   +
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  100

Query  225  SSLIGETIHKD----AKAFGWTVGE-----------QTFDWSQMLKSVNSYIKS----IN  265
            + ++  T H+       A+  T G+           Q  + ++M  + N  +++    IN
Sbjct  101  A-VLHLTAHRHKGFYGNAYSATSGKRMSIQDILDRVQKVESAEMDLTRNQLLRNGIYLIN  159

Query  266  FKYKVELRDKKVKYENLLG--SFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  320
               +  L D   K   +L   S+ +A   +        K V T D  +I+VG RP   P 
Sbjct  160  GTARF-LPDADKKTVAVLSNDSYTEATDGQRHSDANICKRVLTADKFLISVGTRPARHPN  218

Query  321  SCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILL  376
                G+L   SD + W      P + +VVGA  + +E A  +  + G  V ++  R  +L
Sbjct  219  MDFDGELIFDSDQLLWGALTNVPKRLIVVGAGVIGMEYAAMISIIPGTQVTVIDGRKEIL  278

Query  377  RGFDQDMANKI-------GEFMETESKIEFIRGAVPQS--ITKLESGQLLVKWVSADGET  427
               D+++++ +       G    TE  I+F+   + +   +  L+SG+++V         
Sbjct  279  EMADKEVSDALCYSMRQRGTRFLTEETIDFVEKRLDEKEVVVHLKSGKIIVG--------  330

Query  428  CEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAP  486
                 D +L   GR  +V  L L+ VG++ N + G + V N  QTS P+IYA GD I  P
Sbjct  331  -----DALLYTQGRQGNVTGLDLEAVGLEANNR-GYLEVNNNFQTSVPHIYAAGDCIGYP  384

Query  487  ELTPVAIQAGRLLARRLYNNETA---LMDYDKVCTAVF-TPIEYGCC---GLSEEASIEK  539
             L  V+++ GRL +  +  +E       D D   T+ F T +  G     G+     I  
Sbjct  385  ALASVSMEQGRLASVHMRTSEPTNKNRTDLDPYETSHFRTRMRSGEVFPFGIYTVPEISM  444

Query  540  YGEENLEIYHQNFTPLEWSLSSDREAAGSC-------YVKVI-CDTKRNKHVVGFHYLGP  591
             G+   ++  +N  P E  ++   E A          ++K+I C +     ++G H +G 
Sbjct  445  VGKSEQQLTKEN-VPYEVGVARYEELAKGQMLGGTPGFLKIIFCPSTLK--LLGVHAIGE  501

Query  592  NAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             A E+     + M  G T +   N V  +PT AE +
Sbjct  502  GATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  537

>SDRG_14446
Length=495

 Score = 107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 123/478 (26%), Positives = 218/478 (46%), Gaps = 44/478 (9%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDL+VIG G   + C+ E+ K GK V V+D           G+GG CV+ G IP K   
Sbjct  28   EYDLVVIGSGPSAVQCAIESVKKGKTVAVID--------KKAGIGGVCVHTGTIPSKTFR  79

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            +S ++  +  +    +G +        + +L  VN+ +       + +L+  +V     L
Sbjct  80   ES-VLHLSGFRHQGFYGKSYARDNITLNDILGRVNTVVSKEMDVIQAQLKAARVDLVPGL  138

Query  284  GSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRP--KPLSCEGGDLAISSDDIFWR--KE  339
              F + + + +         +  +  ++A G RP   PL    G + + SD I      +
Sbjct  139  ARFENENEVSVEGDDGQPTRLRGKKFLVACGTRPAHSPLVPCDGKVILDSDQILNHGTTK  198

Query  340  APGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETESK-  396
             P   +VVGA  + +E A  +  + G +V ++  R+ +L   D ++ + +   ME   K 
Sbjct  199  LPKSWIVVGAGVIGMEYASMLNVLPGINVTVVDGRAEILSFCDDEIVSSLK--MEMRHKG  256

Query  397  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
              F+ G   +S+   ++G + V++ S      E     +L   GR  +   L L+ VG+ 
Sbjct  257  ARFLLGESIKSVEHFKNG-VKVEFNSGKAMFAE----ALLYCVGRQANTDGLNLEAVGLS  311

Query  457  LNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNE---TALMD  512
             N + G I V  + QTS P+IYA GD I AP L   +++ GRL A  +++++   T+ ++
Sbjct  312  KNHR-GLITVNEQYQTSHPHIYAAGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLE  370

Query  513  YDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL-EWSLSSDREAAGSCYV  571
                   ++T  E    G +E+  + K G  N  +    F+ L +  +S D E      +
Sbjct  371  SGNYPYGIYTIPEISMVGKTEQ-QLTKEG-ANYAVGLAKFSELAKGQMSGDIEG----IL  424

Query  572  KVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY--DQMVNVVGIHPTTAE  625
            K++ D   +  ++G H +G  A E+     + +AM    TY  D + N    +PT AE
Sbjct  425  KLLFDPV-SLQLLGVHAIGHGATEIIHIGQVAMAMNCKLTYFRDAVFN----YPTLAE  477

>PHALS_10055
Length=516

 Score = 106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 122/492 (25%), Positives = 216/492 (44%), Gaps = 52/492 (11%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDL+VIG G     C+ E++K GK+V ++D            LGG CV+ G IP K   
Sbjct  31   NYDLLVIGSGPSATQCAIESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFR  82

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            + +++  + ++    +G +   +T     +L  V   + S     + +L+  +V      
Sbjct  83   E-AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGF  141

Query  284  GSFVDAHTLELWHPKKGTKTVTTRDV----------------VIAVGGRP--KPLSCEGG  325
              F + H + +    +   T T +++                +IA G RP   PL    G
Sbjct  142  ARFENEHEISIL---RDVDTQTKKEISASSVDSLSRAKADKFLIACGTRPAHNPLIPIDG  198

Query  326  DLAISSDDIFWRKE--APGKTLVVGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQ  381
             + I SD I  R     P   +V+GA  + +E A  +  + G+ V ++  R  +L   D 
Sbjct  199  KVVIDSDQILSRDMHLLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDSRPDILPFCDL  258

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            ++ + +   M++     F+ G   +++ K+E+ +  VK     G+    + D +L   GR
Sbjct  259  EIISNLTYEMQSNGA-RFLLG---ETVKKVETTKNQVKVFFNSGKVL--SADALLYTVGR  312

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLA  500
                  L L+ VG+  N + G I V  N QT  P+IYA GD I AP L   +++ GRL +
Sbjct  313  QAATDGLNLEAVGLSRNHR-GLINVNKNYQTDRPHIYAAGDCIGAPALASTSMEQGRLAS  371

Query  501  RRLYN-NE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPL  555
              ++  NE    T+ ++       ++T  E    G +E+   +     N EI    ++ L
Sbjct  372  CHMWKPNEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKNC--INYEIGIAKYSEL  429

Query  556  EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVN  615
                     A G+  +K++ D +    ++G H +G  A E      +AM +G +     +
Sbjct  430  AKGQMMGAMAGGT--LKILFDPE-TLSLLGVHAIGEGATETIHIGQVAMAMGCSLTYFRD  486

Query  616  VVGIHPTTAEIF  627
             V  +PT AE +
Sbjct  487  AVFNYPTLAEAY  498

>PHALS_12028
Length=579

 Score = 106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 134/521 (26%), Positives = 223/521 (43%), Gaps = 62/521 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K+GK V ++D            LGG CV+ G IP K   +
Sbjct  36   FDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTIPSKTFRE  87

Query  225  SSLIGETIHKDAKAFGWTVGEQTF---DWSQMLKSVNSYIKSIN----FKYKVELRDKKV  277
            ++L        A   G     + F   D  Q +K V S    I      +  V+L +   
Sbjct  88   AALHLTGYRHKAFYNGQGGPSKRFGVEDILQRVKKVESAETDITRHQLLRNGVQLINGTA  147

Query  278  KYENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEG------------G  325
            ++       +   + E +      +  ++ D+   V    K L C G            G
Sbjct  148  RFLPGSKHMIAVLSNESYETATDAQRHSSADICKRVLTADKFLLCVGTRPARRADIPFDG  207

Query  326  DLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIM-VRSILLRGFDQ  381
            +    SD + W   K  P + +VVGA  + +E A  M  + G DV ++  R  +L   D 
Sbjct  208  ETIFDSDQLLWGKVKSVPRRLIVVGAGVIGMEYASMMTIIPGTDVTVIDARKEILNMADN  267

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            +++  +  F   ++   F+ G V +S+ K   G++ V   S  G+T     D +L   GR
Sbjct  268  EVSEALC-FSMAQTGTRFLTGEVIKSVEKSAMGEVFVHLES--GKTV--VGDGLLYTVGR  322

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRL--  498
              +V  L L+ VG+ +  K G+I V N  QT+ P+IYA GD+I  P L   +++ GRL  
Sbjct  323  QGNVEGLNLEAVGI-VPDKRGQIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  381

Query  499  --------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQ  550
                    L  +  +++  + D D+V T + +  E    G+     I   G+   ++  +
Sbjct  382  VHMRTSQPLNDQKISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  440

Query  551  NFTPLEWSLSSDREAAGSC-------YVKVI-C-DTKRNKHVVGFHYLGPNAGEVTQAIG  601
               P E  ++   E A          ++K+I C DT +   V+G H +G  A E+     
Sbjct  441  G-VPYEVGVARYEELAKGQMLGGVPGFLKIIFCPDTLK---VLGVHAIGEGATEIIHIGQ  496

Query  602  LAMKLGFTYDQMVNVVGIHPTTAEIFTTLEVTKSSGESAAS  642
            + M    T +   N V  +PT AE +    +     E++ S
Sbjct  497  VLMSTDGTLEYFRNAVFNYPTLAEAYRVAALNGLRNENSKS  537

>PHYCA_504445
Length=548

 Score = 105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 126/504 (25%), Positives = 216/504 (43%), Gaps = 58/504 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K GK V ++D            +GG CV+ G +P K   +
Sbjct  46   FDLIVIGSGPAGQKCAIDSAKSGKSVAIID--------KRDMMGGVCVHTGTVPSKTFRE  97

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            ++L        A   G     + F    +L+ V     +     + +L    V+  N   
Sbjct  98   AALHLTGYRHKAFYNGHGGPSKRFGVEDILQRVRKVEDAETDITRHQLMRNGVQLINGTA  157

Query  285  SFV--DAHTLELW-------------HPKKGT--KTVTTRDVVIAVGGRP--KPLSCEGG  325
             F+  + H + +              H       + +T    ++ VG RP  +P     G
Sbjct  158  RFLPGNNHMVAVLSNESYETATDAQRHSSADICKRVLTADKFLVCVGTRPARRPDIPFDG  217

Query  326  DLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQ  381
            +    SD + W   K  P + ++VGA  V +E A  M  + G DV ++  R  +L   D+
Sbjct  218  ETIFDSDQLLWGKVKTVPRRLIIVGAGVVGMEYASMMTIIPGTDVTVIDGRQEILNMADK  277

Query  382  DMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGR  441
            +++  +   M  ++   F+ G   +S+ K   G++ V   S  G+T     D +L   GR
Sbjct  278  EVSEALCYSM-AQTGTRFLTGETIKSVEKTAKGEVFVHLES--GKTV--VGDGLLYTVGR  332

Query  442  DPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLA  500
              +V  L L+ VG++ + K GRI V N  QT+ P+IYA GD+I  P L   +++ GRL +
Sbjct  333  QGNVEGLNLEAVGLEPD-KRGRIKVDNNFQTAVPHIYAAGDIIGFPGLASTSMEQGRLAS  391

Query  501  RRLYNNET----------ALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQ  550
              +  ++T           + D D+V T + +  E    G+     I   G+   ++  +
Sbjct  392  VHMRTSKTLNTKELSDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTKE  450

Query  551  NFTPLEWSLSSDREAAGSC-------YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLA  603
               P E   +   E A          ++K+I   +  K ++G H +G  A E+     + 
Sbjct  451  Q-VPYEVGKARYEELARGQMLGGVPGFLKIIFCPETLK-ILGVHAIGEGATEIIHIGQVV  508

Query  604  MKLGFTYDQMVNVVGIHPTTAEIF  627
            M  G   +   N V  +PT AE +
Sbjct  509  MSTGGDLEYFRNAVFNYPTLAEAY  532

>PHYCA_555180
Length=521

 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 211/499 (42%), Gaps = 62/499 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++K GK+V ++D            LGG CV+ G IP K   +
Sbjct  31   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  82

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +T     +L  V   + S     + +L+  +V       
Sbjct  83   A-VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  141

Query  285  SFVDAHTLELWHPKKGTKT--------------------VTTRDVVIAVGGRP--KPLSC  322
             F + H + +       K                     V     +IA G RP   PL  
Sbjct  142  RFENQHEISIIRDDADVKKNGAVGANASGSSCNLDSLSRVHADKFLIACGTRPAHNPLVP  201

Query  323  EGGDLAISSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRG  378
              G + I SD I  R   + P   +V+GA  + +E A  +  + G+ V ++  R  +L  
Sbjct  202  IDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPGHSVTVVDGRPDILSF  261

Query  379  FDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNA  438
             D+++ + +   M++     F+ G   +++ K+E     VK     G+      D +L  
Sbjct  262  CDREIISNLTYEMQSNGA-RFLLG---ETVKKVEVTDR-VKVFFDSGKVLSA--DALLYT  314

Query  439  TGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGR  497
             GR      L L+ VG+  N + G I V  N QT  P+IYA GD I AP L   +++ GR
Sbjct  315  VGRQAATDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGR  373

Query  498  LLARRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNF  552
            L +  ++N +     T+ ++       ++T  E    G +E+   +     N EI    +
Sbjct  374  LASCHMWNPDEELAVTSQLENGNYPYGIYTIPEISMVGQTEQQLTKAC--INYEIGVAKY  431

Query  553  TPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQ--AIGLAMKLGFTY  610
            + L         A G+  +K++ D    K V G H +G  A E+     + +AM    TY
Sbjct  432  SELAKGQMMGAMAGGT--LKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMDCSLTY  488

Query  611  --DQMVNVVGIHPTTAEIF  627
              D + N    +PT AE +
Sbjct  489  FRDAVFN----YPTLAEAY  503

>PYIR_14132
Length=513

 Score = 103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 125/504 (25%), Positives = 214/504 (42%), Gaps = 58/504 (12%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ + +K+GK V V+D            LGG C++ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAVDHAKHGKSVAVID--------KRDMLGGVCIHTGTVPSKTFRE  62

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            ++L        +   G +   + F    +L+ V     +     + +L    ++  N   
Sbjct  63   ATLHLTAYRHRSFYDGQSNPTKRFGIEDILQRVKKVEHAETDITRHQLLRNNIELINGTA  122

Query  285  SFV-------------DAHTLELWHPKKGT-----KTVTTRDVVIAVGGRP--KPLSCEG  324
             F+             D++T      +  +     + +T    +IAVG RP  +P     
Sbjct  123  RFLPDAGKKMVAVLSNDSYTTATDAKRHSSADICKRVLTADKFLIAVGTRPARRPDIPFD  182

Query  325  GDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  380
            G     SD + W   K  P + +VVGA  + +E A  M  + G +V I+  R  +L   D
Sbjct  183  GQTIFDSDQLLWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  242

Query  381  QDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATG  440
            ++++  +   M       F+   + +S+ K ++G+++V   S  G+T     D +L   G
Sbjct  243  REVSEALCYSMRQTGARFFVEETI-KSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLG  297

Query  441  RDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  499
            R  +   L L  VG++ + K G I V ++ QT  P+IYA GD I  P L   +++ GRL 
Sbjct  298  RQGNTEGLNLAAVGLEAD-KRGLIQVDDDFQTDVPHIYAAGDCIGFPALASTSMEQGRLA  356

Query  500  ARRLYN---------NETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQ  550
            +  +           +ET   D   + T + +  E    G+     I   G+   ++  Q
Sbjct  357  SVHMRTSKPTNKKGESETESTDPQYMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQ  415

Query  551  NFTPLEWSLSSDREAAGSC-------YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLA  603
            N  P E  ++   E A          ++K+I    +   V+G H +G  A E+     + 
Sbjct  416  NI-PYEVGVARYEELAKGQMLGGVPGFLKIIF-CPKTLQVLGVHAIGEGATEIIHIGQVV  473

Query  604  MKLGFTYDQMVNVVGIHPTTAEIF  627
            M  G T +   N V  +PT AE +
Sbjct  474  MSTGGTIEYFRNAVFNYPTLAEAY  497

>PYIW_20257
Length=503

 Score = 101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 124/491 (25%), Positives = 206/491 (42%), Gaps = 81/491 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ + +K+GK V V+D            LGG C++ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDHAKHGKTVAVID--------KRDMLGGVCIHTGTVPSKTFRE  101

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            ++L        +   G +   + F    +L+ V                           
Sbjct  102  ATLHLTAYRHRSFYEGQSTPAKRFGIEDILQRVKK-------------------------  136

Query  285  SFVDAHTLELWHPKKGTKTVTTRD----VVIAVGGRP--KPLSCEGGDLAISSDDIFW--  336
                       H + G +T   R      +IAVG RP  +P     G+    SD + W  
Sbjct  137  ----------LHDRHGRQTPLERRHLQAFLIAVGTRPARRPDIPFDGETIFDSDQLLWGG  186

Query  337  RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETE  394
             K  P + +VVGA  + +E A  M  + G +V I+  R  +L   D++++  +   M   
Sbjct  187  VKSVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIVDGRREILDMADREVSEALCYSMRQT  246

Query  395  SKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVG  454
                F+   + +S+ K ++G+++V   S  G+T     D +L   GR  +   L L+ +G
Sbjct  247  GARFFVEETI-KSVEKADNGEVIVHLNS--GKTL--VGDGLLYTLGRQGNTEGLNLEAIG  301

Query  455  VKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLY---------  504
            +K + K G I V ++ QT+ P+IYA GD I  P L   +++ GRL +  +          
Sbjct  302  LKAD-KRGLIEVDDDFQTAVPHIYAAGDCIGFPALASTSMEQGRLASVHMRTAKPTNKKG  360

Query  505  NNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDRE  564
            ++ET   D   + T + +  E    G+     I   G+   ++  Q   P E  ++   E
Sbjct  361  DSETESTDPAFMRTRMRSG-EVFPFGIYTVPEISMVGKNEQQLTSQCI-PYEVGVARYEE  418

Query  565  AAGSC-------YVKVI-CDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNV  616
             A          ++K+I C T     V+G H +G  A E+     + M  G T +   N 
Sbjct  419  LAKGQMLGGVPGFLKIIFCPT--TLQVLGVHAIGEGATEIIHIGQVVMSTGGTIEYFRNA  476

Query  617  VGIHPTTAEIF  627
            V  +PT AE +
Sbjct  477  VFNYPTLAEAY  487

>PHYKE_9807
Length=557

 Score = 100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 128/511 (25%), Positives = 219/511 (43%), Gaps = 73/511 (14%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKL-MH  223
            +DLIVIG G  G  C+ +++K+GK V ++D            LGG CV+ G   ++  MH
Sbjct  56   FDLIVIGSGPAGQKCAIDSAKHGKSVAIVD--------KRDMLGGVCVHTGTTFREAAMH  107

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             +       +         +G +  D  Q +K V +    I    + +L+   V+  +  
Sbjct  108  LTGYRHRAFYNGHGGISKRIGVE--DILQRVKKVEAAETDIT---RHQLQRNGVQLISGT  162

Query  284  GSFV--DAHTLELWH---------PKKGT------KTVTTRDVVIAVGGRP--KPLSCEG  324
              F+  D+H L +            K+ T      + +T    ++ VG RP   P     
Sbjct  163  ARFLAGDSHMLAVLSNEEYETATDAKRHTEADICKRVLTADKFLVCVGTRPARHPDIPFD  222

Query  325  GDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  380
            G+    SD + W   K  P + ++VG   V +E A  M  + G DV ++  R  +L   D
Sbjct  223  GETIFDSDQLLWGKVKMVPRRLIIVGGGVVGMEYASMMTIIPGTDVTVIDGRKEILNMAD  282

Query  381  QDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATG  440
            ++++  +   M  ++   F+ G   + + K   G++LV+  S  G+T     D +L   G
Sbjct  283  KEVSEALCYSM-AQTGTRFLVGETIKKVEKNSKGEVLVRLDS--GKTV--VGDGLLYTVG  337

Query  441  RDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLL  499
            R  +V  L L+ VG+  + K GRI V N  QT  P+IYA GD+I  P L   +++ GRL 
Sbjct  338  RQGNVEGLHLESVGIHPD-KRGRIKVDNNFQTEVPHIYAAGDIIGFPGLASTSMEQGRLA  396

Query  500  ARRLYN-------------NETALMDYDKVCTAVFT--PIEYGCCGLSEEASIEKYGEEN  544
            +  +               ++  + D D++ T + +     +G   + E + + K    N
Sbjct  397  SVHMRTASPVATKPSKELPDDKLMDDPDRMRTRMRSGEVFPFGIYTVPEISMVGK----N  452

Query  545  LEIYHQNFTPLEWSLSSDREAAG-------SCYVKVI-CDTKRNKHVVGFHYLGPNAGEV  596
             +   Q   P E  ++   E A          ++K+I C       ++G H +G  A E+
Sbjct  453  EQQLTQEQVPYEVGMARYEELARGQMLGGVPGFLKIIFCPN--TLQILGVHAIGEGATEI  510

Query  597  TQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
                 + M  G T +   N V  +PT AE +
Sbjct  511  IHIGQVVMSTGGTLEYFRNAVMNYPTLAEAY  541

>PHYKE_2864
Length=486

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 117/489 (24%), Positives = 197/489 (40%), Gaps = 80/489 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ E++K GK+V ++D            LGG CV+ G IP K   +
Sbjct  34   YDLVVIGSGPSATQCALESAKQGKRVAIVD--------KKTSLGGVCVHTGTIPSKTFRE  85

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            + ++  + ++    +G +   +T     +L  V   + S     + +L+  +V       
Sbjct  86   A-VLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSETDVVRAQLKAARVDVIPGFA  144

Query  285  SFVDAHTLELWHPKK---------------GTKTVTTRDVVIAVGGRP--KPLSCEGGDL  327
             F + H + +   +                    V     +IA G RP   PL    G +
Sbjct  145  RFENEHEISIVRGEDEKSKAVGASASNGLDSLSRVRADKFLIACGTRPAHNPLVPIDGKV  204

Query  328  AISSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMVRSILLRGFDQDMA  384
             I SD I  R   + P   +VVGA  + +E A  +  + G+ V ++              
Sbjct  205  IIDSDQILSRDMHQLPRSLIVVGAGVIGMEYASMVNVVPGHSVTVV--------------  250

Query  385  NKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPD  444
               G    T+ +++              SG++L             + D +L   GR   
Sbjct  251  --DGRPDTTDKRVKVF----------FNSGKVL-------------SADALLYTVGRQAS  285

Query  445  VAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRL  503
               L L+ VG+  N + G I V  N QT  P+IYA GD I AP L   +++ GRL +  +
Sbjct  286  TDGLNLEAVGLSRNHR-GLINVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHM  344

Query  504  YNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWS  558
            +N +     T+ ++       ++T  E    G +E+   +     N EI    ++ L   
Sbjct  345  WNPDEELAATSQLESGNYPYGIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYSELAKG  402

Query  559  LSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVG  618
                  A G+  +K++ D    K V G H +G  A E+     +AM +G +     + V 
Sbjct  403  QMMGAMAGGT--LKILFDPDTLK-VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVF  459

Query  619  IHPTTAEIF  627
             +PT AE +
Sbjct  460  NYPTLAEAY  468

>H310_07641
Length=548

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 130/514 (25%), Positives = 212/514 (41%), Gaps = 76/514 (15%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K+GKKV ++D             GG CV+ G IP K   +
Sbjct  41   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  92

Query  225  SSLIGETIHKDAKAFGWT---------------------VGEQTFDWSQMLKSVNSYIKS  263
            + ++  T H+    +G                       V E   D ++   + N  I  
Sbjct  93   A-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEEAETDLTRNQLTRNGIILI  151

Query  264  INFKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPL  320
                  ++  DKK        S+ +    +  +     K V T D V+IAVG RP   P 
Sbjct  152  NGTARFLQTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARHPD  211

Query  321  SCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILL  376
                G L   SD + W      P + +VVGA  + +E A  +  + G  V ++  R  +L
Sbjct  212  LEYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEIL  271

Query  377  RGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLES---GQLLVKWVSADGETCEEAFD  433
               D+++++ +  +M         R    +SI K+E+    +++V   S  G+      D
Sbjct  272  DMADKEVSDALCYYMRQRGS----RFLTEESILKVETKDDSEVVVHLTS--GKVI--MGD  323

Query  434  TVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVA  492
             +L   GR  +VA L L+ VG+  N K G + V N  QT+ P+IYA GD I  P L   +
Sbjct  324  ALLYTQGRQGNVAGLDLEAVGLSAN-KRGILEVNNNFQTAVPHIYAAGDCIGYPALASTS  382

Query  493  IQAGRLLARRLYNNE------------------TALMDYDKVCTAVFTPIEYGCCGLSEE  534
            ++ GRL +  +  +E                  T +   +     ++T  E    G SE 
Sbjct  383  MEQGRLASVHMRTSEPTNKLRPDAEVHDPAHPRTRMRSGEVFPFGIYTVPEISMVGKSE-  441

Query  535  ASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI-CDTKRNKHVVGFHYLGPNA  593
               ++  +EN+  Y       E             ++K+I C T     ++G H +G  A
Sbjct  442  ---QQLSKENIP-YEVGIARYEELAKGQMLGGMPGFLKLIFCPTTLK--LLGVHAIGEGA  495

Query  594  GEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             E+     + M  G T +   N V  +PT AE +
Sbjct  496  TEIIHIGQVVMSTGGTMEYFRNAVFNYPTLAEAY  529

>PYU1_G005699
Length=550

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 131/511 (26%), Positives = 212/511 (41%), Gaps = 75/511 (15%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K+GK V ++D             GG CV+ G +P K   +
Sbjct  50   FDLIVIGSGPAGQKCAIDSAKHGKSVAIIDKRDMH--------GGVCVHTGTVPSKTFRE  101

Query  225  SSLIGETIHKDAKAFGWTVGEQTF---DWSQMLKSVNSYIKSIN----FKYKVELRDKKV  277
            ++L        +   G +   + F   D  Q +K V      I      +  VEL +   
Sbjct  102  ATLHLTAYRHRSFYDGQSSPTKRFGIEDILQRVKKVEHAETDITRHQLLRNGVELINGTA  161

Query  278  KY-----ENLLGSFV-DAHTLELWHPKKGT-----KTVTTRDVVIAVGGRP--KPLSCEG  324
            ++     +N++     D++T      +  +     + +T    +IAVG RP  +P     
Sbjct  162  RFLPDANKNMIAVLSNDSYTTATDAKRHASADICKRVLTADKFLIAVGTRPARRPDIPFD  221

Query  325  GDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFD  380
            G     SD + W   K  P + +VVGA  + +E A  M  + G +V I+  R  +L   D
Sbjct  222  GQAVFDSDQLLWGGVKTVPKRLIVVGAGVIGMEYASMMSIIPGMEVTIIDGRKEILDMAD  281

Query  381  QDMANKIGEFM----------ETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEE  430
            ++++  +   M          ET   +E + G V   I  L SG+ LV            
Sbjct  282  REVSEALCYSMRQTGARFFVEETIKSVEKVNGEV---IVHLNSGKTLVG-----------  327

Query  431  AFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAV-TNEQTSTPNIYAIGDVIDAPELT  489
              D +L   GR  +   L L  VG++ + K G I V  N QT+ P+IYA GD I  P L 
Sbjct  328  --DGLLYTLGRQGNTDGLNLPAVGLEAD-KRGLIQVDENFQTAVPHIYAAGDCIGFPALA  384

Query  490  PVAIQAGRLLARRLYNNETALMDYDKVCTA---VFTPIEYGCC---GLSEEASIEKYGEE  543
              +++ GRL +  +   +      D   T    + T +  G     G+     I   G+ 
Sbjct  385  STSMEQGRLASVHMRTEKPTNKTGDSESTDPQFMRTRMRSGDVFPFGIYTVPEISMVGKN  444

Query  544  NLEIYHQNFTPLEWSLSSDREAAGSC-------YVKVICDTKRNKHVVGFHYLGPNAGEV  596
              ++  +N  P E  L+   E A          ++K+I   K    ++G H +G  A E+
Sbjct  445  EQQLTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPK-TLQLLGVHAIGEGATEI  502

Query  597  TQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
                 + M  G T +   N V  +PT AE +
Sbjct  503  IHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  533

>PYIR_21896
Length=518

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 124/493 (25%), Positives = 211/493 (43%), Gaps = 59/493 (12%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            +YDL+VIG G     C+ E++K GK+V V+D            +GG CV+ G IP K   
Sbjct  37   NYDLVVIGSGPSATQCAIESAKKGKRVAVVD--------KKTFVGGVCVHTGTIPSKTFR  88

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            ++ ++  + ++    +G +   +T     +L  V   + S     +V++   +   +   
Sbjct  89   EA-VLHLSGYRHHGFYGKSYSMKTVTIDDILYRVKRVVNS-----EVDISIVRDTPDAAG  142

Query  284  GSFVDAHTLELWHPKKGTKTVTTRD-VVIAVGGRP--KPLSCEGGDLAISSDDIFWR--K  338
            G   D+      H    T +    D  +IA G RP   PL    G +   SD I     +
Sbjct  143  GDAGDSD-----HDAANTVSRLRADKFLIACGTRPAHNPLVPIDGKVIFDSDQILSGDIR  197

Query  339  EAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETESK  396
            E P   +VVGA  + +E A  M  + G+ V ++  RS +L   D ++ + +   M ++  
Sbjct  198  ELPRSLIVVGAGVIGMEYASMMNVVPGHSVTVVDGRSEILSFCDDEIISNLTYEMRSKGA  257

Query  397  IEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVK  456
              F+ G   + + K ESG + V + S    +     D +L   GR      L L+ V + 
Sbjct  258  -RFLLGETIKHVEKTESG-VTVHFNSGKITSA----DALLYTVGRQAATDGLNLEAVDLS  311

Query  457  LNPKTGRIAVTNEQTSTPNI------------------YAIGDVIDAPELTPVAIQAGRL  498
             NP+       + QT+ P++                  YA GD I AP L   +++ GRL
Sbjct  312  RNPRGLLTVNKSYQTNQPHMPVLQMGFAHSISDENVCSYAAGDCIGAPSLASTSMEQGRL  371

Query  499  LARRLYNNE----TALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTP  554
             A  +++ E    T+ ++       ++T  E    G +E+  + K G  N EI    ++ 
Sbjct  372  AACHMWDQEEQLVTSQLENGNYPYGIYTIPEISMVGKTEQ-QLTKEG-LNFEIGIAKYSE  429

Query  555  LEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMV  614
            L     S   A G   +K++ D    K + G H +G  A E+     +AM +G +     
Sbjct  430  LAKGQMSGSTAGG--MLKILFDPTTLK-LFGVHAIGEGATEIIHIGQVAMAMGCSITYFR  486

Query  615  NVVGIHPTTAEIF  627
            + V  +PT AE +
Sbjct  487  DAVFNYPTLAEAY  499

>PYIW_24688
Length=259

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 136/279 (49%), Gaps = 37/279 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD I IGGGSGG+A ++ A+ +G KV V++  +    G + GLGGTCV+ GC+PKK+M  
Sbjct  7    YDYISIGGGSGGMASARRAATFGAKVLVVE--RGRKYGGA-GLGGTCVHYGCVPKKIMFN  63

Query  225  SSLIGETIHKDAKAFGWTVGEQT-----FDWSQMLKSVNSYIKSINFKYKVELRDKKVKY  279
            ++   E +++ A     T G        FDW+ M    ++YI  +N  Y+  L + +V  
Sbjct  64   AATHVEHLNRAADYSITTNGAHKYQFGDFDWANMKTKRDAYILRLNGIYERNLGNAQVDL  123

Query  280  ENLLGSFVDAHTLELWHPKKGTKTVTTRDVVIAVGGRPKPLSCEGGDLAISSDDIFWRKE  339
               +   V  + +E+          T + +++AVGG+P               D F++ E
Sbjct  124  VEGVAKLVAKNQVEV-----DGVVYTGKHILVAVGGKP---------------DGFFKLE  163

Query  340  A-PGKTLVVGASYVALECAGFMKGMGYDVKIMVR-SILLRGFD---QDMANKIGEFMETE  394
            A P K  VVGA Y+A+E AG    +  D  +  R   +LR FD   +D+ N+ GE    +
Sbjct  164  AQPKKVAVVGAGYIAIEIAGIFNTLKSDTSLFCRFDHVLRTFDPIVRDLINEEGE----K  219

Query  395  SKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFD  433
            + I F+R +  + I K   G L +       E     FD
Sbjct  220  AGINFVRNSRIERIEKQADGSLTITAKVNGEEQVLAGFD  258

>PPTG_13000
Length=387

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 100/386 (26%), Positives = 169/386 (44%), Gaps = 24/386 (6%)

Query  253  MLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLEL-WHPKKGTKTVTTRDVVI  311
            M+K+    +K++    +   +  KV Y    G       + +  +  KG +TV  ++++I
Sbjct  1    MMKAKEKAVKTLTGGIESLFKKNKVTYIKGHGKISAQGEVSVALNDNKGNETVKAKNIII  60

Query  312  AVGGR-----PKPLSCEGGDLAISSDDIFWRKEAPGKTLVVGASYVALECAGFMKGMGYD  366
            A G       P P+    G + I S      K  P   +VVGA  + LE     K +G  
Sbjct  61   ATGSEVTPLPPVPVDNAAGKI-IDSTGALELKRVPEHLVVVGAGVIGLELGSVYKRLGAK  119

Query  367  VKIM-VRSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWV---S  422
            V ++        G D++   +  + ++ +  ++F  G     +T  E    +VK     S
Sbjct  120  VTVVEFLDAACPGMDKEAVKEFTKLLKKQG-LDFKFGT---KVTSSEVNGDVVKLTTEPS  175

Query  423  ADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGD  481
              G+      DTVL ATGR    A LGL+++G++ + K GRI V +  +T  P I+AIGD
Sbjct  176  KGGDASTIECDTVLVATGRRAFTAGLGLEQMGIQTD-KLGRIEVDDAFRTQVPGIFAIGD  234

Query  482  VIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEEASIEKYG  541
            VI    L   A + G      +       ++Y  V   ++T  E+   G +EE    +  
Sbjct  235  VIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAVPGVIYTFPEFASVGKTEE----ELK  289

Query  542  EENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVTQAIG  601
             E +E Y+    P+  +  +   A     VKV+ D K +K ++G H +  NAGE+     
Sbjct  290  AEGIE-YNVGKFPMMANSRARTVAESDGLVKVLADKKTDK-LLGVHIIASNAGEMIAEGV  347

Query  602  LAMKLGFTYDQMVNVVGIHPTTAEIF  627
            + ++ G   + +      HPT +E F
Sbjct  348  IGIEYGAASEDLARTCHAHPTLSEAF  373

>HYAP_04149
Length=564

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 128/516 (25%), Positives = 217/516 (42%), Gaps = 73/516 (14%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ +++K+G  V ++D            LGG CV+ G +P K   +
Sbjct  53   FDLIVIGSGPAGQKCAIDSAKHGYSVAIVD--------KRDMLGGVCVHTGTVPSKTFRE  104

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
            ++L        A   G     +      +L+ VN   K+     + +L    V+      
Sbjct  105  AALHLTGYRHRAFYNGQAGPSKRVGVEDILQRVNKVEKAETDITRHQLMRNGVQLITGTA  164

Query  285  SFV--DAHTLELW-------------HPKKGT--KTVTTRDVVIAVGGRPK-----PLSC  322
             F+  ++H + +              H       + +T  + ++ VG RP      P   
Sbjct  165  RFMPGNSHMIAVLSNESYETATDAKRHSSANICKRVLTADNFLVCVGTRPARRADIPFD-  223

Query  323  EGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRG  378
              G+    SD + W   K  P + +VVGA  V +E A  M  + G DV ++  R  +L  
Sbjct  224  --GETIFDSDQLLWGKVKAVPRRLIVVGAGVVGMEYASMMSIIPGTDVTVIDGRKEILEM  281

Query  379  FDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLNA  438
             D++++  +   M  ++   F+   V +S+ K   G++ V   S  G+T     D +L  
Sbjct  282  ADKEVSEALCYSM-AQTGTRFLVDEVIKSVEKSAKGEVGVHLES--GKTV--VGDGLLYT  336

Query  439  TGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYA---------IGDVIDAPEL  488
             GR  +V  L L+ VG+  + K GRI V N  QT+ P++YA          GD+I  P L
Sbjct  337  VGRQGNVEGLNLEAVGLAPD-KRGRIIVDNNFQTAVPHMYAQSRLIADQNAGDIIGFPAL  395

Query  489  TPVAIQAGRL------LARRLYNNETA----LMDYDKVCTAVFTPIEYGCCGLSEEASIE  538
               +++ GRL       ++  Y  E +    + D D+V T + +  E    G+     I 
Sbjct  396  ASTSMEQGRLASVHMRTSKSFYTKEISDDKKMDDPDRVRTRMRSG-EVFPFGIYTVPEIS  454

Query  539  KYGEENLEIYHQNFTPLEWSLSSDREAAGSC-------YVKVICDTKRNKHVVGFHYLGP  591
              G+   ++  +   P E  ++   E A          ++K+I   K  K ++G H +G 
Sbjct  455  MVGKNEQQLTREQ-VPYEVGIARYEELAKGQMLGGVPGFLKIIFCPKTLK-LLGVHAIGE  512

Query  592  NAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             A E+     + M    T +   N V  +PT AE +
Sbjct  513  GATEIIHIGQVVMSTDGTLEYFRNAVFNYPTLAEAY  548

>PYAP_19148
Length=535

 Score = 93.6 bits (231),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 121/520 (23%), Positives = 217/520 (42%), Gaps = 80/520 (15%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ + +K+GK V ++D             GG CV+ G +P K   +
Sbjct  11   FDLIVIGSGPAGQKCAIDHAKHGKSVAIIDKKDMH--------GGVCVHTGTVPSKTFRE  62

Query  225  SSLIGETIHKDAKAF-GWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            + ++  T H+    + G +  ++ F    +L+ V     +     + +L    ++  N  
Sbjct  63   A-ILHLTAHRHRSFYDGASKPKKRFGIEDILQRVRKVENAETDITRHQLLRNGIELINGT  121

Query  284  GSFVDAHTLEL--------WHPKKGTKTVTTRDV---------------------VIAVG  314
              F+   + ++        +     TK  T+ D+                     ++AVG
Sbjct  122  ARFLPDPSKKMVAVLSNDSYETATDTKRHTSADICKRTGADSSILLISVLTADKFLVAVG  181

Query  315  GRPK-----PLSCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYD  366
             RP      P     G     SD I W      P + +VVGA  + +E A  M  + G +
Sbjct  182  TRPARRADIPFD---GKTIFDSDQILWGGVDAVPKRLIVVGAGVIGMEYASMMSIIPGSE  238

Query  367  VKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADG  425
            V ++  R  +L   D+++A  + ++   ++   F       ++ K  +G+++VK  S  G
Sbjct  239  VTVIDGRKEILDMADKEVAEAL-KYAMRQTGTRFYTDETINTVEKAANGEVIVKLNS--G  295

Query  426  ETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVID  484
            +T     D +L   GR  +   L L  VG++ + K G + V  N +TS P+IYA GD I 
Sbjct  296  KTI--VGDGLLYTVGRQGNTDGLNLAAVGLEAD-KRGLLKVDDNFRTSVPHIYAAGDCIG  352

Query  485  APELTPVAIQAGRL----------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLSEE  534
             P L   +++ GRL          + ++  +NE +   Y +          +G   + E 
Sbjct  353  YPALASTSMEQGRLASVHMRSEKPVNKKRADNEPSDPSYQRTRMRSGEVFPFGIYTVPE-  411

Query  535  ASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSC-------YVKVICDTKRNKHVVGFH  587
              I   G+   ++  +N  P E  ++   E A          ++K++    ++  V+G H
Sbjct  412  --ISMVGKSEQQLTRENI-PYEVGVARYEELAKGQMLGGVPGFLKIVF-CPKSLQVLGVH  467

Query  588  YLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  468  AIGEGATEIIHIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  507

>H257_07450
Length=567

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 100/375 (27%), Positives = 166/375 (44%), Gaps = 50/375 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DL+VIG G  G  C+ +++K+GKKV ++D             GG CV+ G IP K   +
Sbjct  39   FDLVVIGSGPAGQKCAIDSAKHGKKVAIIDKKDMH--------GGVCVHTGTIPSKTFRE  90

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL-  283
            + ++  T H+    +G      T      L+ +   +K +        R++  +   +L 
Sbjct  91   A-VLHLTAHRHKGFYGNAYTASTTGKRLSLEEILDRVKKVEDAETDLTRNQLTRNGIILI  149

Query  284  ---GSFV---DAHTLELWHPKKGT---------------KTVTTRDVVIAVGGRP--KPL  320
                 F+   D  T+ +      T               + +T   V+IAVG RP  +P 
Sbjct  150  NGTARFLPTEDKKTIAVLSNDSYTEKTDAQRHNDANICKRVLTADKVLIAVGTRPARRPD  209

Query  321  SCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILL  376
                G L   SD + W      P + +VVGA  + +E A  +  + G  V ++  R  +L
Sbjct  210  LDYDGRLIFDSDQLLWGGVDIVPKRLIVVGAGVIGMEYASMISIIPGTQVTVIDGRKEIL  269

Query  377  RGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLES---GQLLVKWVSADGETCEEAFD  433
               D+++++ +  +M         R    +SI K+E+    ++LV   S  G+      D
Sbjct  270  DMADKEVSDALCYYMRKRGS----RFLTEESIVKVETKDNSEVLVYLTS--GKVI--VGD  321

Query  434  TVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVA  492
             +L   GR  +VA L L+ VG+  N K G + V N  QT  P+IYA GD I  P L   +
Sbjct  322  ALLYTQGRQGNVAGLDLEAVGLAAN-KRGVLDVNNNFQTDVPHIYAAGDCIGYPALASTS  380

Query  493  IQAGRLLARRLYNNE  507
            ++ GRL +  +  +E
Sbjct  381  MEQGRLASVHMRTSE  395

>HYAP_08069
Length=255

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 101/213 (47%), Gaps = 15/213 (7%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMH  223
            DYDL+VIGGG GG   + +A++ G K   ++        +   LGGTC+NVGCIP K + 
Sbjct  34   DYDLVVIGGGPGGYVAAIKAAQLGLKTACVE--------SRGKLGGTCLNVGCIPSKALL  85

Query  224  QSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
             S+ +  T   + K++G      T ++ QM+K+    ++++    +      KV Y   +
Sbjct  86   HSTHLLHTAQHEFKSYGIDAPNVTANFPQMMKAKEKAVRTLTAGIESLFSKNKVTYIKGV  145

Query  284  GSFVDAHTLEL-WHPKKGTKTVTTRDVVIAVGGR-----PKPLSCEGGDLAISSDDIFWR  337
            G       + +    ++G  T+T +++++A G       P P+  + G + + S      
Sbjct  146  GKLAAKGQVSVTLADRQGNGTLTAKNIILATGSEVTPLPPVPVDNDAGKI-VDSTGALAL  204

Query  338  KEAPGKTLVVGASYVALECAGFMKGMGYDVKIM  370
               P   +VVGA  + LE     K +G  V ++
Sbjct  205  TRVPEHLVVVGAGVIGLELGSVYKRLGAKVTVV  237

>PHYSO_489418
Length=471

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 198/462 (43%), Gaps = 50/462 (11%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINF  266
            +GG CV+ G +P K   +++L        A   G     + F    +L+ V     +   
Sbjct  2    MGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSKRFGVEDILQRVKKVEDAETD  61

Query  267  KYKVELRDKKVKYENLLGSFV--DAHTL-----ELWHPKKGTKTVTTRDV----------  309
              + +L    V+  N    F+  + H +     E +      K  T+ D+          
Sbjct  62   ITRHQLMRNGVQLINGTARFLPGNNHMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  310  VIAVGGRP--KPLSCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-G  364
            ++ VG RP  +P     G+    SD + W   K  P + +VVGA  V +E A  M  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGKVKTVPRRLIVVGAGVVGMEYASMMTIIPG  181

Query  365  YDVKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSA  423
             DV ++  R  +L   D++++  +   M  ++   F+ G   +S+ K   G++ V   S 
Sbjct  182  TDVTVIDGRQEILNMADKEVSEALCYSM-AQTGTRFLVGETIKSVEKTPKGEVFVHLES-  239

Query  424  DGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDV  482
             G+T     D +L   GR  +V  L L+ VG+ +  K GRI V N  QT+ P+IYA GD+
Sbjct  240  -GKTV--VGDGLLYTVGRQGNVEGLNLEAVGL-VPDKRGRIKVDNNFQTAVPHIYAAGDI  295

Query  483  IDAPELTPVAIQAGRL----------LARRLYNNETALMDYDKVCTAVFTPIEYGCCGLS  532
            I  P L   +++ GRL          L  +  +++  + D D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNNKELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  533  EEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAG-------SCYVKVICDTKRNKHVVG  585
                I   G+   ++  +   P E  ++   E A          ++K+I   +  K ++G
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGMARYEELARGQMLGGLPGFLKIIFCPETLK-ILG  412

Query  586  FHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  413  VHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>CCI39993
Length=550

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 122/515 (24%), Positives = 200/515 (39%), Gaps = 82/515 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDLIVIG G  G  C+ +++K+GK V ++D         +   GG CV+ G +P K   +
Sbjct  45   YDLIVIGSGPAGQKCAIDSAKHGKSVAIID--------KNEMHGGVCVHTGTVPSKTFRE  96

Query  225  SSLIGETIHKDAKAF-GWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            + ++  T H+    + G +  ++ F    +L  V     +     + +L    V+  N  
Sbjct  97   A-ILHLTAHRHRNFYTGLSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNNVELINGT  155

Query  284  GSFVDAHT-----LELWHPKK-------------GTKTVTTRDVVIAVGGRPKPLS--CE  323
              F+   +      ++ H K+               K +T    +IAVG RP        
Sbjct  156  ARFLPDPSKKMLYYQIAHLKQQRMEIAIFELIFVNGKILTADKFLIAVGTRPARRDDIVF  215

Query  324  GGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGF  379
             G +   SD I W   K  P + +VVGA  + +E A  M  + G  V ++  R  +L   
Sbjct  216  DGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEMA  275

Query  380  DQDMANKIGEFMETESKIEFIRGAVP--------QSITKLESGQLLVKWVSADGETCEEA  431
            D+++   +   M       ++   +         + I  L SG+ +V             
Sbjct  276  DREVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVIIHLNSGKTIVG------------  323

Query  432  FDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTP  490
             D +L   GR  +   L L  +G++ + K G I V  N QTS P+IYA GD    P L  
Sbjct  324  -DGLLYTVGRQGNTEGLDLSAIGLQTD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALAS  381

Query  491  VAIQAGRLLARRLYNN-----------------ETALMDYDKVCTAVFTPIEYGCCGLSE  533
             +++ GRL +  +  +                  T +   D     ++T  E    G   
Sbjct  382  TSMEQGRLASVHMRTSMPTNTSGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVG-KN  440

Query  534  EASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI-CDTKRNKHVVGFHYLGPN  592
            E  + K G      Y       E             ++K+I C T  N  ++G H +G  
Sbjct  441  EYQLTKEGIA----YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHAIGEG  494

Query  593  AGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            A E+     + M  G T +   N V  +PT AE +
Sbjct  495  ATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  529

>PYVX_23499
Length=519

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 123/510 (24%), Positives = 212/510 (42%), Gaps = 68/510 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIV+G G  G  C+ +++K+GK V ++D            LGG CV+ G +P K   +
Sbjct  15   FDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KRDMLGGVCVHTGTVPSKTFRE  66

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNS-------YIKSINFKYKVELRDKKV  277
            ++L        A     +V  +  +   +L+ V+          +    +  VEL     
Sbjct  67   ATLHLTGYRHRAFYDSASVSSRRLEIDDILQRVHKVEGAETDITRHQLMRNNVELIHGTA  126

Query  278  KY-----ENLLGSFVDAHTLELWHPKKGT------KTVTTRDVVIAVGGRPK-----PLS  321
            ++      N++    +A        K+ T      + +T    +I VG RP      P  
Sbjct  127  RFLPDEKRNMVAVLSNAKYDTPTDAKRHTSADICKRVLTADKFLICVGTRPARREDIPFD  186

Query  322  CEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLR  377
               G     SD + W   K AP + +VVGA  + +E A  M  + G +V ++  R  +L 
Sbjct  187  ---GKTIFDSDQLLWGGVKAAPRRLIVVGAGVIGMEYASMMSIIPGTEVTVIDGRKEILD  243

Query  378  GFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSADGETCEEAFDTVLN  437
              D++++  +   M  ++   F      + + K E+G+++    S  G+      D +L 
Sbjct  244  MADKEVSESLCYSMR-QTGTRFYTEESIKKVEKRENGEVVAHLNS--GKVI--VGDGLLY  298

Query  438  ATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAG  496
              GR  +   L L  VG++ + K G + V ++ QT  P+IYA GD I  P L   +++ G
Sbjct  299  TLGRQGNTDGLNLQAVGLETD-KRGFLNVNDDFQTEVPHIYAAGDCIGYPALASTSMEQG  357

Query  497  RLLARRLYNN-------ETALMDYDKVCTAVFTPIEYGCC---GLSEEASIEKYGEENLE  546
            RL +  +          E A  +       +   +  G     G+     I   G+   +
Sbjct  358  RLASVHMRTESPTNKVGEEASDELGGDANRIRWRMRSGEVFPFGIYTIPEISMVGKNEQQ  417

Query  547  IYHQNFTPLEWSLSSDREAAGSC-------YVKVI-C-DTKRNKHVVGFHYLGPNAGEVT  597
            +  +N  P E  L+   E A          ++K+I C DT +   V+G H +G  A E+ 
Sbjct  418  LTKEN-VPYEVGLARYEELAKGQMLGGVPGFLKIIFCPDTLK---VLGVHAIGEGATEII  473

Query  598  QAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
                + M  G T +   N V  +PT AE +
Sbjct  474  HIGQVVMSTGGTIEYFRNAVFNYPTLAEAY  503

>CCA14030
Length=560

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 118/515 (23%), Positives = 201/515 (39%), Gaps = 82/515 (16%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDLIV+G G  G  C+ +++K+GK V ++D         +   GG CV+ G +P K   +
Sbjct  55   YDLIVVGSGPAGQKCAIDSAKHGKSVAIID--------KNEMHGGVCVHTGTVPSKTFRE  106

Query  225  SSLIGETIHKDAKAF-GWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLL  283
            + ++  T H+    + G +  ++ F    +L  V     +     + +L    V+  N  
Sbjct  107  A-ILHLTAHRHRNFYTGMSSPKKRFGIEDILTRVRKVENAETDITRHQLVRNNVELINGT  165

Query  284  GSFVDAHTLEL------------------WHPKKGTKTVTTRDVVIAVGGRP--KPLSCE  323
              F+   +  +                  +      + +T    +IAVG RP  +     
Sbjct  166  ARFLPDPSKNMVAVLSNSSYETATDGNRHFRANICQRILTADKFLIAVGTRPARRDDVVF  225

Query  324  GGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-GYDVKIMV-RSILLRGF  379
             G +   SD I W   K  P + +VVGA  + +E A  M  + G  V ++  R  +L   
Sbjct  226  DGQMIFDSDQILWGGVKSVPKRLIVVGAGVIGMEYASMMSIIPGAQVTVIDGRKEILEMA  285

Query  380  DQDMANKIGEFMETESKIEFIRGAVP--------QSITKLESGQLLVKWVSADGETCEEA  431
            D+++   +   M       ++   +         + IT L SG+ +V             
Sbjct  286  DREVVEALTYAMRQTGSRFYMEETIKCVELSNKDEVITHLNSGKTVVG------------  333

Query  432  FDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDVIDAPELTP  490
             D +L   GR  +   L L  +G++ + K G I V  N QTS P+IYA GD    P L  
Sbjct  334  -DGLLYTVGRQGNTEGLDLSAIGLETD-KRGLIKVNENFQTSVPHIYAAGDCTGFPALAS  391

Query  491  VAIQAGRLLARRLYNN-----------------ETALMDYDKVCTAVFTPIEYGCCGLSE  533
             +++ GRL +  +  +                  T +   D     ++T  E    G +E
Sbjct  392  TSMEQGRLASVHMRTSMPTNTTGHAEPTDPQHMRTRMRSGDFFPFGIYTVPEISMVGKNE  451

Query  534  EASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVI-CDTKRNKHVVGFHYLGPN  592
                 +  +E +  Y       E             ++K+I C T  N  ++G H +G  
Sbjct  452  ----HQLTKEGIA-YEVGVARYEELAKGQMLGGVPGFLKIIFCPTTLN--ILGVHAIGEG  504

Query  593  AGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            A E+     + M  G T +   N V  +PT AE +
Sbjct  505  ATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  539

>PITG_01778
Length=470

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 116/464 (25%), Positives = 197/464 (42%), Gaps = 54/464 (12%)

Query  207  LGGTCVNVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTF---DWSQMLKSVNSYIKS  263
            LGG CV+ G +P K   +++L        A   G     + F   D  Q ++ V      
Sbjct  2    LGGVCVHTGTVPSKTFREAALHLTGYRHKAFYNGQAGPSRRFGVEDILQRVRKVEDAETD  61

Query  264  IN----FKYKVELRDKKVKYENLLGSFVDAHTLELWHPKKGTKTVTTRDV----------  309
            I      +  V+L +   ++     + V   + E +      K  T+ D+          
Sbjct  62   ITRHQLLRNGVQLINGTARFLTGNKNMVAVLSNESYETATDAKRHTSADICKRVLTADKF  121

Query  310  VIAVGGRP--KPLSCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVALECAGFMKGM-G  364
            ++ VG RP  +P     G+    SD + W   K  P + ++VGA  V +E A  M  + G
Sbjct  122  LVCVGTRPARRPDIPFDGETIFDSDQLLWGNVKSVPRRLIIVGAGVVGMEYASMMTIIPG  181

Query  365  YDVKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSA  423
             DV ++  R  +L   D+ ++  +   M  ++   F+ G   +S+ K   G++     S 
Sbjct  182  TDVTVIDGRQEILNMADKQVSEALCYSM-AQTGTRFLTGETIKSVEKSPKGEVFAHLES-  239

Query  424  DGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYAIGDV  482
             G+T     D +L   GR  +V  L L+ VG+  + K GRI V N  QT+ P+IYA GD+
Sbjct  240  -GKTV--VGDGLLYTVGRQGNVEGLNLEAVGLAPD-KRGRIKVDNNFQTAVPHIYAAGDI  295

Query  483  IDAPELTPVAIQAGRLLARRL----------YNNETALMDYDKVCTAVFTPIEYGCCGLS  532
            I  P L   +++ GRL +  +           +++  + D D+V T + +  E    G+ 
Sbjct  296  IGFPGLASTSMEQGRLASVHMRTSKPLNDLELSDDKKMDDPDRVRTRMRSG-EVFPFGIY  354

Query  533  EEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGS-------CYVKVI-C-DTKRNKHV  583
                I   G+   ++  +   P E  ++   E A          ++K+I C DT +   +
Sbjct  355  TVPEISMVGKNEQQLTKEQ-VPYEVGVARYEELARGQMLGGVPGFLKIIFCPDTLK---I  410

Query  584  VGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
             G H +G  A E+     + M  G T +   N V  +PT AE +
Sbjct  411  FGVHAIGEGATEIIHIGQVVMSTGGTLEYFRNAVFNYPTLAEAY  454

>PYAR_16664
Length=577

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 99/388 (26%), Positives = 168/388 (43%), Gaps = 72/388 (19%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +DLIVIG G  G  C+ + +K+GK V ++D            +GG C++ G +P K   +
Sbjct  64   FDLIVIGSGPAGQKCAIDHAKHGKSVAIID--------KRDMVGGVCIHTGTVPSKTFRE  115

Query  225  SSLIGETIHKDAKAF-GWTVGEQTF---DWSQMLKSVNSYIKSIN----FKYKVELRDKK  276
            + ++  T H+    + G +  ++ F   D  Q ++ V S    I      +  +EL +  
Sbjct  116  A-ILHLTAHRHRSFYDGESEPKKRFGIEDVLQRVRKVESAETDITRHQLLRNGIELINGT  174

Query  277  VKYE------------------NLLGSFVDAHTLEL--------WHPKKGTKTVTTRDV-  309
             ++                   N    F+   ++++        +     TK  T+ D+ 
Sbjct  175  ARFXXXXCDRALILLRNGIELINGTARFLPDPSMKMVAVLSNDSYDTPTDTKRHTSADIC  234

Query  310  ---------VIAVGGRPK-----PLSCEGGDLAISSDDIFW--RKEAPGKTLVVGASYVA  353
                     +IAVG RP      P     G     SD I W      P + +VVGA  + 
Sbjct  235  KRVLTADKFLIAVGTRPARREDIPFD---GKTIFDSDQILWGGVDAVPKRLIVVGAGVIG  291

Query  354  LECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKL  411
            +E A  M  + G +V ++  R  +L   D+++A  + ++   +S   F      +S+ K 
Sbjct  292  MEYASMMSIIPGSEVTVIDGRKEILDMADKEVAEAL-KYAMRQSGTRFYTDETIKSVEKA  350

Query  412  ESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQ  470
             +G+++VK  S  G+T     D +L   GR      L L  VG++ + K G + V  N +
Sbjct  351  ANGEVIVKLNS--GKTI--IGDGLLYTVGRQGSTDGLNLAAVGLETD-KRGLLQVDDNFR  405

Query  471  TSTPNIYAIGDVIDAPELTPVAIQAGRL  498
            TS P+IYA GD I  P L   +++ GRL
Sbjct  406  TSVPHIYAAGDCIGYPALASTSMEQGRL  433

>PHYSO_562795
Length=415

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 88/330 (27%), Positives = 152/330 (46%), Gaps = 24/330 (7%)

Query  310  VIAVGGRP--KPLSCEGGDLAISSDDIFWR--KEAPGKTLVVGASYVALECAGFMKGM-G  364
            +IA G RP   PL    G + I SD I  R   + P   +V+GA  + +E A  +  + G
Sbjct  80   LIACGTRPAHNPLVPIDGKVIIDSDQILSRDMHQLPRSLIVMGAGVIGMEYASMVNVVPG  139

Query  365  YDVKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAVPQSITKLESGQLLVKWVSA  423
            + V ++  R  +L   D+++ + +   M++     F+ G   +++ K+E+ +  VK    
Sbjct  140  HSVTVVDGRPDILSFCDREIISNLTYEMQSNGA-RFLLG---ETVKKVETTENRVKVFFD  195

Query  424  DGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVT-NEQTSTPNIYAIGDV  482
             G+    + D +L   GR      L L+ VG+  N + G I V  N QT  P+IYA GD 
Sbjct  196  SGKVL--SADALLYTVGRQASTDGLNLEAVGLSRNHR-GLINVNQNYQTDQPHIYAAGDC  252

Query  483  IDAPELTPVAIQAGRLLARRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEASI  537
            I AP L   +++ GRL +  ++N +     T+ +D       ++T  E    G +E+   
Sbjct  253  IGAPALASTSMEQGRLASCHMWNPDEELKVTSQLDNGNYPYGIYTIPEISMVGQTEQQLT  312

Query  538  EKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGEVT  597
            +     N E+    ++ L         A G+  +K++ D    K + G H +G  A E+ 
Sbjct  313  KDC--VNYEVGIAKYSELAKGQMMGAMAGGT--LKILFDPDTLK-LFGVHAIGEGATEII  367

Query  598  QAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
                +AM +G +     + V  +PT AE +
Sbjct  368  HIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  397

>PITG_19065
Length=416

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 102/409 (25%), Positives = 173/409 (42%), Gaps = 39/409 (10%)

Query  246  QTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLGSFVDAHTLELWHP---KKGTK  302
            +T     +L  V   + S     + +L+  +V        F + H + +      KK   
Sbjct  2    KTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVVPGFARFENEHEISIVRDEDDKKKNS  61

Query  303  TVTTRDVV------------IAVGGRP--KPLSCEGGDLAISSDDIFWR--KEAPGKTLV  346
            +VT R  V            IA G RP   PL    G + I SD I  R   + P   +V
Sbjct  62   SVTGRSNVDSLSRIKADKFLIACGTRPAHNPLIPIDGKVVIDSDQILSRDMHQLPRSLIV  121

Query  347  VGASYVALECAGFMKGM-GYDVKIMV-RSILLRGFDQDMANKIGEFMETESKIEFIRGAV  404
            +GA  + +E A  +  + G+ V ++  R  +L   D+++ + +   M++     F+ G  
Sbjct  122  LGAGVIGMEYASMVNVVPGHTVTVVDGRPDILSFCDREIISNLTYEMQSNGA-RFLLG--  178

Query  405  PQSITKLESGQLLVKWVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRI  464
             +++ K+E+    VK     G+    + D +L   GR      L L+ VG+  N + G I
Sbjct  179  -ETVKKVETTDKRVKVFFNSGKAL--SADALLYTVGRQAATDGLNLEAVGLSRNHR-GLI  234

Query  465  AVT-NEQTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNE-----TALMDYDKVCT  518
             V  N QT  P+IYA GD I AP L   +++ GRL +  ++N +     T+ ++      
Sbjct  235  NVNKNYQTDQPHIYAAGDCIGAPALASTSMEQGRLASCHMWNPDEELAATSQLENGNYPY  294

Query  519  AVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTK  578
             ++T  E    G +E+   +     N EI    ++ L         A G+  +    DT 
Sbjct  295  GIYTIPEISMVGQTEQQLTKDC--VNYEIGIAKYSELAKGQMMGAMAGGTLKILFDPDTL  352

Query  579  RNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            +   V G H +G  A E+     +AM +G +     + V  +PT AE +
Sbjct  353  K---VFGVHAIGEGATEIIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  398

>SPRG_04114
Length=376

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 90/335 (27%), Positives = 157/335 (47%), Gaps = 35/335 (10%)

Query  307  RDVVIAVGGRP--KPLSCEGGDLAISSDDIFWRK--EAPGKTLVVGASYVALECAGFMKG  362
            +  ++A G RP   PL    G + + SD I      + P   +VVGA  + +E A  +  
Sbjct  43   KKFLVACGTRPAHSPLVPCDGKIILDSDQILNHDTTKLPKSWIVVGAGVIGMEYASMLNV  102

Query  363  M-GYDVKIMV-RSILLRGFDQDMANKIGEFMETESK-IEFIRGAVPQSITKLESGQLLVK  419
            + G +V ++  R+ +L   D ++ + +   ME   K   F+ G   +S+   ++G + V+
Sbjct  103  LPGINVTVVDGRAEILSFCDDEIVSSLK--MEMRHKGARFLLGESIKSVEHFKNG-VKVE  159

Query  420  WVSADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNE-QTSTPNIYA  478
            + S      E     +L   GR  +   L L+ VG+  N + G I V  + QTS P+IYA
Sbjct  160  FNSGKAMFAE----ALLYCVGRQANTDGLNLEAVGLSKNHR-GLITVNEQYQTSHPHIYA  214

Query  479  IGDVIDAPELTPVAIQAGRLLARRLYNNE---TALMDYDKVCTAVFTPIEYGCCGLSEEA  535
             GD I AP L   +++ GRL A  +++++   T+ ++       ++T  E    G +E+ 
Sbjct  215  AGDCIGAPSLASTSMEQGRLAACDMWSDKDQTTSQLESGNYPYGIYTIPEISMVGKTEQ-  273

Query  536  SIEKYGEENLEIYHQNFTPL-EWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAG  594
             + K G  N  +    F+ L +  +S D E      +K++ D   +  ++G H +G  A 
Sbjct  274  QLTKEG-ANYAVGLAKFSELAKGQMSGDIEG----ILKLLFDPV-SLQLLGVHAIGHGAT  327

Query  595  EVTQ--AIGLAMKLGFTY--DQMVNVVGIHPTTAE  625
            E+     + +AM    TY  D + N    +PT AE
Sbjct  328  EIIHIGQVAMAMNCKITYFRDAVFN----YPTLAE  358

>HYAP_13613
Length=423

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 91/216 (42%), Gaps = 28/216 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YDL+VIG G     C+ +++K GK+V ++D            LGG CV+ G IP K   +
Sbjct  33   YDLVVIGSGPSATQCALDSAKQGKRVAIVD--------KKTRLGGVCVHTGTIPSKTFRE  84

Query  225  SSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVELRDKKVKYENLLG  284
             +++  + ++    +G +   +T     +L  V   + S     + +L+  +V       
Sbjct  85   -AVLHLSGYRHHGFYGKSYSMKTVTIEDILYRVQRVVSSEEDVVRAQLKAARVDVIPGFA  143

Query  285  SFVDAHTLELWH---PKKGTKT------------VTTRDVVIAVGGRP--KPLSCEGGDL  327
             F  AH + +      K   +T            V     ++A G RP   PL    G +
Sbjct  144  RFESAHEISIVKEGAAKDKAETGQCSNNMDARTRVRADKFLVACGTRPAHNPLVPIDGKI  203

Query  328  AISSDDIFWR--KEAPGKTLVVGASYVALECAGFMK  361
             I SD I  R  ++ P   +VVGA  + +E A  + 
Sbjct  204  VIDSDQILKRGMQQLPRSLIVVGAGVIGMEYASMIN  239

 Score = 33.5 bits (75),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 36/152 (24%), Positives = 66/152 (43%), Gaps = 10/152 (7%)

Query  481  DVIDAPELTPVAIQAGRLLARRLYNNE-----TALMDYDKVCTAVFTPIEYGCCGLSEEA  535
            D I AP L   +++ GRL +  ++  +     T+ ++       ++T  E    G +E+ 
Sbjct  259  DCIGAPALASTSMEQGRLASCHMWEVDEEHAGTSQLENGNYPYGIYTIPEISMVGQTEQQ  318

Query  536  SIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGPNAGE  595
              +     N EI    ++ L         A G+  +K++ D    K V+G H +G  A E
Sbjct  319  LTKDC--VNYEIGIAKYSELAKGQMMGAMAGGT--LKILFDPDTLK-VLGVHAIGEGATE  373

Query  596  VTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            +     +AM +G +     + V  +PT AE +
Sbjct  374  IIHIGQVAMAMGCSLTYFRDAVFNYPTLAEAY  405

>PPTG_24712
Length=67

 Score = 49.3 bits (116),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 3/62 (5%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            YD +VIGGGSGG+A ++ A+ +G KV V++  +        GLGGTCVN GC+PKK+M  
Sbjct  7    YDYMVIGGGSGGMASARRAATFGAKVLVVERGREFD---GMGLGGTCVNFGCVPKKVMFN  63

Query  225  SS  226
            ++
Sbjct  64   TA  65

>PITG_19802
Length=185

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 7/156 (4%)

Query  472  STPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIEYGCCGL  531
            S P I+AIGDVI    L   A + G      +       ++Y  +   ++T  E+   G 
Sbjct  23   SVPGIFAIGDVIKGAMLAHKAEEEGIACVENIAGKH-GHVNYGAIPGVIYTFPEFASVGK  81

Query  532  SEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCYVKVICDTKRNKHVVGFHYLGP  591
            +EE    +   E +E Y+    P+  +  +   A     VKV+ D K +K ++G H +  
Sbjct  82   TEE----ELKAEGIE-YNVGKFPMMANSRARTIAEADGLVKVLADKKTDK-LLGVHIIAG  135

Query  592  NAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            NAGE+     + ++ G   + +      HPT +E F
Sbjct  136  NAGEMIAEGVIGIEYGAASEDLARTCHAHPTLSEAF  171

>SPRG_04231
Length=90

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 0/53 (0%)

Query  578  KRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIFTTL  630
            +++K VVG H  G  A E+ Q  G+A+K+G       N+V IHPT +E   T+
Sbjct  8    EKDKTVVGVHVAGLGADEMIQGFGVAVKMGAYKSDFDNIVAIHPTASEELVTM  60

>SPRG_18643
Length=85

 Score = 37.7 bits (86),  Expect = 0.022, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 23/30 (77%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +DL+VIG G  G  C+ +++K+GKKV ++D
Sbjct  49   FDLVVIGSGPSGQKCAIDSAKHGKKVAIID  78

>PYIW_27568
Length=128

 Score = 37.4 bits (85),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 30/117 (26%), Positives = 52/117 (44%), Gaps = 6/117 (5%)

Query  511  MDYDKVCTAVFTPIEYGCCGLSEEASIEKYGEENLEIYHQNFTPLEWSLSSDREAAGSCY  570
            ++Y+ +   ++T  E    G +EE    +  EE +  Y+    P+  +  +         
Sbjct  4    VNYNAIPGVIYTFPEVASVGKTEE----QLKEEGVA-YNVGKFPMMANSRARAVGEADGL  58

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            VKVI D   +K ++G H +  NAGE+     L M+ G   + +      HPT +E F
Sbjct  59   VKVIADKATDK-ILGVHIIASNAGEMISEGVLGMEYGAASEDIARTCHAHPTLSEAF  114

>CCI40989
Length=552

 Score = 37.0 bits (84),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 60/141 (43%), Gaps = 30/141 (21%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +D ++IGGG  GL  +   +K GK+VCVL+            +GG  V     P  L  +
Sbjct  14   WDAVIIGGGHNGLVAAAYLAKAGKQVCVLE--------KRHVIGGAAVTEEIFPGFLFSR  65

Query  225  SSLI-----------------GETIH-KDAKAFGWTVGEQT-FDWSQMLK---SVNSYIK  262
            +S +                 G  I+ +D  +F  T+ +++   WS M K   S+  + K
Sbjct  66   ASYVFSLFRPDIIEYLELKRRGLHIYSRDPGSFTPTLNQKSLLLWSDMEKTQQSIGQFSK  125

Query  263  SINFKYKVELRDKKVKYENLL  283
            +    Y   ++D +   +N +
Sbjct  126  ADALMYPKYIKDLEFLVQNFI  146

>HYAP_08068
Length=100

 Score = 34.3 bits (77),  Expect = 0.41, Method: Composition-based stats.
 Identities = 18/57 (32%), Positives = 30/57 (53%), Gaps = 1/57 (2%)

Query  571  VKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            VKV+ D K +K ++G H +  NAGE+     + ++ G   + +      HPT +E F
Sbjct  16   VKVLADKKTDK-LLGVHIIASNAGEMISEGVIGIEYGAASEDLARTCHAHPTLSEAF  71

>PYAP_15943
Length=139

 Score = 35.0 bits (79),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D +V+GGG  GL  +   +K GK+VCVL+
Sbjct  14   WDAVVVGGGHNGLVAAAYLAKAGKRVCVLE  43

>PITG_02760
Length=165

 Score = 35.0 bits (79),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D IV+GGG  GL  +   +K GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAASYLAKAGKSVCVLE  41

>PYAP_16251
Length=225

 Score = 35.4 bits (80),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (43%), Gaps = 4/114 (4%)

Query  25   TRANIKETLVHEGGPTKYHVAGWRGCGFYKKASDVVTAMRVLYPDVVDFELHEFPDREAF  84
            TR+ +K  + HEG  ++  +A  R     + A DV+      +PD  D    +       
Sbjct  4    TRSPVK-AISHEGFHSEEELAVLRAIVARENAMDVLLDCCCAFPD--DPSEMDSAAITLL  60

Query  85   REWLAASSTIEELTECFGADSKALTHKSSPFVWANTRGFIGGCDDTLALFRSGV  138
            ++ LA  +    + +C  A  + +  K  PF+W NT   +  C D   L RS +
Sbjct  61   QQILAVRAQSLNVIDCVAAWRRRMVQKR-PFIWRNTNYLLKMCSDLDFLARSQL  113

>PYU1_G000378
Length=1070

 Score = 36.2 bits (82),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 99/221 (45%), Gaps = 18/221 (8%)

Query  345  LVVGASYVALECAGFMKGMGYDVKIMVR--SILLRGFDQDMANKIGEFMETESKIEFIRG  402
            LV+G   + LE A  +  +   V+I+ R   ++ R  D   A  +   + ++  IE +  
Sbjct  160  LVIGGGLLGLEAAKAIHDLQLSVRIVNRGSRLMSRQLDDAGAKVLHNEIVSKFGIEVLY-  218

Query  403  AVPQSITKLESGQLLVKWVS-ADGETCEEAFDTVLNATGRDPDVAKLGLDKVGVKLNPKT  461
                  TK   G  +V+ V   DGE+ ++ F  V  ATG  P    LG D  G+ +  + 
Sbjct  219  ---HKTTKYIHGTTVVEGVDFTDGESYDDVFMIVF-ATGIKPR-DDLGRDS-GLDVAQRG  272

Query  462  GRIAVTNE-QTSTPNIYAIGDVIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAV  520
            G I V +  +TS  ++YAIG+ +   ++T   +  G  +A  L  N TA  D   + T  
Sbjct  273  GGILVNDLLETSHKDVYAIGECVSHRDVTYGLVAPGYEMADNLAKNFTANGDEKVLFTGS  332

Query  521  FTPIEYGCCGLSEEASIEKYGEENL-----EIYHQNFTPLE  556
             +  +    G+   A    + EE+L     E+ + N  PLE
Sbjct  333  DSSTKLKLMGMEVAAFGAYFPEEHLNEPYEELVYNN--PLE  371

>PYU1_G004385
Length=562

 Score = 35.4 bits (80),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D IV+GGG  GL  +   +K GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAAAYLAKAGKQVCVLE  42

>PYVX_18330
Length=558

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D IV+GGG  GL  +   +K GK+VCVL+
Sbjct  13   WDAIVVGGGHNGLVAASYLAKAGKQVCVLE  42

>PHYKE_5677
Length=211

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D IV+GGG  GL  +   +K GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKNVCVLE  41

>H310_07705
Length=546

 Score = 35.0 bits (79),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 30/64 (47%), Gaps = 8/64 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +D IV+GGG  GL  +   +K GK VCVL+            LGG  V    +P     +
Sbjct  12   WDAIVVGGGHNGLVAATYLAKAGKAVCVLE--------KRHVLGGAAVTEEIVPNFRFSR  63

Query  225  SSLI  228
            +S +
Sbjct  64   ASYV  67

>PPTG_05518
Length=554

 Score = 34.3 bits (77),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            +D IV+GGG  GL  +   +K GK VCVL+
Sbjct  12   WDAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>H310_06296
Length=590

 Score = 34.3 bits (77),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 0/31 (0%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            D D+IVIG G GGL  +   +K GK+V VL+
Sbjct  62   DLDVIVIGSGMGGLTVAAALAKEGKRVLVLE  92

>SDRG_05159
Length=551

 Score = 33.5 bits (75),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (47%), Gaps = 8/64 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +D +++GGG  GL  +   +K GK VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPDFHFSR  66

Query  225  SSLI  228
            +S +
Sbjct  67   ASYV  70

>SPRG_08354
Length=550

 Score = 33.5 bits (75),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (47%), Gaps = 8/64 (13%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQ  224
            +D +++GGG  GL  +   +K GK VCVL+            LGG  V    IP     +
Sbjct  15   WDAVIVGGGHNGLVAATYLAKAGKSVCVLE--------KRHLLGGAAVTEEIIPNFHFSR  66

Query  225  SSLI  228
            +S +
Sbjct  67   ASYV  70

>PHYRA_48183
Length=532

 Score = 33.5 bits (75),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  166  DLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            D IV+GGG  GL  +   +K GK VCVL+
Sbjct  1    DAIVVGGGHNGLVAAAYLAKAGKSVCVLE  29

>CCA24710
Length=686

 Score = 33.5 bits (75),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 21/148 (14%)

Query  172  GGSGGLACSKEASKYGKKVCVLDYVKPSPVGT-------------SWGLGGT------CV  212
            GG  GL   ++A KY   + V D    +P+               + G  GT      C+
Sbjct  288  GGKLGLHILRQARKYLNPIQVYDVAHQNPMSALNDFKELPRLRILACGGDGTVGWILNCL  347

Query  213  NVGCIPKKLMHQSSLIGETIHKDAKAFGWTVGEQTFDWSQMLKSVNSYIKSINFKYKVEL  272
            +   +P + +  + L   T +  A+  GW  G    D+S+ L  V S   S+  ++ V +
Sbjct  348  D-DVVPSRQLPVAVLPLGTGNDLARVLGWGSGLSCGDFSERLPQVESAHVSLLDRWNVRI  406

Query  273  R-DKKVKYENLLGSFVDAHTLELWHPKK  299
              +K+    N LG  VDA     +H ++
Sbjct  407  NGNKRTVMNNYLGIGVDAQVALEFHKQR  434

>SPRG_04526
Length=334

 Score = 32.7 bits (73),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (47%), Gaps = 4/64 (6%)

Query  163  YDY---DLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPK  219
            YDY   D+I+ G GS GL  + E SKY      +     +P G +W LGG   +   + K
Sbjct  74   YDYADSDVIIAGAGSAGLCAAYELSKYPNVRVAIIEQSVAPGGGAW-LGGQLFSSMIVRK  132

Query  220  KLMH  223
               H
Sbjct  133  PAHH  136

>SPRG_17626
Length=148

 Score = 31.6 bits (70),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 30/58 (52%), Gaps = 1/58 (2%)

Query  570  YVKVICDTKRNKHVVGFHYLGPNAGEVTQAIGLAMKLGFTYDQMVNVVGIHPTTAEIF  627
            +VK++   K +  ++G H +  NAGE+     L ++ G + + +      HPT +E F
Sbjct  78   FVKILA-AKDDDKILGIHIIASNAGEMISEGVLGLEYGASAEDIGRTCHAHPTLSEAF  134

>PYIW_14781
Length=339

 Score = 32.3 bits (72),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGG  209
            D D+I+ G GS GL  + E SKY      L     +P G +W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>PHYSO_261176
Length=541

 Score = 32.7 bits (73),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 20/30 (67%), Gaps = 0/30 (0%)

Query  165  YDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            ++ IV+GGG  GL  +   +K GK VCVL+
Sbjct  12   WNAIVVGGGHNGLVAAAYLAKAGKSVCVLE  41

>PYU1_G009988
Length=284

 Score = 32.3 bits (72),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGG  209
            D D+I+ G GS GL  + E SKY      L     +P G +W LGG
Sbjct  28   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  72

>PYIR_13610
Length=339

 Score = 32.3 bits (72),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGG  209
            D D+I+ G GS GL  + E SKY      L     +P G +W LGG
Sbjct  83   DSDVIIAGAGSAGLVAAYELSKYPNVRVALIEQSVAPGGGAW-LGG  127

>H257_18256
Length=492

 Score = 32.3 bits (72),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 2/57 (4%)

Query  585  GFHYLGPNAGEVTQAIGLAMKLGFTYD--QMVNVVGIHPTTAEIFTTLEVTKSSGES  639
            GF    P+ G +TQ IG  + + FT +   ++N + +  T   I   LEV +  GE+
Sbjct  9    GFSTAAPSVGRITQIIGAVVDVQFTNNLPPILNALEVQNTNDNIRIVLEVAQHLGEN  65

>H257_18255
Length=492

 Score = 32.3 bits (72),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 29/57 (51%), Gaps = 2/57 (4%)

Query  585  GFHYLGPNAGEVTQAIGLAMKLGFTYD--QMVNVVGIHPTTAEIFTTLEVTKSSGES  639
            GF    P+ G +TQ IG  + + FT +   ++N + +  T   I   LEV +  GE+
Sbjct  9    GFSTAAPSVGRITQIIGAVVDVQFTNNLPPILNALEVQNTNDNIRIVLEVAQHLGEN  65

>H257_04036
Length=1049

 Score = 32.7 bits (73),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query  166  DLIVIGGGSGGLACSKEASKYGKKVCVLDYVKPSPVGTSWGLGGTCVNVGCIPKKLMHQS  225
            D+++ GGG+G  +C  +  + G     ++++   P GT+  + G  + VG  P+ L H  
Sbjct  442  DVVLFGGGAGAASCELQVPEPG----TVEFMVAMP-GTTCLINGLPLTVGAAPRPLAHGD  496

Query  226  SL  227
            +L
Sbjct  497  TL  498

>PHYSO_256448
Length=1175

 Score = 32.7 bits (73),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 47/104 (45%), Gaps = 11/104 (11%)

Query  428  CEEAF------DTVLNATGRDPDVAKLGLDKVGVKLNPKTGRIAVTNEQTSTPNIYAIGD  481
            C+EAF      D VL  + ++  V  +    VGVK    +   A   +    P I A+ D
Sbjct  140  CQEAFEADFGLDGVLYVSEQEELVTGVYQIYVGVKAEIYSMIEATRPDHAGRPEIRAMQD  199

Query  482  VIDAPELTPVAIQAGRLLARRLYNNETALMDYDKVCTAVFTPIE  525
            +I+A     + + A RL A+ + + +     +D+  T  F+P E
Sbjct  200  LIEA-----IGVHAPRLYAQTVKSVDAIQQTFDREGTYTFSPFE  238

>SDRG_06501
Length=623

 Score = 32.3 bits (72),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (68%), Gaps = 0/31 (0%)

Query  164  DYDLIVIGGGSGGLACSKEASKYGKKVCVLD  194
            D D+I+IGGG+ G A +   +K GKKV V +
Sbjct  124  DADVIIIGGGTTGCAMAMGLAKQGKKVLVFE  154

Lambda      K        H        a         alpha
   0.317    0.134    0.405    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 50513536077

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40