Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_134511475635935915970.0
PYIW_199711475634836211625e-159
PYU1_G0017351475634236211294e-154
PYAP_17762147563483638725e-115
PHYRA_81100147563493648448e-111
PPTG_17127147563513638404e-110
PHYCA_556162147563513638362e-109
PITG_18456147563513738204e-107
PHYSO_471523147563483708134e-106
PHALS_06478147563453677979e-104
PYVX_18171147562942467391e-95
PYAR_13570147563223277141e-91
PHYKE_8393147563263646916e-88
CCA18899147563433536552e-82
CCI45123147563013215113e-61
SPRG_06336147563353434169e-47
SDRG_01781147563353434062e-45
H257_06294147563583663724e-40
H310_09223147563333483461e-36
CCI451271609872022132644e-26
SDRG_1276312510913171201271e-06
SPRG_0605912510913121181243e-06
PYIR_215891612815681241217e-06
HYAP_086451612815141271209e-06
H310_0023012510912481321181e-05
H257_0672112510912381301182e-05
CCI44752161281526551182e-05
PYIW_17381161289521241172e-05
PYU1_G0063471612810951151163e-05
PHYRA_849161612815411201163e-05
H310_00231161281495411154e-05
H257_06722161281482471145e-05
PHYSO_3617471612815231211146e-05
PYAR_2328616128607401136e-05
PHYKE_19901612814991201136e-05
PPTG_18898161281559401128e-05
PITG_20562161281559401129e-05
PYVX_204381612813461321121e-04
CCA18875161281514401111e-04
SDRG_127621612813921231083e-04
SPRG_06058161281258411073e-04
PYAP_16997161281018311047e-04
PYIR_1530914459937591049e-04
PYU1_G00106314459783341030.001
PYIW_1317214459939341010.002
CCI10489158709777601000.002
PHALS_036452417830571000.002
PYAP_1729014459835341000.002
PYVX_1357414459950341000.003
PYU1_G004386241783757990.003
PHYKE_24791445917134950.003
PPTG_134011445992757990.003
PYVX_18338241774649990.003
PHYSO_344112241781355990.003
HYAP_08026241779857980.003
PITG_11303931829336970.004
PITG_02762241781056980.004
PHYCA_506137241781055980.004
PPTG_05519241781056980.004
PHALS_065331445993058980.004
PITG_180671445992451980.004
PHYCA_50311215292621456950.004
PHYRA_79281241780956980.004
CCI412251445998134970.005
PYAR_199141445978858970.006
PHYRA_778341445993634970.006
PHYKE_5678241780961950.008
PYAP_22646241781544950.010
CCI4245715292690634940.012
H257_030931526797553940.014
SPRG_1702213189210739860.014
CCA164871445997534940.014
PYIR_18382152671154131930.015
PPTG_1462618501055130930.015
CCA1710215292688434930.017
PYU1_G00884815267765157930.018
PYAR_19883241783355920.023
PYIW_1698715267821131910.030
PYIW_18480241775544910.030
PYVX_1331215267101635910.033
CCA21715241778238900.033
CCA2186015507878238900.033
CCI4623515267115560900.036
PYAR_1546315267109153900.038
PYVX_2334914313924128890.044
PITG_18687836631030167890.045
SDRG_014071526781535890.050
PITG_1789314313747133890.051
H310_063781445983735890.053
PITG_0765264031094167890.056
PPTG_0455314313904133880.058
H257_135671445983635880.061
PHYKE_4910185237546870.061
CCA1802315267113856880.065
SPRG_008901526788335880.067
PYAP_18636152671009119880.069
SDRG_05150241778739880.070
SPRG_08346241779739880.072
PYIR_13120241781444870.080
PHYRA_8254315267119935870.096
PPTG_1937115267119535870.098
PHYSO_48454116911146860.100
PYU1_G0128591850118340870.100
PHYSO_54459815267116335860.10
SDRG_088001445988135860.11
H310_048431526796835860.11
PITG_1921315267120135860.12
PHALS_0409815267118335850.14
SPRG_054491445972335850.16
PHALS_0669914313884116850.16
CCI40991241780138830.23
SDRG_021352194430633820.23
PHALS_06336185251139820.28
PYVX_14593185096456830.28
CCA2551013479113934830.29
PYIR_1745395112619116830.30
PHYRA_73534696861210118820.32
PHYSO_3436291445997723820.32
PHYRA_7353514313875116820.34
PYIR_2337215835141537820.38
PYU1_G0122741583587337820.38
HYAP_0445715267120335820.39
CCA190339511188335820.40
PYIR_1449416819136810.41
PYU1_G0032291681037810.42
H257_07514241781038810.43
H310_07701241781138810.43
PHYKE_66621526776535810.50
HYAP_06101288598461810.50
PHYKE_55881675144800.51
PHYSO_55616414313765116800.55
PYAP_161619866188941800.66
SDRG_14070749063049790.73
PYVX_1308413479126734790.77
SPRG_119001660538790.80
SPRG_060218195983119790.81
PYIW_219018506091354790.84
CCI4379313479111734790.85
SPRG_14955749063549790.85
HYAP_08248749078427790.87
HYAP_137571151726231770.95
PPTG_1915381951219161781.0
PHYSO_48987281951240117781.0
PYAP_234788506089739781.1
PITG_033182885134361781.1
PPTG_160442885137861781.2
PYAR_192918506071139771.2
PYIR_1511813479122232781.2
PHYSO_2484812885128361771.3
SDRG_0008012454429852761.3
PYU1_G0095089576532832761.3
SPRG_091281431362030771.3
PHYRA_732975725911929721.3
SDRG_05567819598032771.3
PYAP_2414415835102235771.4
PYIW_1891113479119632771.4
PHYRA_7693181951212138771.4
H310_0020915835119843771.5
PYAP_22195863290134771.5
CCI393672885204633771.5
CCI458959511172135771.6
SDRG_03175640393439761.7
H310_06666863288734761.7
PYAR_255001583547335761.8
PYIW_1849115835168437761.8
H257_081821685939761.8
H257_0336112342869932761.8
SPRG_00889122518994142761.8
PYVX_145276030126934761.8
PPTG_1898913479121332761.9
PHALS_035401690438761.9
PHALS_06568185338832751.9
PHYSO_556902919645429752.0
PYU1_G0007249278718933732.0
H257_098231431365426752.1
HYAP_0930413479114432762.1
PHYRA_8194413479114932752.2
PHALS_0633418501064129752.2
PHALS_0793013479120032752.4
H310_01921185334132742.5
PYAP_1673481951314117752.6
HYAP_0223081951195136752.7
SPRG_0275212342883132742.8
PPTG_06130749078246742.8
CCI434561109212634702.8
PYIR_245888506090939742.9
SPRG_029399511216138752.9
PHYCA_5047121620844722.9
HYAP_1368818501036169742.9
H257_06469219447630673.0
PYIR_2225949814425713.0
SDRG_1277615835118451743.1
PITG_09010749078246743.1
PHYKE_7856288534648733.1
PYAP_166589576529434733.1
PPTG_146122290033193733.2
SDRG_1448712342896432743.2
PPTG_166591691644743.3
PYAR_233668366382841743.5
SDRG_142861431367030733.6
PITG_099308195122134743.6
H310_1362714313678136733.6
PHYCA_5047984407339439733.6
PHALS_0991112952341119733.7
SDRG_007569511216938743.7
PHALS_080978195106934733.7
H257_01308863289734733.9
PITG_000201692744733.9
PYAP_1364715926684723.9
PHYRA_734314407339439734.0
PPTG_146294407339439724.1
H257_0669815835119935734.3
SDRG_062881664138734.3
HYAP_136894407339339724.4
SPRG_0627313479104732734.4
PHALS_125031151734031724.5
PYAR_14615863251734724.5
CCA14309650023533714.6
SDRG_08236863286442734.6
SPRG_01860863267442724.7
CCA19097185668832724.9
PYIR_131682885135333734.9
PHYSO_478442461468646724.9
H310_029338195105335725.0
PHYCA_504624919644929725.1
H310_0666713886889641725.1
PHYRA_788151691944725.1
SDRG_0183813479104332725.1
SDRG_01408122518916141725.3
PYIW_175718195133034725.3
H310_14473749061330725.3
H310_09363140947195460725.3
H257_02642640397539725.4
PYAP_1977699602118565725.6
SDRG_056081109212126685.6
SPRG_1631213132226140715.7
PYVX_2258915835137537725.7
SPRG_01654640392339725.8
PYIW_178181850118834725.8
PITG_021061850101552725.8
PHYRA_78920919645329715.8
H257_007291109212129685.8
PYIR_165398195134634725.8
H257_0902812554556123715.9
PPTG_1075537972346725.9
SPRG_025021109212126686.0
PHYCA_989485725912426686.0
PITG_0041637969846716.4
PHYSO_563553749079727716.4
H257_13346749058730716.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_13451

Length=359
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_13451                                                            619        0.0   
PYIW_19971                                                            452        5e-159
PYU1_G001735                                                          439        4e-154
PYAP_17762                                                            340        5e-115
PHYRA_81100                                                           329        8e-111
PPTG_17127                                                            328        4e-110
PHYCA_556162                                                          326        2e-109
PITG_18456                                                            320        4e-107
PHYSO_471523                                                          317        4e-106
PHALS_06478                                                           311        9e-104
PYVX_18171                                                            289        1e-95 
PYAR_13570                                                            279        1e-91 
PHYKE_8393                                                            270        6e-88 
CCA18899                                                              256        2e-82 
CCI45123                                                              201        3e-61 
SPRG_06336                                                            164        9e-47 
SDRG_01781                                                            160        2e-45 
H257_06294                                                            147        4e-40 
H310_09223                                                            137        1e-36 
CCI45127                                                              106        4e-26 
SDRG_12763                                                            53.5       1e-06 
SPRG_06059                                                            52.4       3e-06 
PYIR_21589                                                            51.2       7e-06 
HYAP_08645                                                            50.8       9e-06 
H310_00230                                                            50.1       1e-05 
H257_06721                                                            50.1       2e-05 
CCI44752                                                              50.1       2e-05 
PYIW_17381                                                            49.7       2e-05 
PYU1_G006347                                                          49.3       3e-05 
PHYRA_84916                                                           49.3       3e-05 
H310_00231                                                            48.9       4e-05 
H257_06722                                                            48.5       5e-05 
PHYSO_361747                                                          48.5       6e-05 
PYAR_23286                                                            48.1       6e-05 
PHYKE_1990                                                            48.1       6e-05 
PPTG_18898                                                            47.8       8e-05 
PITG_20562                                                            47.8       9e-05 
PYVX_20438                                                            47.8       1e-04 
CCA18875                                                              47.4       1e-04 
SDRG_12762                                                            46.2       3e-04 
SPRG_06058                                                            45.8       3e-04 
PYAP_16997                                                            44.7       7e-04 
PYIR_15309                                                            44.7       9e-04 
PYU1_G001063                                                          44.3       0.001 
PYIW_13172                                                            43.5       0.002 
CCI10489                                                              43.1       0.002 
PHALS_03645                                                           43.1       0.002 
PYAP_17290                                                            43.1       0.002 
PYVX_13574                                                            43.1       0.003 
PYU1_G004386                                                          42.7       0.003 
PHYKE_2479                                                            41.2       0.003 
PPTG_13401                                                            42.7       0.003 
PYVX_18338                                                            42.7       0.003 
PHYSO_344112                                                          42.7       0.003 
HYAP_08026                                                            42.4       0.003 
PITG_11303                                                            42.0       0.004 
PITG_02762                                                            42.4       0.004 
PHYCA_506137                                                          42.4       0.004 
PPTG_05519                                                            42.4       0.004 
PHALS_06533                                                           42.4       0.004 
PITG_18067                                                            42.4       0.004 
PHYCA_503112                                                          41.2       0.004 
PHYRA_79281                                                           42.4       0.004 
CCI41225                                                              42.0       0.005 
PYAR_19914                                                            42.0       0.006 
PHYRA_77834                                                           42.0       0.006 
PHYKE_5678                                                            41.2       0.008 
PYAP_22646                                                            41.2       0.010 
CCI42457                                                              40.8       0.012 
H257_03093                                                            40.8       0.014 
SPRG_17022                                                            37.7       0.014 
CCA16487                                                              40.8       0.014 
PYIR_18382                                                            40.4       0.015 
PPTG_14626                                                            40.4       0.015 
CCA17102                                                              40.4       0.017 
PYU1_G008848                                                          40.4       0.018 
PYAR_19883                                                            40.0       0.023 
PYIW_16987                                                            39.7       0.030 
PYIW_18480                                                            39.7       0.030 
PYVX_13312                                                            39.7       0.033 
CCA21715                                                              39.3       0.033 
CCA21860                                                              39.3       0.033 
CCI46235                                                              39.3       0.036 
PYAR_15463                                                            39.3       0.038 
PYVX_23349                                                            38.9       0.044 
PITG_18687                                                            38.9       0.045 
SDRG_01407                                                            38.9       0.050 
PITG_17893                                                            38.9       0.051 
H310_06378                                                            38.9       0.053 
PITG_07652                                                            38.9       0.056 
PPTG_04553                                                            38.5       0.058 
H257_13567                                                            38.5       0.061 
PHYKE_4910                                                            38.1       0.061 
CCA18023                                                              38.5       0.065 
SPRG_00890                                                            38.5       0.067 
PYAP_18636                                                            38.5       0.069 
SDRG_05150                                                            38.5       0.070 
SPRG_08346                                                            38.5       0.072 
PYIR_13120                                                            38.1       0.080 
PHYRA_82543                                                           38.1       0.096 
PPTG_19371                                                            38.1       0.098 
PHYSO_484541                                                          37.7       0.100 
PYU1_G012859                                                          38.1       0.100 
PHYSO_544598                                                          37.7       0.10  
SDRG_08800                                                            37.7       0.11  
H310_04843                                                            37.7       0.11  
PITG_19213                                                            37.7       0.12  
PHALS_04098                                                           37.4       0.14  
SPRG_05449                                                            37.4       0.16  
PHALS_06699                                                           37.4       0.16  
CCI40991                                                              36.6       0.23  
SDRG_02135                                                            36.2       0.23  
PHALS_06336                                                           36.2       0.28  
PYVX_14593                                                            36.6       0.28  
CCA25510                                                              36.6       0.29  
PYIR_17453                                                            36.6       0.30  
PHYRA_73534                                                           36.2       0.32  
PHYSO_343629                                                          36.2       0.32  
PHYRA_73535                                                           36.2       0.34  
PYIR_23372                                                            36.2       0.38  
PYU1_G012274                                                          36.2       0.38  
HYAP_04457                                                            36.2       0.39  
CCA19033                                                              36.2       0.40  
PYIR_14494                                                            35.8       0.41  
PYU1_G003229                                                          35.8       0.42  
H257_07514                                                            35.8       0.43  
H310_07701                                                            35.8       0.43  
PHYKE_6662                                                            35.8       0.50  
HYAP_06101                                                            35.8       0.50  
PHYKE_5588                                                            35.4       0.51  
PHYSO_556164                                                          35.4       0.55  
PYAP_16161                                                            35.4       0.66  
SDRG_14070                                                            35.0       0.73  
PYVX_13084                                                            35.0       0.77  
SPRG_11900                                                            35.0       0.80  
SPRG_06021                                                            35.0       0.81  
PYIW_21901                                                            35.0       0.84  
CCI43793                                                              35.0       0.85  
SPRG_14955                                                            35.0       0.85  
HYAP_08248                                                            35.0       0.87  
HYAP_13757                                                            34.3       0.95  
PPTG_19153                                                            34.7       1.0   
PHYSO_489872                                                          34.7       1.0   
PYAP_23478                                                            34.7       1.1   
PITG_03318                                                            34.7       1.1   
PPTG_16044                                                            34.7       1.2   
PYAR_19291                                                            34.3       1.2   
PYIR_15118                                                            34.7       1.2   
PHYSO_248481                                                          34.3       1.3   
SDRG_00080                                                            33.9       1.3   
PYU1_G009508                                                          33.9       1.3   
SPRG_09128                                                            34.3       1.3   
PHYRA_73297                                                           32.3       1.3   
SDRG_05567                                                            34.3       1.3   
PYAP_24144                                                            34.3       1.4   
PYIW_18911                                                            34.3       1.4   
PHYRA_76931                                                           34.3       1.4   
H310_00209                                                            34.3       1.5   
PYAP_22195                                                            34.3       1.5   
CCI39367                                                              34.3       1.5   
CCI45895                                                              34.3       1.6   
SDRG_03175                                                            33.9       1.7   
H310_06666                                                            33.9       1.7   
PYAR_25500                                                            33.9       1.8   
PYIW_18491                                                            33.9       1.8   
H257_08182                                                            33.9       1.8   
H257_03361                                                            33.9       1.8   
SPRG_00889                                                            33.9       1.8   
PYVX_14527                                                            33.9       1.8   
PPTG_18989                                                            33.9       1.9   
PHALS_03540                                                           33.9       1.9   
PHALS_06568                                                           33.5       1.9   
PHYSO_556902                                                          33.5       2.0   
PYU1_G000724                                                          32.7       2.0   
H257_09823                                                            33.5       2.1   
HYAP_09304                                                            33.9       2.1   
PHYRA_81944                                                           33.5       2.2   
PHALS_06334                                                           33.5       2.2   
PHALS_07930                                                           33.5       2.4   
H310_01921                                                            33.1       2.5   
PYAP_16734                                                            33.5       2.6   
HYAP_02230                                                            33.5       2.7   
SPRG_02752                                                            33.1       2.8   
PPTG_06130                                                            33.1       2.8   
CCI43456                                                              31.6       2.8   
PYIR_24588                                                            33.1       2.9   
SPRG_02939                                                            33.5       2.9   
PHYCA_504712                                                          32.3       2.9   
HYAP_13688                                                            33.1       2.9   
H257_06469                                                            30.4       3.0   
PYIR_22259                                                            32.0       3.0   
SDRG_12776                                                            33.1       3.1   
PITG_09010                                                            33.1       3.1   
PHYKE_7856                                                            32.7       3.1   
PYAP_16658                                                            32.7       3.1   
PPTG_14612                                                            32.7       3.2   
SDRG_14487                                                            33.1       3.2   
PPTG_16659                                                            33.1       3.3   
PYAR_23366                                                            33.1       3.5   
SDRG_14286                                                            32.7       3.6   
PITG_09930                                                            33.1       3.6   
H310_13627                                                            32.7       3.6   
PHYCA_504798                                                          32.7       3.6   
PHALS_09911                                                           32.7       3.7   
SDRG_00756                                                            33.1       3.7   
PHALS_08097                                                           32.7       3.7   
H257_01308                                                            32.7       3.9   
PITG_00020                                                            32.7       3.9   
PYAP_13647                                                            32.3       3.9   
PHYRA_73431                                                           32.7       4.0   
PPTG_14629                                                            32.3       4.1   
H257_06698                                                            32.7       4.3   
SDRG_06288                                                            32.7       4.3   
HYAP_13689                                                            32.3       4.4   
SPRG_06273                                                            32.7       4.4   
PHALS_12503                                                           32.3       4.5   
PYAR_14615                                                            32.3       4.5   
CCA14309                                                              32.0       4.6   
SDRG_08236                                                            32.7       4.6   
SPRG_01860                                                            32.3       4.7   
CCA19097                                                              32.3       4.9   
PYIR_13168                                                            32.7       4.9   
PHYSO_478442                                                          32.3       4.9   
H310_02933                                                            32.3       5.0   
PHYCA_504624                                                          32.3       5.1   
H310_06667                                                            32.3       5.1   
PHYRA_78815                                                           32.3       5.1   
SDRG_01838                                                            32.3       5.1   
SDRG_01408                                                            32.3       5.3   
PYIW_17571                                                            32.3       5.3   
H310_14473                                                            32.3       5.3   
H310_09363                                                            32.3       5.3   
H257_02642                                                            32.3       5.4   
PYAP_19776                                                            32.3       5.6   
SDRG_05608                                                            30.8       5.6   
SPRG_16312                                                            32.0       5.7   
PYVX_22589                                                            32.3       5.7   
SPRG_01654                                                            32.3       5.8   
PYIW_17818                                                            32.3       5.8   
PITG_02106                                                            32.3       5.8   
PHYRA_78920                                                           32.0       5.8   
H257_00729                                                            30.8       5.8   
PYIR_16539                                                            32.3       5.8   
H257_09028                                                            32.0       5.9   
PPTG_10755                                                            32.3       5.9   
SPRG_02502                                                            30.8       6.0   
PHYCA_98948                                                           30.8       6.0   
PITG_00416                                                            32.0       6.4   
PHYSO_563553                                                          32.0       6.4   
H257_13346                                                            32.0       6.7   
PHYRA_94409                                                           32.0       6.7   
SDRG_13767                                                            32.0       6.7   
PHYRA_80694                                                           32.0       6.8   
CCA19118                                                              30.4       6.9   
PPTG_11714                                                            32.0       6.9   
PPTG_07800                                                            30.8       6.9   
PITG_11578                                                            32.0       7.0   
H257_03363                                                            31.6       7.1   
H310_01094                                                            30.4       7.2   
H310_14019                                                            32.0       7.4   
PHYSO_485120                                                          30.4       7.7   
CCA24531                                                              31.6       7.7   
CCI47145                                                              31.6       7.8   
HYAP_08916                                                            31.2       7.9   
PYAP_22685                                                            32.0       8.0   
CCA15513                                                              32.0       8.1   
PHALS_10754                                                           31.6       8.2   
H257_10063                                                            32.0       8.4   
PYIW_21108                                                            32.0       8.4   
PHALS_03335                                                           31.6       8.6   
PYAP_19753                                                            31.6       8.7   
PYAR_19122                                                            31.6       9.6   

>PYIR_13451
Length=359

 Score = 619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/359 (100%), Positives = 359/359 (100%), Gaps = 0/359 (0%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY
Sbjct  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI
Sbjct  61   ESRDASKGSSSSGGTGVPVPKGSFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180
            ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL
Sbjct  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180

Query  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240
            AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM
Sbjct  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240

Query  241  KRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRNDALSDl  300
            KRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSDL
Sbjct  241  KRPMLHLFSGDERVKQSPHTGGASGHTDRASHGQTPGTTNGGTAGGQQIHGQRNDALSDL  300

Query  301  eklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNLF  359
            EKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNLF
Sbjct  301  EKLALALGELEEQANLMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNLF  359

>PYIW_19971
Length=348

 Score = 452 bits (1162),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 260/362 (72%), Positives = 279/362 (77%), Gaps = 17/362 (5%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVPD KLATS  +G  GDKFK TSCEGYVTKRGHFRKSWRVRYLVFNGA+LQ A  
Sbjct  1    MNILRVPDMKLATS--HGSGGDKFKATSCEGYVTKRGHFRKSWRVRYLVFNGADLQAAGG  58

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
                 +    S            F+VSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI
Sbjct  59   GGASPATPKGS------------FFVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  106

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180
            ELDIFVE+LGDLNKWVEVVQNALDAAKK +RT G  D+STTK MFGFSA+ SPQLQVKKL
Sbjct  107  ELDIFVETLGDLNKWVEVVQNALDAAKKHTRTPGAADSSTTKNMFGFSATVSPQLQVKKL  166

Query  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240
            AATKE+LLRDALREIEGAKLIGREAV++I  QG KL+M+E DLGKVE DLDH  KLL HM
Sbjct  167  AATKEELLRDALREIEGAKLIGREAVSDIKGQGGKLNMIEDDLGKVESDLDHGGKLLNHM  226

Query  241  KRPMLHLFSGDERVKQSP-HTGGASGHTDRASHgqtpgttnggtaggqqIHGQRNDA--L  297
            KRPMLHLFS D R K +  H+G  S H D  S        +         H Q+ D   +
Sbjct  227  KRPMLHLFSNDNRSKPNAHHSGSHSDHKDGHSGAHPSSGGSSAETATGAQHHQQQDTSVM  286

Query  298  SDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGN  357
            SDLE+L LALGELEEQA  MNAEAVKSTEQIARVEQRLTAVNDRVQ QTKKA ATMKAGN
Sbjct  287  SDLERLVLALGELEEQATAMNAEAVKSTEQIARVEQRLTAVNDRVQAQTKKATATMKAGN  346

Query  358  LF  359
            LF
Sbjct  347  LF  348

>PYU1_G001735
Length=342

 Score = 439 bits (1129),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 252/362 (70%), Positives = 284/362 (78%), Gaps = 23/362 (6%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVPDAKLA SG+     +  KPTSCEGYVTKRGHFRKSWRVRYLVFNGA+LQV+Y+
Sbjct  1    MNILRVPDAKLAISGA-----EVCKPTSCEGYVTKRGHFRKSWRVRYLVFNGADLQVSYF  55

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESRDA+    +            FYVSSVEKHEYW+GVMGG+EKPFGFKLVGHAP KGYI
Sbjct  56   ESRDAAHAPGTVPKGS-------FYVSSVEKHEYWIGVMGGKEKPFGFKLVGHAPSKGYI  108

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKL  180
            ELDIFVESL D+NKW+EVVQNALDAAKK +R G      +TK+MFGF AS SPQLQVKKL
Sbjct  109  ELDIFVESLPDVNKWLEVVQNALDAAKKLTRKGM---TDSTKSMFGFGASISPQLQVKKL  165

Query  181  AATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHM  240
            AATKE+LLR+ALREIEGAKLIGREAVNEIV QGEKLD VE+DLG VEGDLDHADKLLRH+
Sbjct  166  AATKEELLREALREIEGAKLIGREAVNEIVSQGEKLDQVENDLGHVEGDLDHADKLLRHL  225

Query  241  KRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRN---DAL  297
            K P+LH+FS D R K+     GA      ++ G    TT+  +    Q+H +       L
Sbjct  226  KSPVLHVFSNDNRQKK-----GAPTAATASASGGASATTSPVSGTEGQLHAKITGGGGTL  280

Query  298  SDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGN  357
            +DLE LALAL ELEEQANLMNAEA +STEQIAR+E+RLT+VNDRVQ QTKKA ATMKAGN
Sbjct  281  NDLEMLALALSELEEQANLMNAEAARSTEQIARIEERLTSVNDRVQHQTKKATATMKAGN  340

Query  358  LF  359
            LF
Sbjct  341  LF  342

>PYAP_17762
Length=348

 Score = 340 bits (872),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 250/363 (69%), Gaps = 28/363 (8%)

Query  1    MNILRVP---DAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQV  57
            MNILR+P    +    + S+       KPTSCEGYVTKRGHFRKSWRVR+LV NGA+L V
Sbjct  1    MNILRLPLGATSHPTVTASSSSPTSPVKPTSCEGYVTKRGHFRKSWRVRFLVLNGADLLV  60

Query  58   AYYESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKK  117
            +YY+S++ ++ + +            FY+SSVEKHEY+VGV+G +EKPFGFK+VGHAP+K
Sbjct  61   SYYDSKEVARTAGAVPKGS-------FYLSSVEKHEYYVGVLGAQEKPFGFKMVGHAPRK  113

Query  118  GYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQV  177
            GY+ELDIFVE+LGDLNKW+EV QNALDAAKK +RTG   +    K++FGFS + SPQ Q+
Sbjct  114  GYVELDIFVETLGDLNKWLEVCQNALDAAKKLTRTGQ-PEALAPKSLFGFSPATSPQQQM  172

Query  178  KKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLL  237
            KK+ ATKE +L+ A+ EIE AKLIGR A  EI +QGE+LD +  +L  VEGDLD+ADKLL
Sbjct  173  KKMTATKEQMLKQAIEEIESAKLIGRSACQEIFIQGERLDHIGQELAHVEGDLDYADKLL  232

Query  238  RHMKRPMLHLFSGD--ERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRND  295
            RHMK P LH+FS D  +R K +  T  +S  T  A                  I    +D
Sbjct  233  RHMKNPGLHMFSSDARDRAKNTGRTKPSSRDTPSA----------VSEETRAAILSDSHD  282

Query  296  A-----LSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKAN  350
            A     LSD+E+LA  LGELE+QA L+N EA+K T Q+ RV ++L  VN+RV+ QT+KAN
Sbjct  283  AVGGAPLSDIERLASLLGELEQQATLLNEEAIKGTAQVERVGEQLAHVNERVKAQTRKAN  342

Query  351  ATM  353
            A++
Sbjct  343  ASI  345

>PHYRA_81100
Length=349

 Score = 329 bits (844),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 242/364 (66%), Gaps = 27/364 (7%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV  G+NLQ++YY
Sbjct  1    MNILRVPEIGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLEGSNLQISYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A    ++            FY+SS+E HEY VGVMG   KPFGFK++GHAPKKGY+
Sbjct  55   ESRAACHPPAAEPSAPKGS----FYLSSIEPHEYVVGVMGAAGKPFGFKMIGHAPKKGYV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQD-NSTTKTMFGFSASASPQL----  175
            ELD+FVE+ GD NKW+EV +NAL A ++ +R    Q  +S  K +FGF  S SPQ     
Sbjct  111  ELDVFVETQGDRNKWLEVARNALSAKRQLTRQAIDQSVSSNKKNLFGFGVSLSPQPLMTP  170

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ L   K++LL  ALR+IE AKL+GREA NEIV+QGEKLD +E DLG ++ DLD  
Sbjct  171  QKQMQTLTQNKDELLSGALRDIEAAKLVGREACNEIVIQGEKLDAIEQDLGAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQR  293
            DKLLR +K P LHLFS D R    P +  + GH+ + S       +    A         
Sbjct  231  DKLLRRLKSPTLHLFSDDSR----PKSTASKGHSPQRSQQSGGSPSRLPPAMETI-----  281

Query  294  NDA-LSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANAT  352
            NDA +SDLE+LA ALGELE QA ++N EA +ST+QI RVE +L+ V  RV+ QTK+A+AT
Sbjct  282  NDAGVSDLERLAQALGELEVQAEILNGEAGRSTQQIERVEHQLSNVTARVEKQTKQASAT  341

Query  353  MKAG  356
            ++AG
Sbjct  342  LRAG  345

>PPTG_17127
Length=351

 Score = 328 bits (840),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 240/363 (66%), Gaps = 23/363 (6%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV+YY
Sbjct  1    MNILRVPEHGTTASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A    +             FY+SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+
Sbjct  55   ESRAACHPPTGEPSAPKGS----FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTK-TMFGFSASASPQL----  175
            ELD+FV++L D NKW+EV +NAL   ++ +R    Q  S  K T+FGFS + SPQ     
Sbjct  111  ELDVFVDTLADRNKWLEVARNALSVKRQLTRQAIDQSVSPNKKTLFGFSVALSPQPAMSP  170

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ LA +K++LL +ALRE+E AKL+GREA NEIV+QGEKLD +E DL  ++ DLD  
Sbjct  171  QKQMQTLAKSKDELLSEALRELEAAKLVGREACNEIVIQGEKLDTIEQDLSAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQR  293
            DKLLR +K P LHLFS D R K    TGG+ G + +  H       +  +          
Sbjct  231  DKLLRRLKSPTLHLFSDDSRPKS---TGGSKGSSPQRFH---QSGGSSPSRLPPAFDTSS  284

Query  294  NDALSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM  353
            +   SDLE+LA ALGELE QA ++N EA  S++QI R+E  LT V  RV+ QTK+A+AT+
Sbjct  285  DAGGSDLERLAQALGELEVQAEMLNGEASHSSQQIERIEHHLTNVTTRVEKQTKQASATL  344

Query  354  KAG  356
             AG
Sbjct  345  SAG  347

>PHYCA_556162
Length=351

 Score = 326 bits (836),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 238/363 (66%), Gaps = 23/363 (6%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+   ATSG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV YY
Sbjct  1    MNILRVPEVGAATSG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVTYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A   ++             FY+SS+E HEY VGVMG   KPFGFK+VGHAPKKGY+
Sbjct  55   ESRAACHPTTGEASPPKGS----FYLSSIEPHEYVVGVMGAAGKPFGFKMVGHAPKKGYV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTK-TMFGFSASASPQL----  175
            ELD+FVE++GD NKW+EV +NAL A ++ +R    Q  S  K  +FGFS S SPQ     
Sbjct  111  ELDVFVETVGDRNKWLEVARNALSAKRQLTRQAIDQSVSPNKKNLFGFSVSLSPQPALSP  170

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ L   K+DLL DALR+IE AK IGREA NEIV+QGEKLD +E DL  ++ DLD  
Sbjct  171  QKQMQTLTKNKDDLLSDALRDIEAAKQIGREACNEIVIQGEKLDAIEQDLSAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQR  293
            DKLLR +K P LH+FS D R K +  +   +    R+        T    A   +I    
Sbjct  231  DKLLRRLKSPTLHMFSNDSRPKST--SSSKANSPQRSQQSGGSSPTRLAQAAESRI----  284

Query  294  NDALSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATM  353
            +   SDLE+LA ALGELE QA L+N EA  ST+QI  +E  L+ V  RV+ QTK+A+AT+
Sbjct  285  DPGASDLERLAQALGELELQAELLNDEAGHSTQQIQTIEHHLSTVTGRVEKQTKQASATL  344

Query  354  KAG  356
            +AG
Sbjct  345  RAG  347

>PITG_18456
Length=351

 Score = 320 bits (820),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 190/373 (51%), Positives = 236/373 (63%), Gaps = 43/373 (12%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQV+YY
Sbjct  1    MNILRVPEHGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVVDGSNLQVSYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A             +    FY+SS+E HEY VGVMG  +KPFGFK+VGHAPKKGY+
Sbjct  55   ESRAACHPPIGQPSAPKGI----FYLSSIEPHEYVVGVMGAADKPFGFKMVGHAPKKGYV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNST-TKTMFGFSASASPQL----  175
            ELD+FV++L D NKW+EV +NAL A ++ +R    Q  S   K +FGFS S SPQ     
Sbjct  111  ELDVFVDTLADRNKWLEVARNALGAKRQLTRQAIDQSVSPGKKNLFGFSVSLSPQPAMSP  170

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ L+ +K++LL  ALRE+E AKL+GREA NEIVVQGEKLD +E DL  ++ DLD  
Sbjct  171  QKQIQTLSKSKDELLSQALRELEAAKLVGREACNEIVVQGEKLDAIEQDLSAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDER----------VKQSPHTGGASGHTDRASHgqtpgttnggt  283
            DKLLR +K P LHLFS D R            Q  H  G S  T                
Sbjct  231  DKLLRRLKSPTLHLFSDDSRPKSTGSSKGSSPQRSHQSGGSSPT----------------  274

Query  284  aggqqIHGQRNDALSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQ  343
                 +    +  +SDLE+LA ALGELE QA L+N EA +S++QI R+E  LT V  RV+
Sbjct  275  RLPPALEISSDAGVSDLERLAQALGELEVQAELLNGEAGRSSQQIERIEHHLTNVTTRVE  334

Query  344  TQTKKANATMKAG  356
             QTK+A+AT+ AG
Sbjct  335  KQTKQASATLSAG  347

>PHYSO_471523
Length=348

 Score = 317 bits (813),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/370 (51%), Positives = 234/370 (63%), Gaps = 40/370 (11%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NL V+YY
Sbjct  1    MNILRVPEVGATASG------DKARPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLNVSYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A    +             FY+SS+E HEY VGVMG  EKPFGFK+VGHAP+KGY+
Sbjct  55   ESRAACHPPTGEPSAPKGS----FYLSSIEPHEYVVGVMGAAEKPFGFKMVGHAPRKGYV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT-KTMFGFSASASPQL----  175
            ELD+FVE+L D NKW+EV +NAL A ++ +R    Q  S   K +FGF+ S SPQ     
Sbjct  111  ELDVFVETLNDRNKWLEVARNALSAKRQLTRQAIDQSVSPNRKNLFGFNISLSPQPNMSP  170

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ L  ++++LL DALR+IE AK +GREA NEIV QGEKLD +E DL  ++ DLD  
Sbjct  171  QKQMQTLTKSRDELLSDALRDIEAAKQVGREACNEIVTQGEKLDAIEQDLSAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDERVK------QSPHTGGASGHTDRASHgqtpgttnggtaggq  287
            DKLLR +K P LHLFS D R K       SP     SG   R                  
Sbjct  231  DKLLRRLKSPTLHLFSDDSRPKASASKASSPQRSQQSGRPPRLPPAMDSI----------  280

Query  288  qIHGQRNDA-LSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQT  346
                  NDA +SDLE+LA ALGELE QA L+N EA + T+QI R+E +L+ V  RV+ QT
Sbjct  281  ------NDAGVSDLERLAQALGELEVQAELLNGEAGRGTQQIERIEHQLSNVTARVEKQT  334

Query  347  KKANATMKAG  356
            K+A+A + +G
Sbjct  335  KQASAALDSG  344

>PHALS_06478
Length=345

 Score = 311 bits (797),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 235/367 (64%), Gaps = 37/367 (10%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILR+P+     SG      DK +PTSCEGYVTKRGHFRKSWRVR+LV +G+NLQVAYY
Sbjct  1    MNILRLPEPGATASG------DKAQPTSCEGYVTKRGHFRKSWRVRFLVLDGSNLQVAYY  54

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            ESR A    +             FY+S++E HEY +GVMG  ++PFGFK+VGHAP+KG++
Sbjct  55   ESRAACHPPNGESTMPKGS----FYLSNIEPHEYVIGVMGAADRPFGFKMVGHAPRKGFV  110

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKT-MFGFSASAS------P  173
            ELD+FVE+  D NKW+EV  NAL A ++ +R    Q  S  K  +FGFS  +S      P
Sbjct  111  ELDVFVETQTDRNKWLEVACNALKAKRQLTRQAIDQSVSPNKKKLFGFSVPSSTQPVMSP  170

Query  174  QLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
            Q Q++ LA +KE LL +ALREIE AKL+GREA NEIV QGEKLD++E DL  ++ DLD  
Sbjct  171  QKQMQTLATSKEGLLLEALREIEAAKLVGREACNEIVNQGEKLDVIEQDLSAIDRDLDFG  230

Query  234  DKLLRHMKRPMLHLFSGDERVK----QSPHTGGASGHTDRASHgqtpgttnggtaggqqI  289
            DKLL  +K P LH FS D R K      PH  G++  +                     I
Sbjct  231  DKLLHRLKSPTLHFFSDDTRPKVPLGDHPHHSGSTSPS----------------RLIPAI  274

Query  290  HGQRNDALSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKA  349
               R+  +SDL++LA ALGELE QA L+N+E+  S++QI R+E  L+ V +RV+ QTK+A
Sbjct  275  EITRDAGVSDLQRLAQALGELEVQAELLNSESGHSSQQIERIEHHLSHVTERVEKQTKQA  334

Query  350  NATMKAG  356
             AT+ AG
Sbjct  335  VATLSAG  341

>PYVX_18171
Length=294

 Score = 289 bits (739),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 186/246 (76%), Gaps = 14/246 (6%)

Query  19   GAG-DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgv  77
            GAG +  +PTSCEGYVTKRGHFRKSWRVRYLV +GA+L+VAY+ES+ A +  ++S G   
Sbjct  3    GAGVNVVRPTSCEGYVTKRGHFRKSWRVRYLVLDGADLRVAYFESKTAFQNGAASKGE--  60

Query  78   pvpkgsFYVSSVEKHEYWVGVMGG---REKPFGFKLVGHAPKKGYIELDIFVESLGDLNK  134
                  FY+SS++KH Y  G MG    +EKPFGFK+VGHAPKKGY ELDIFVE+L DL K
Sbjct  61   ------FYLSSIDKHAYVAGGMGAVGAQEKPFGFKMVGHAPKKGYTELDIFVETLADLTK  114

Query  135  WVEVVQNALDAAKKRSR--TGGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDAL  192
            W+EV  NAL++A   SR   G    ++TTK++FGFS + SPQ Q+K ++ +K++LL+DAL
Sbjct  115  WLEVAHNALESAAAMSRKAAGDGGGSATTKSLFGFSTTTSPQQQLKAMSVSKDELLKDAL  174

Query  193  REIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDE  252
            RE+EGAKLIGREA  E+VVQGEKLD +E++LG +E DLD+ DKLLR +K P+LHL + D 
Sbjct  175  RELEGAKLIGREACTEMVVQGEKLDGIEANLGGIESDLDYGDKLLRRLKSPVLHLLARDL  234

Query  253  RVKQSP  258
            R   SP
Sbjct  235  RRPPSP  240

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 1/37 (3%)

Query  324  STEQIARVEQRLTAVNDRVQTQTKKANATM-KAGNLF  359
            ST+QIAR+E+RLT VNDRVQ QTK+A + + + GN+F
Sbjct  258  STQQIARIEERLTTVNDRVQRQTKQATSGIQRGGNIF  294

>PYAR_13570
Length=322

 Score = 279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 167/327 (51%), Positives = 224/327 (69%), Gaps = 28/327 (9%)

Query  42   SWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGG  101
            SWRVRYLV NGA+L V+Y++S+D ++   +S           FY+SSVEKHEY VGV+G 
Sbjct  8    SWRVRYLVLNGADLCVSYFDSKDVARTPGASPKGS-------FYLSSVEKHEYVVGVLGA  60

Query  102  REKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTT  161
            ++KPFGFK+VGHAP+KGY+ELDIFVES GDL KW+EV Q+AL AAKK +R+ G  D ++T
Sbjct  61   QKKPFGFKMVGHAPRKGYVELDIFVESRGDLAKWLEVCQHALAAAKKLTRS-GLSDAAST  119

Query  162  KTMFGFSASASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQG--------  213
            K++FGFS + SPQ Q++KL+A+KE+LL+ A+ EIE AKL+GREA  EIVVQG        
Sbjct  120  KSLFGFSPATSPQKQIQKLSASKEELLKQAIDEIESAKLMGREACQEIVVQGVRKRGRLT  179

Query  214  -------EKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGH  266
                   EKLD +ES+L +V+ DLD+ DKLL H+K P+L+LFS D R K S     +  H
Sbjct  180  SGFSLHAEKLDHIESELQRVDADLDYGDKLLSHLKSPLLYLFSSDARDKNS----ASPAH  235

Query  267  TDRASHgqtpgttnggtaggqqIHGQRNDALSDleklalalgeleeqanlMNAEAVKSTE  326
            +   S      +     A GQ +  + +  +SD+E+LAL LGELE QA L+N EAV+ T 
Sbjct  236  SPVKSKQSALSSAARADALGQGVE-RASGEMSDMERLALLLGELEAQATLLNEEAVRGTT  294

Query  327  QIARVEQRLTAVNDRVQTQTKKANATM  353
            Q+ RV   L  +N+RVQ QTKKA++ +
Sbjct  295  QVERVGDALAHINERVQNQTKKADSAV  321

>PHYKE_8393
Length=326

 Score = 270 bits (691),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 224/364 (62%), Gaps = 50/364 (14%)

Query  1    MNILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            MNILRVP+     SG      DK +PTSCEGYVTKRGHF                   + 
Sbjct  1    MNILRVPEVGATASG------DKARPTSCEGYVTKRGHF--------------PCHPPHG  40

Query  61   ESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYI  120
            E+               P  KGSFY+S++  HEY VGVMG  +KPFGFK+VGHAP+KGY+
Sbjct  41   ET---------------PAHKGSFYLSNIAPHEYVVGVMGAADKPFGFKMVGHAPRKGYV  85

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKT-MFGFSASASPQL----  175
            ELD+FVE+L D NKW+EV +NAL A ++  R    Q  S TK  MFGF  S SPQ     
Sbjct  86   ELDVFVETLSDRNKWLEVARNALGAKRQIMRQAIDQSVSPTKKGMFGFGLSLSPQPLVPP  145

Query  176  --QVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHA  233
              Q++ L   KE+LL +ALRE+E AK++GREA NEIVVQGEKLD VE DL  ++ DLD  
Sbjct  146  QKQIQALTHNKEELLAEALRELEAAKMVGREACNEIVVQGEKLDSVEHDLHAIDRDLDFG  205

Query  234  DKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQR  293
            DKLLR +K P LHLFS D R K       +  +++ +S  +T  +            G  
Sbjct  206  DKLLRRLKNPTLHLFSDDTRPK-------SHANSNESSPQRTHQSAGSNPIHLPFSMGSA  258

Query  294  NDA-LSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANAT  352
            NDA  SDLE+LA ALGELE QA L+N EA +ST+QIAR+EQ+L+ V  RV+ QTK+A+AT
Sbjct  259  NDADASDLERLAHALGELELQAELLNGEAGRSTQQIARIEQQLSNVTARVEKQTKQASAT  318

Query  353  MKAG  356
            + AG
Sbjct  319  LSAG  322

>CCA18899
Length=343

 Score = 256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 221/353 (63%), Gaps = 37/353 (10%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkg  82
            ++ PTSCEGYVTKRGHFRKSWRVRYLV +G N+QV+YYES+D+SK  +++          
Sbjct  12   RYTPTSCEGYVTKRGHFRKSWRVRYLVISGVNMQVSYYESKDSSKSKNATPKGS------  65

Query  83   sFYVSSVEKHEYWVGVM---GGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVV  139
             F + S EKHEYW+  M     +EKPFGFK+VGHAPK+GYIELD+FV+S  D+++W++V+
Sbjct  66   -FILQSAEKHEYWISQMVTGSVKEKPFGFKMVGHAPKQGYIELDVFVDSSSDMDQWLDVI  124

Query  140  QNALDAAKKRSRTGGFQDNSTTKTMFGFS-ASASPQLQVKKLAATKEDLLRDALREIEGA  198
             N L A+K  +R     +  TTK++ GFS    + + Q++ L + K D + +AL++IE A
Sbjct  125  NNGLKASKCMAREAFMAEMDTTKSVLGFSYIGTTSKQQIQVLKSKKCDYIHEALQQIEMA  184

Query  199  KLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSP  258
            K  G  A +EIV QGE+L  VE +L  ++ DL+H++KL++ ++ P+ + FS     +  P
Sbjct  185  KSAGNAACDEIVSQGEQLGKVEQNLSTIQNDLNHSEKLIKSIRHPLRYFFS-----RSRP  239

Query  259  HTGGASGHTDRASHgqtpgttnggtaggqqIHGQRND------------ALSDleklala  306
            H        DRA+      + +        +H  + D              +D+EKLA+A
Sbjct  240  H--------DRAT-ISKSSSIHRSHHHPGILHKTKKDRNVDHLAEEIRVPTNDIEKLAMA  290

Query  307  lgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNLF  359
            L +LE QA L+N+EAVKS EQIAR+E +L+ +NDR+Q QT +   +    NLF
Sbjct  291  LKDLEVQAQLINSEAVKSNEQIARIEGQLSGINDRIQAQTSQVITSSGKQNLF  343

>CCI45123
Length=301

 Score = 201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 196/321 (61%), Gaps = 36/321 (11%)

Query  55   LQVAYYESRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVM---GGREKPFGFKLV  111
            +QV+YYES+D+ K  +++           F + +VEKHEYW+  M     +E+PFGFK+V
Sbjct  1    MQVSYYESKDSYKNRNATPKGS-------FILQNVEKHEYWISRMVTGSVKERPFGFKMV  53

Query  112  GHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFS-AS  170
            GHAPK+GY+ELD+FV+SL ++++W++V+ N L A K+ +R     +  TTK + GFS A 
Sbjct  54   GHAPKQGYVELDVFVDSLSNMDQWLDVINNGLKANKRMAREAFMAEMDTTKGVLGFSFAG  113

Query  171  ASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDL  230
             + + QVK+L + K D + +AL++IE AK  G  A +EIV QGE+L  VE +L  +E DL
Sbjct  114  TTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGKVEQNLSNIESDL  173

Query  231  DHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIH  290
            +H++KL++ ++ P+ + FS     ++   +   + H  R+ H                +H
Sbjct  174  NHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNH--RSHH-----------HQTGILH  220

Query  291  GQRNDA------------LSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAV  338
             ++ND              +DLEKLA+AL ELE QA L+N+EAVKS +QI R+E +L+ +
Sbjct  221  MRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSNDQITRIEGQLSGI  280

Query  339  NDRVQTQTKKANATMKAGNLF  359
            NDR+Q+QT +  A+    NLF
Sbjct  281  NDRIQSQTTQVVASSGKKNLF  301

>SPRG_06336
Length=335

 Score = 164 bits (416),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 185/343 (54%), Gaps = 23/343 (7%)

Query  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgs  83
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+V+YY+S+       +   +  P  KGS
Sbjct  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYYDSK-------TIYKSDKPKEKGS  60

Query  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
            F ++ +EKH+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +W+EV  NAL
Sbjct  61   FILAEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118

Query  144  DAAKKRSRTGGFQDNSTTKTMFGFSASA----SPQLQVKKLAATKEDLLRDALREIEGAK  199
                 ++ T     +     + G  A +    S  +Q++ +  TKE+LLR A+  +E A+
Sbjct  119  G----KNVTPQASVDQRASALLGHRAPSGFLTSAPVQLRNVNKTKEELLRKAIVTLEHAR  174

Query  200  LIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQ---  256
             +G   V+E+    E LD+ E+++  VE +LD  D +++ M  P  + FS  +  K+   
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVETELDRGDNIIKKMTSPFFYYFSSSKSKKKGTG  234

Query  257  SPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRNDALSDl-eklalalgeleeqan  315
            SP +  A  H  +          + G A      G   DA  D  ++L+  L  LE  AN
Sbjct  235  SPKSKSARSHQPQTPMNSPTHKKSSGPASKAG--GATTDAGDDELDQLSKILASLEVHAN  292

Query  316  lMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNL  358
             ++ E  ++TEQI R+++++   ++R+  Q+ K +A  +   L
Sbjct  293  TISTEVERTTEQIDRIQKKMVEADERIVEQSAKVHAIQEKNKL  335

>SDRG_01781
Length=335

 Score = 160 bits (406),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/343 (35%), Positives = 184/343 (54%), Gaps = 23/343 (7%)

Query  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgs  83
            FK TSCEGYVTKRGH  KSWR RY+V +G  L+V+Y++S+       +   +  P  KGS
Sbjct  8    FKQTSCEGYVTKRGHVMKSWRRRYMVLDGDTLKVSYFDSK-------TIYKSDKPKEKGS  60

Query  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
            F ++ +EKH+Y     GG  KP+GFKLVGHAP  GY E  ++VE+  D  +W+EV  NAL
Sbjct  61   FILAEIEKHDY--SDEGGGVKPYGFKLVGHAPGHGYKEFCVYVETAKDQTQWLEVAHNAL  118

Query  144  DAAKKRSRTGGFQDNSTT----KTMFGFSASASPQLQVKKLAATKEDLLRDALREIEGAK  199
               K  +        +T     +   GF  SA   +Q++ +  TKE+LLR A+  +E A+
Sbjct  119  --GKNVAPQASADQRATALLGHRAASGFLTSAP--VQLRNVNKTKEELLRKAIVTLEHAR  174

Query  200  LIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQ---  256
             +G   V+E+    E LD+ E+++  V  +LD  D +++ M  P  + FS  +  K+   
Sbjct  175  TVGDNTVSEMGHNAEMLDIAEANMDYVGTELDRGDNIIKKMTSPFFYYFSSSKSKKKGAG  234

Query  257  SPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRNDALSDl-eklalalgeleeqan  315
            SP +  A  H  +        T    +    +  G   DA  D  ++L+  L  LE  AN
Sbjct  235  SPKSKSARSHLPQTP--MNSPTNKKPSGPTSKTGGPTTDAGDDELDQLSKILASLEVHAN  292

Query  316  lMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKAGNL  358
             ++ E  ++TEQI R+++++   ++RV  Q+ K +A  +   L
Sbjct  293  TISTEVERTTEQIDRIQKKMVEADERVVEQSAKVHAIQQKNKL  335

>H257_06294
Length=358

 Score = 147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 123/366 (34%), Positives = 183/366 (50%), Gaps = 50/366 (14%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkg  82
            K   TSCEGYVTKRGH  KSW+ RY+V NG  L V+YY+S++          T    PKG
Sbjct  7    KIHQTSCEGYVTKRGHLMKSWKRRYMVLNGDTLLVSYYDSKEI--------YTSKGHPKG  58

Query  83   sFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNA  142
            SF +S  EK +  +   G   KPFGFK +GH P +GY E  ++VES  D  KW+ V  NA
Sbjct  59   SFVLSECEKQD--LSDEGASVKPFGFKFIGHCPGQGYKEYSVYVESQIDQTKWLNVAHNA  116

Query  143  L--DAAKKRSRT-------------GGFQDNSTTKTM-----FGFSASA----SPQLQVK  178
            L  +++ ++S +                Q N   + M      G   SA    S + Q+K
Sbjct  117  LGKNSSPQKSMSQRIEEITGPLLPCASVQLNCPRRDMIHITTLGHKESAGLMQSLEAQMK  176

Query  179  KLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLR  238
             +  T ++LL+ A+ + + A  IG   VNE+V Q + L+  E  +  +   +DHA+ L R
Sbjct  177  NVKKTSQELLQQAINDAKEADRIGDATVNEMVYQEDVLNDAEGTVDTMGRQMDHAEDLGR  236

Query  239  HMKRPML----HLFSGDERVKQSPHTGGASGHTD----RASHgqtpgttnggtaggqqIH  290
             +K P+L    HLF+     K+S   GG    T     +AS               Q   
Sbjct  237  SLKHPILYKLTHLFTR----KKSYKKGGRGSKTRKGGAKASRSSRVSRVKLQPPQQQHAA  292

Query  291  GQ-RNDALSDleklalalgeleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKA  349
             Q  +D L  L K+   LG+  +  + + A   ++TEQ+ R++Q++T+V+DRV+ + K  
Sbjct  293  AQPEDDQLDQLSKILAKLGQTADTISDITA---RTTEQVDRIDQKVTSVDDRVKKEAKLV  349

Query  350  NATMKA  355
             A +KA
Sbjct  350  QAVLKA  355

>H310_09223
Length=333

 Score = 137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 110/348 (32%), Positives = 166/348 (48%), Gaps = 39/348 (11%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkg  82
            K   TSCEGYVTKRGH  K+W+ RY+V +G  L VAYY+S++               PKG
Sbjct  7    KIHQTSCEGYVTKRGHMMKTWKRRYMVLHGDTLLVAYYDSKEI--------YKSNGPPKG  58

Query  83   sFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNA  142
            SF +S  EK +  +   GG  KPFGFK +GH P +GY E  +FVE+  D  KW+ V  NA
Sbjct  59   SFVLSECEKQD--LSDEGGSVKPFGFKFIGHCPGQGYKEYMVFVETQIDQTKWLNVAHNA  116

Query  143  LD-----AAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDALREIEG  197
            L       +      GG     +   M    A      Q+K +  T  +LL+ A+ + + 
Sbjct  117  LGKTTYIPSPSMESHGGAGHKESAGLMISLEA------QIKNVKKTSHELLQQAINDAKE  170

Query  198  AKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRPML----HLFS----  249
            A  IG   V+E+  Q E L+  E+ +  +   +D A+ L + +K P+L    H+FS    
Sbjct  171  ADRIGDATVDEMAYQEEVLNDAENTVDAMGKQMDRAEDLGKSIKHPILYKFTHIFSRKKS  230

Query  250  --GDERVKQSPHTGGASGHTDRASHgqtpgttnggtaggqqIHGQRNDALSDleklalal  307
              G          GG S  + R   G                  Q  D L +L K+   L
Sbjct  231  KRGKRGASSKKRGGGKSTRSSRVPRGVQVKLHPPQPQPK-----QEEDQLDELSKILAKL  285

Query  308  geleeqanlMNAEAVKSTEQIARVEQRLTAVNDRVQTQTKKANATMKA  355
            G+  +  + +     ++TEQ+ R++Q++T+V++RV  + K   + +KA
Sbjct  286  GQTADTISDIT---TRTTEQVDRIDQKVTSVDERVTKEAKLVESVLKA  330

>CCI45127
Length=202

 Score = 106 bits (264),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 124/213 (58%), Gaps = 26/213 (12%)

Query  160  TTKTMFGFS-ASASPQLQVKKLAATKEDLLRDALREIEGAKLIGREAVNEIVVQGEKLDM  218
            TTK + GFS A  + + QVK+L + K D + +AL++IE AK  G  A +EIV QGE+L  
Sbjct  3    TTKGVLGFSFAGTTSKQQVKELKSRKSDYIHEALQQIEMAKSAGSAACDEIVAQGEQLGK  62

Query  219  VESDLGKVEGDLDHADKLLRHMKRPMLHLFSGDERVKQSPHTGGASGHTDRASHgqtpgt  278
            VE +L  +E DL+H++KL++ ++ P+ + FS     ++   +   + H  R+ H      
Sbjct  63   VEQNLSNIESDLNHSEKLIKSIRHPLRYFFSKTHHHEKDAMSKNNTNH--RSHH------  114

Query  279  tnggtaggqqIHGQRNDA------------LSDleklalalgeleeqanlMNAEAVKSTE  326
                      +H ++ND              +DLEKLA+AL ELE QA L+N+EAVKS +
Sbjct  115  -----HQTGILHMRKNDGKIEHVAEEICVPTNDLEKLAMALKELEVQAQLINSEAVKSND  169

Query  327  QIARVEQRLTAVNDRVQTQTKKANATMKAGNLF  359
            QI R+E +L+ +NDR+Q+QT +  A+    NLF
Sbjct  170  QITRIEGQLSGINDRIQSQTTQVVASSGKKNLF  202

>SDRG_12763
Length=1317

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 52/120 (43%), Gaps = 25/120 (21%)

Query  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgs  83
             KP SC GY+TK+GH RKSW+ RY V  GA L  +YY   D+    S +           
Sbjct  219  IKPISCAGYLTKQGHRRKSWKRRYFVLRGATL--SYYSDYDSMNKQSLAEV---------  267

Query  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
                 VE    W G      + FGF+ +       Y    +F ES  +  KW+  +Q  +
Sbjct  268  ----GVEDVALWDG------EQFGFQFITTEQVPYY----VFAESDRERQKWMVALQTLI  313

 Score = 35.4 bits (80),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (55%), Gaps = 4/42 (10%)

Query  19  GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
           G GD+     C GY+TKRGH   +W+ R+ V     + + YY
Sbjct  3   GDGDEIL---CAGYLTKRGHVVTNWKTRFFVLRPHAI-LCYY  40

>SPRG_06059
Length=1312

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 50/118 (42%), Gaps = 25/118 (21%)

Query  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgs  83
             KP SC GY+TK+GH RKSW+ RY V  G  L  AYY   D+    S +           
Sbjct  221  IKPISCAGYLTKQGHRRKSWKRRYFVLRGGTL--AYYADYDSMNKQSLAEV---------  269

Query  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQN  141
                 VE    W G      + FGF+ +       Y    +F ES  +  KW+  +Q 
Sbjct  270  ----GVEDVALWDG------EQFGFQFITTEQVPYY----VFAESDRERQKWMVALQT  313

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 55/150 (37%), Gaps = 13/150 (9%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            C GY+TKRGH   +W+ R+ V     +   Y +   A K          P      YVS+
Sbjct  12   CAGYLTKRGHVVTNWKTRFFVLRPHAILCYYADESMAKKLGQVHLVKVAPWE----YVSA  67

Query  89   VEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKK  148
               +       G  E  FGF          Y+  ++  E      KW+  +Q+       
Sbjct  68   TTANSILKSTRGSDEMKFGFMFFTTKRVAYYVYANVNAER----QKWLLALQDLYVVTSN  123

Query  149  RSRTGGFQDNSTTKTMFGFS-ASASPQLQV  177
             +   G+     TK   GFS  S+ P+  V
Sbjct  124  ATDCEGY----LTKRTPGFSFLSSRPKYYV  149

>PYIR_21589
Length=1568

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (47%), Gaps = 22/124 (18%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G NL +AYY   D +  +       V       
Sbjct  402  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYYPDYDLANSAKGRALAEV-------  452

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
               +VE  + W G      +PFGF  +       Y    ++ ++  + NKW+  ++    
Sbjct  453  ---TVEDVQKWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTT  499

Query  145  AAKK  148
             A++
Sbjct  500  VAEE  503

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+T+RGH   S R+ Y V NG +L     Q AY +++ A
Sbjct  305  SCEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRDNQSA  347

 Score = 40.4 bits (93),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEG++TKRGH   +W+ RY V  G  L+  Y+   D
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFAGED  244

>HYAP_08645
Length=1514

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 23/127 (18%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G NL ++YY   D +  +       V       
Sbjct  304  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDMANNTKGRPLAEVL------  355

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
                VE  + W G      +PFGF  + +     Y    ++ ++  + NKW+  + N L+
Sbjct  356  ----VEDVQSWDG------EPFGFMFMTNEQVPYY----VYADNDRERNKWMNAL-NKLN  400

Query  145  AAKKRSR  151
            A ++  +
Sbjct  401  AVEEEPQ  407

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V NG +L     Q AY E++ A
Sbjct  207  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRENQSA  249

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (63%), Gaps = 2/32 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            CEGY+TKRGH   +W+ RY    G  L+  YY
Sbjct  113  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YY  142

>H310_00230
Length=1248

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/132 (27%), Positives = 57/132 (43%), Gaps = 25/132 (19%)

Query  21   GDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvp  80
            G   +P +C GY+TK+GH RKSW+ RY V  GA L  +YY   +++     +        
Sbjct  218  GSSLQPIACAGYLTKQGHKRKSWKRRYFVLRGALL--SYYTDYESANKQCLAEV------  269

Query  81   kgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQ  140
                    +E  + W G M G    F F           +   ++ ++  +  KW+  ++
Sbjct  270  -------GIEDVQVWDGEMHG----FMFTTTEQ------VMYYVYADTERERQKWLVALK  312

Query  141  NALDAAKKRSRT  152
              LDA   R+ T
Sbjct  313  ALLDAQSNRAPT  324

 Score = 38.5 bits (88),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (68%), Gaps = 3/34 (9%)

Query  29  CEGYVTKRGHFRKSWRVRYLVFNG-ANLQVAYYE  61
           C GY+TKRGH   +W++R+ V    ANL  +YYE
Sbjct  12  CSGYLTKRGHVVTNWKMRFFVLRPHANL--SYYE  43

>H257_06721
Length=1238

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 56/130 (43%), Gaps = 25/130 (19%)

Query  21   GDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvp  80
            G   +P +C GY+TK+GH RKSW+ RY V  G+ L  +YY   D++     +        
Sbjct  224  GSSLQPIACAGYLTKQGHKRKSWKKRYFVLRGSLL--SYYTDYDSTNKQCLAEV------  275

Query  81   kgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQ  140
                    +E  + W G M G    F F           +   ++ ES  +  KW+  ++
Sbjct  276  -------GIEDVQVWDGEMHG----FMFTTSEQ------VVYYVYAESERERQKWLVSLK  318

Query  141  NALDAAKKRS  150
              LDA   R+
Sbjct  319  ALLDAQSTRA  328

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/141 (27%), Positives = 52/141 (37%), Gaps = 6/141 (4%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD-AskgssssggtgvpvpkgsFYVS  87
            C GY+TKRGH   +W++RY V    +  ++YYE    A K          P         
Sbjct  14   CRGYLTKRGHVVTNWKMRYFVLR-PHASLSYYEDESMAKKLGQVHLAKVAPWEYNGSLAK  72

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAK  147
            SV K E      G  E  +GF          Y    I+  S  +  KW   V +      
Sbjct  73   SVSKRESRGSSSGAEESRYGFMFFTTKRVVYY----IYTTSAIEHQKWFHAVADYYVHTS  128

Query  148  KRSRTGGFQDNSTTKTMFGFS  168
              +   G+    T  T+F FS
Sbjct  129  NVADCEGYMTKKTPGTLFSFS  149

>CCI44752
Length=1526

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 35/55 (64%), Gaps = 2/55 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +  ++ SN    +  +P +C GY+TK+GH RKSW+ RY +  G N+ ++YY+  D
Sbjct  399  RWVSNHSNTTTSNTVEPVACAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYD  451

 Score = 38.1 bits (87),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGY+TKRGH   +W+ R+ V +G  L+  YY S +
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEE  255

 Score = 38.1 bits (87),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTYLR  344

>PYIW_17381
Length=952

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (47%), Gaps = 22/124 (18%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G NL +AY+   D +  +       V       
Sbjct  402  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-IAYFTDYDIANSAKGKPLAEV-------  452

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
               +VE  + W G      +PFGF  +       Y    ++ ++  + NKW+  ++    
Sbjct  453  ---TVEDVQKWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLTT  499

Query  145  AAKK  148
             A++
Sbjct  500  VAEE  503

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 26/42 (62%), Gaps = 5/42 (12%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            CEGY+T+RGH   S R+ Y V NG +L     Q AY E++ A
Sbjct  306  CEGYLTRRGHLVPSQRMAYYVLNGTSLRHYADQSAYRENQSA  347

 Score = 41.2 bits (95),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEG++TKRGH   +W+ RY V  G  L+  Y+   D
Sbjct  211  CEGFLTKRGHVFTTWKTRYFVLRGNVLE--YFSGED  244

>PYU1_G006347
Length=1095

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 54/115 (47%), Gaps = 22/115 (19%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G NL ++YY   D +  +       V       
Sbjct  391  EPVSCAGYLTKQGHKRKSWKKRYFILRG-NL-ISYYSDYDLANSAKGKPLAEV-------  441

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVV  139
               +VE  + W G      +PFGF  +       Y    ++ ++  + NKW+  +
Sbjct  442  ---AVEDVQKWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNAL  483

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+T+RGH   S R+ Y V NGA+L     Q AY +++ A
Sbjct  294  SCEGYLTRRGHLVPSQRMAYYVLNGASLRHYADQSAYRDNQSA  336

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            CEG++TKRGH   +W+ RY V  G  L+
Sbjct  200  CEGFLTKRGHVFTNWKTRYFVLRGDVLE  227

>PHYRA_84916
Length=1541

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 26/120 (22%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G    ++YY   D +  +       V       
Sbjct  401  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYDMANNTKGKPLAEVL------  452

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
                VE  + W G      +PFGF  + +     Y    ++ ++  + NKW+    NAL+
Sbjct  453  ----VEDVQKWDG------EPFGFMFMTNEQVPYY----VYADNDRERNKWM----NALN  494

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 44/112 (39%), Gaps = 27/112 (24%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            CEGY+TKRGH   +W+ RY    G  L+  YY S +                   +   +
Sbjct  210  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEE---------------KSKKYGAVT  252

Query  89   VEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQ  140
            VEK   W G   G    F F      P        ++  S G+ ++W+  ++
Sbjct  253  VEKVAPWSGEAHG----FMFYTTKQIPYY------VYASSEGERSRWLRALK  294

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V NG +L     Q AY +++ A
Sbjct  304  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  346

>H310_00231
Length=1495

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 2/41 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            +P +C G++TK+GH RKSW+ RY V  G  L  AYY   DA
Sbjct  348  QPIACAGWLTKQGHKRKSWKKRYFVLRGTTL--AYYTDFDA  386

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 23/28 (82%), Gaps = 0/28 (0%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            CEGY+TKRGH   S+R+RY V +GA+++
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLSGASMK  278

 Score = 32.7 bits (73),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            GY+TKRGH   +W+ R+ V   A  +++YY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>H257_06722
Length=1482

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 3/47 (6%)

Query  20   AGDK-FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            A DK  +P +C G++TK+GH RKSW+ RY V  G  L  AYY   DA
Sbjct  342  ATDKPMQPIACAGWLTKQGHKRKSWKKRYFVLRGNTL--AYYTDFDA  386

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            CEGY+TKRGH   S+R+RY V  G+ ++  YY    A
Sbjct  251  CEGYLTKRGHLVPSYRMRYFVLCGSTIK--YYADETA  285

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 1/30 (3%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            GY+TKRGH   +W+ R+ V   A  +++YY
Sbjct  157  GYLTKRGHVVTNWKTRFFVLR-AGGRLSYY  185

>PHYSO_361747
Length=1523

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 55/121 (45%), Gaps = 23/121 (19%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P SC GY+TK+GH RKSW+ RY +  G    ++YY   D +  S       V       
Sbjct  410  EPVSCAGYLTKQGHKRKSWKKRYFILRGN--AISYYSDYDMANNSKGKPLAEVL------  461

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
                VE  + W G      +PFGF  +       Y    ++ ++  + NKW+  + N L+
Sbjct  462  ----VEDVQKWDG------EPFGFMFMTTEQVPYY----VYADNDRERNKWMNAL-NKLN  506

Query  145  A  145
            A
Sbjct  507  A  507

 Score = 42.7 bits (99),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 45/115 (39%), Gaps = 27/115 (23%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            CEGY+TKRGH   +W+ RY    G  L+  YY S +                   +   +
Sbjct  219  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEE---------------KSKKYGAVT  261

Query  89   VEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
            VEK   W G   G    F F      P        ++  S  + ++W+ V++  +
Sbjct  262  VEKVATWSGEAHG----FMFYTTKQIP------YYVYASSESERSRWLRVLKEYM  306

 Score = 42.4 bits (98),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            SCEGY+TKRGH   S R+ Y V NG +L+
Sbjct  313  SCEGYLTKRGHLVPSQRMAYYVLNGTSLR  341

>PYAR_23286
Length=607

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 2/40 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +P +C GY+TK+GH RKSW+ RY V  G++  V+YY   D
Sbjct  385  EPIACSGYLTKQGHKRKSWKKRYFVLRGSS--VSYYTDYD  422

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (64%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEG++TKRGH   +W++RY V  G  L+  Y+   D
Sbjct  194  CEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFAGED  227

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            +CEGY+T+RGH   S R  Y V NG +L     Q AY +++ A
Sbjct  288  TCEGYLTRRGHLVPSQRHAYYVLNGTSLRHYADQQAYRDNQSA  330

>PHYKE_1990
Length=1499

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 26/120 (22%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P +C GY+TK+GH RKSW+ RY +  G+   ++YY   D +  S       V       
Sbjct  402  EPVACAGYLTKQGHKRKSWKKRYFILRGST--ISYYSDYDMANNSKGKALAEVL------  453

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD  144
                VE  + W G      +PFGF  +       Y    ++ ++  + NKW+    NAL+
Sbjct  454  ----VEDVQRWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWM----NALN  495

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V NGA+L     Q AY +++ A
Sbjct  305  SCEGYLTKRGHLVPSQRMAYYVLNGASLRHYADQQAYRDNQSA  347

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEGY+TKRGH   +W+ RY    G  L+  YY S +
Sbjct  211  CEGYLTKRGHLFTNWKTRYFTLRGNVLE--YYSSEE  244

>PPTG_18898
Length=1559

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +P SC GY+TK+GH RKSW+ RY +  G    ++YY   D
Sbjct  404  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYD  441

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V NG +L     Q AY +++ A
Sbjct  307  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  349

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEGY+TKRGH   +W+ RY    G  L+  YY S +
Sbjct  213  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEE  246

>PITG_20562
Length=1559

 Score = 47.8 bits (112),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +P SC GY+TK+GH RKSW+ RY +  G    ++YY   D
Sbjct  405  EPVSCAGYLTKQGHKRKSWKKRYFILRGNT--ISYYSDYD  442

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V NG +L     Q AY +++ A
Sbjct  308  SCEGYLTKRGHLVPSQRMAYYVLNGTSLRHYADQQAYRDNQSA  350

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEGY+TKRGH   +W+ RY    G  L+  YY S +
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEE  247

>PYVX_20438
Length=1346

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (47%), Gaps = 28/132 (21%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsF  84
            +P +C GY+TK+GH RKSW+ RY +  G +  ++Y+   + +  +       V       
Sbjct  315  EPVACAGYLTKQGHKRKSWKKRYFILRGTS--ISYFADFEMANSAKGKALAEV-------  365

Query  85   YVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQ--NA  142
               +VE  + W G      +PFGF  +       Y    ++ ++  + NKW+  ++  NA
Sbjct  366  ---TVEDVQRWDG------EPFGFMFMTSEQVPYY----VYADNDRERNKWMNALRKLNA  412

Query  143  LD----AAKKRS  150
            +D    A KKR 
Sbjct  413  VDEEPEAEKKRC  424

 Score = 41.6 bits (96),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEGY+TKRGH   +W+ RY    G  L+  Y+ S D
Sbjct  123  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YFASDD  156

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 25/43 (58%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            SCEGY+TKRGH   S R+ Y V  G  L     Q AY E++ A
Sbjct  218  SCEGYLTKRGHLVPSQRMAYYVLTGTMLRHYADQQAYRENQSA  260

>CCA18875
Length=1514

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 2/40 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +P +C GY+TK+GH RKSW+ RY +  G N+ ++YY+  D
Sbjct  414  EPVTCAGYLTKQGHKRKSWKKRYFILRG-NI-ISYYQDYD  451

 Score = 38.5 bits (88),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGY+TKRGH   +W+ R+ V +G  L+  YY S +
Sbjct  223  EGYLTKRGHVFTNWKTRFFVLSGNVLE--YYSSEE  255

 Score = 38.1 bits (87),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            +CEGY+T+RGH   S RV Y V +G  L+
Sbjct  316  TCEGYLTRRGHLVPSQRVCYYVLSGTCLR  344

>SDRG_12762
Length=1392

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 23/123 (19%)

Query  26   PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFY  85
            P  CEGY+TKRGH   S+R+RY V  G+   V YY    A +  +S+             
Sbjct  255  PVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETAYRTGASALAEI---------  303

Query  86   VSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDA  145
               V+    W G   G      FK   ++       + +  E++ DL KW+E +    + 
Sbjct  304  --EVKSGGRWDGESTG----LFFKTATNS------TMFVCAENVADLQKWIEALGRIFNE  351

Query  146  AKK  148
            A K
Sbjct  352  APK  354

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANL  55
            K  P +C G++TK+GH RKSW+ RY V  G  L
Sbjct  354  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL  386

>SPRG_06058
Length=1258

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  25  KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           +P  CEGY+TKRGH   S+R+RY V  G+   V YY    A
Sbjct  43  RPVDCEGYLTKRGHLVPSYRLRYFVMCGS--VVKYYSDETA  81

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 2/43 (5%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            K  P +C G++TK+GH RKSW+ RY V  G  L  +YY   +A
Sbjct  143  KPAPVACAGWLTKQGHKRKSWKKRYFVLRGTVL--SYYADFEA  183

>PYAP_16997
Length=1018

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANL  55
            +P +C GY+TK+GH RKSW+ RY V  G ++
Sbjct  398  EPIACSGYLTKQGHKRKSWKKRYFVLRGNSI  428

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 24/37 (65%), Gaps = 2/37 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +CEG++TKRGH   +W++RY V  G  L+  Y+   D
Sbjct  206  ACEGFLTKRGHVFTNWKMRYFVLRGNVLE--YFSGDD  240

 Score = 38.5 bits (88),  Expect = 0.062, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 26/43 (60%), Gaps = 5/43 (12%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANL-----QVAYYESRDA  65
            +CEG++T+RGH   S R  Y V NG +L     Q AY +++ A
Sbjct  301  TCEGFLTRRGHLVPSQRFAYYVLNGTSLRHYADQQAYRDNQSA  343

>PYIR_15309
Length=937

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 31/59 (53%), Gaps = 4/59 (7%)

Query  7    PDAKLATSGSNGGAGDKF--KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            PD     SGS   A +         EGYVTKRGH  ++W+ R+    G NL  +YYES+
Sbjct  123  PDTPSIVSGSEDHAVESLDLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK  179

>PYU1_G001063
Length=783

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W+ R+    G NL  +YYES+
Sbjct  147  EGYVTKRGHLVRNWKNRFFTLEGTNL--SYYESK  178

>PYIW_13172
Length=939

 Score = 43.5 bits (101),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W+ R+    G NL  +YYES+
Sbjct  150  EGYVTKRGHLVRNWKNRFFTLEGNNL--SYYESK  181

>CCI10489
Length=777

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 34/60 (57%), Gaps = 4/60 (7%)

Query  7    PDAKLATSGS-NGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            P  +L+ S   N    D FK T  EGY+ KRGH  +SWR R+ V +G  L  +YY S++ 
Sbjct  84   PSQRLSVSPEVNHTFEDMFK-TDWEGYIWKRGHVVRSWRHRFAVLSGTCL--SYYTSKEV  140

>PHALS_03645
Length=830

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 30/57 (53%), Gaps = 2/57 (4%)

Query  9    AKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
             +L+ S     A D    T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  83   TRLSVSPDLSNAFDDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTIF--SYYVSKDV  137

>PYAP_17290
Length=835

 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G NL  +YYE++
Sbjct  153  EGYVTKRGHLVRNWKMRFFTLEGNNL--SYYENK  184

>PYVX_13574
Length=950

 Score = 43.1 bits (100),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 26/34 (76%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G NL V+YYES+
Sbjct  159  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYESK  190

>PYU1_G004386
Length=837

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (51%), Gaps = 2/57 (4%)

Query  9    AKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
             +L+       A D    T  EGY+ K+GH  +SWR RY + +G     +YY S+D 
Sbjct  118  VRLSVCADENDAFDDMFETDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKDV  172

>PHYKE_2479
Length=171

 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G NL V+YYE++
Sbjct  76   EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  107

>PPTG_13401
Length=927

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 4/57 (7%)

Query  7    PDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            PD+   +SG N            EGYVTKRGH  ++W++R+    G NL V+YYE++
Sbjct  88   PDS--MSSGDNAVESLDLPMVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  140

>PYVX_18338
Length=746

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query  17   NGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            +G   D F+ T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  70   HGSIEDAFE-TDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  115

>PHYSO_344112
Length=813

 Score = 42.7 bits (99),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D
Sbjct  84   RLSVSPDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKD  136

>HYAP_08026
Length=798

 Score = 42.4 bits (98),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 30/57 (53%), Gaps = 2/57 (4%)

Query  9    AKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
             +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  70   TRLSVSPDLCSAFEDLFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  124

>PITG_11303
Length=293

 Score = 42.0 bits (97),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (6%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            CEGY+TKRGH   +W+ RY    G  L+  YY S +
Sbjct  214  CEGYLTKRGHVFTNWKTRYFTLRGNVLE--YYSSEE  247

>PITG_02762
Length=810

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  84   RLSVSPDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PHYCA_506137
Length=810

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D
Sbjct  84   RLSVSPDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKD  136

>PPTG_05519
Length=810

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  84   RLSVSPDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  137

>PHALS_06533
Length=930

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 3/58 (5%)

Query  7    PDAKLATSGSNGGAGDKFKP-TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            PD+   T G +        P    EGYVTKRGH  ++W++R+    G NL V+YYE++
Sbjct  87   PDSMSVTMGGDQAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  142

>PITG_18067
Length=924

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (59%), Gaps = 2/51 (4%)

Query  13   TSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            +SG N            EGYVTKRGH  ++W++R+    G NL V+YYE++
Sbjct  92   SSGDNAVESLDLPIVEWEGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  140

>PHYCA_503112
Length=214

 Score = 41.2 bits (95),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  8    DAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            DA    SG N            EGYVTKRGH  ++W+ R+    G NL V+YYE++
Sbjct  95   DAMSVLSGDNSVESLDLPIVEWEGYVTKRGHLVRNWKSRFFTLEG-NL-VSYYENK  148

>PHYRA_79281
Length=809

 Score = 42.4 bits (98),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 30/56 (54%), Gaps = 2/56 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S+D 
Sbjct  83   RLSVSPDLSCAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGTTF--SYYVSKDV  136

>CCI41225
Length=981

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G  L  +YYES+
Sbjct  140  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYESK  171

>PYAR_19914
Length=788

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 31/58 (53%), Gaps = 8/58 (14%)

Query  12   ATSGSNGGAGD------KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
             ++GS  G GD             EGYVTKRGH  ++W+ R+    G NL  +YYE++
Sbjct  122  TSNGSTLGDGDIAVESLDLPIVEWEGYVTKRGHLVRNWKNRFFTLEGNNL--SYYENK  177

>PHYRA_77834
Length=936

 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G NL V+YYE++
Sbjct  119  EGYVTKRGHLVRNWKMRFFTLEG-NL-VSYYENK  150

>PHYKE_5678
Length=809

 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 3/61 (5%)

Query  6    VPD-AKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +P+  +L+ S     A +    T  EGY+ K+GH  +SWR RY V +G     +YY S++
Sbjct  78   IPNRTRLSVSPDLSSAFEDIFETDWEGYIWKQGHVVRSWRYRYAVLSGVTF--SYYVSKE  135

Query  65   A  65
             
Sbjct  136  V  136

>PYAP_22646
Length=815

 Score = 41.2 bits (95),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (7%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            D F+ T  EGY+ K+GH  +SWR RY + +G     +YY S+D 
Sbjct  96   DMFE-TDWEGYIWKQGHVVRSWRYRYAILSGTTF--SYYISKDV  136

>CCI42457
Length=906

 Score = 40.8 bits (94),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYV KRGH  ++W++R+    G   +V+YYES+
Sbjct  130  EGYVIKRGHLVRNWKMRFFTLEGN--RVSYYESK  161

>H257_03093
Length=975

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (55%), Gaps = 5/53 (9%)

Query  15   GSNGGAGDKFKPTS---CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             S+ GA     PT     EGYV K+G +   W  RYLV +GA+L   YY S+D
Sbjct  86   SSSKGASRPPPPTHEVHWEGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKD  136

>SPRG_17022
Length=107

 Score = 37.7 bits (86),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           T  EGY+ K+GH  ++WR RY V +G      YY S++A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>CCA16487
Length=975

 Score = 40.8 bits (94),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (71%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYVTKRGH  ++W++R+    G  L  +YYE++
Sbjct  138  EGYVTKRGHLVRNWKMRFFTLEGNRL--SYYENK  169

>PYIR_18382
Length=1154

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 53/131 (40%), Gaps = 22/131 (17%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSV  89
            EGYV K+G +   W  RYLV +GA L   YY +++                +G   +S V
Sbjct  129  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKE--------EARSARNLRGRMIISKV  178

Query  90   EKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKR  149
                Y      G+   F  +  GH     +  L    E   D+  WVE++Q A+D   K 
Sbjct  179  RPENY------GKAHGFLIETKGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVKH  226

Query  150  SRTGGFQDNST  160
            S  G   D  T
Sbjct  227  SLNGSSVDPET  237

>PPTG_14626
Length=1055

 Score = 40.4 bits (93),  Expect = 0.015, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 55/130 (42%), Gaps = 38/130 (29%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            C G++ K G   KSW+ RY    G+ L  +YY+S   S   S S             V +
Sbjct  714  CVGWLKKEGGKVKSWKRRYFTLYGSKL--SYYKSEKGSLLRSVS-------------VIN  758

Query  89   VEKHE-----YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
            VE H        V  +GGR      KL+  A            ES G+ NKW+  +Q A+
Sbjct  759  VEPHPSVSLGLTVSTVGGR------KLIVQA------------ESNGEFNKWLNAIQEAV  800

Query  144  DAAKKRSRTG  153
              A +R+ TG
Sbjct  801  AEASERNSTG  810

>CCA17102
Length=884

 Score = 40.4 bits (93),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            EGYV KRGH  ++W++R+    G  L  +YYES+
Sbjct  110  EGYVIKRGHLVRNWKMRFFTLEGNRL--SYYESK  141

>PYU1_G008848
Length=765

 Score = 40.4 bits (93),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 62/157 (39%), Gaps = 25/157 (16%)

Query  2    NILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
            N+  V D    ++ S  G   +      EGYV K+G +   W  RYLV +GA L   YY 
Sbjct  109  NVENVEDFLFDSTASTPGVAHEVH---WEGYVRKKGDWLPRWEERYLVLDGAAL--TYYN  163

Query  62   SRDAskgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIE  121
            +++                +G   +S V    Y      G+   F  +  GH     +  
Sbjct  164  TKE--------EARSARNLRGRMIISKVRPENY------GKAHGFLIETKGHK----HFH  205

Query  122  LDIFVESLGDLNKWVEVVQNALDAAKKRSRTGGFQDN  158
            L    E   D+  WVE++Q A+D   K S  G   D+
Sbjct  206  LCCSTELEKDM--WVEMMQAAIDEGVKHSVNGNSMDS  240

>PYAR_19883
Length=833

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 2/55 (4%)

Query  10   KLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +L+ S       ++   T  EGY+ K+GH  ++WR RY + +G     +YY S+D
Sbjct  83   RLSVSPDISNTFEEMFETDWEGYIWKQGHVVRNWRYRYAILSGTTF--SYYISKD  135

>PYIW_16987
Length=821

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 52/131 (40%), Gaps = 22/131 (17%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSV  89
            EGYV K+G +   W  RYLV +GA L   YY +++                +G   +S V
Sbjct  120  EGYVRKKGDWLPRWEERYLVLDGAAL--TYYNTKE--------EARSARNLRGRMIISKV  169

Query  90   EKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKR  149
                Y      G+   F  +  GH     +  L    E   D+  WVE++Q A+D     
Sbjct  170  RPENY------GKAHGFLIETKGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVNH  217

Query  150  SRTGGFQDNST  160
            S  G   D  T
Sbjct  218  SANGTVVDPET  228

>PYIW_18480
Length=755

 Score = 39.7 bits (91),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (7%)

Query  22  DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           D F+ T  EGYV K+GH  +SWR RY + +G     +YY S++ 
Sbjct  46  DMFE-TDWEGYVWKQGHVVRSWRYRYAILSGTTF--SYYVSKEV  86

>PYVX_13312
Length=1016

 Score = 39.7 bits (91),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYL+ +GA L   YY S+D
Sbjct  76   EGYVRKKGDWLPRWEERYLILDGAALT--YYNSKD  108

>CCA21715
Length=782

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  27   TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            T  EGY+ K+GH  +SWR RY V +G     +YY S++
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKE  141

>CCA21860
Length=782

 Score = 39.3 bits (90),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  27   TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            T  EGY+ K+GH  +SWR RY V +G     +YY S++
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCF--SYYSSKE  141

>CCI46235
Length=1155

 Score = 39.3 bits (90),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 10/60 (17%)

Query  13   TSGSNGGAGDKFKPTSC--------EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            T   N     +F P+S         EGYV K+G +   W  RYLV +GA L   YY +++
Sbjct  95   TFNPNTAPTSQFPPSSVFQQHQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKE  152

>PYAR_15463
Length=1091

 Score = 39.3 bits (90),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 29/53 (55%), Gaps = 2/53 (4%)

Query  12   ATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +T+ ++G A         EGYV K+G +   W  RYLV +GA L   YY S++
Sbjct  60   STTAADGAASGINHEVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNSKE  110

>PYVX_23349
Length=924

 Score = 38.9 bits (89),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 52/128 (41%), Gaps = 18/128 (14%)

Query  16   SNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggt  75
            SN  A D     S  G++ K GH RK+W+ RY V   + L+    ESR            
Sbjct  432  SNKSAFDDSFLDSMSGWLRKLGHVRKNWKARYFVLEKSILRYYSDESR------------  479

Query  76   gvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKW  135
                 +   +  +   H   + + GGR+  F  + VG      Y  L +  E L D   W
Sbjct  480  SRLKGEVLLFHPATRVHYVDIHLSGGRDNTFAIQ-VG----SDYTLL-LQAERLSDRENW  533

Query  136  VEVVQNAL  143
            +  +++AL
Sbjct  534  MYCIEDAL  541

>PITG_18687
Length=1030

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 15/167 (9%)

Query  26   PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFY  85
            P   +G   K+G +   W   YL  +GA L+V  +ESR     +       +        
Sbjct  5    PIHWDGPAHKKGDWLPRWDDVYLSLDGATLRV--FESRGRFLEAQEQEQQQMQQDGNCTV  62

Query  86   VSSVEKHEYWVGVMGGRE--KPFGFKLVG-------HAPKKGYIELDIFVESLGDLNKWV  136
            VS  +KH Y V  +      +P GF +         H      +E  +++  LG +   V
Sbjct  63   VSD-KKHSYTVTYVEKENVGRPHGFYVKTKEKSKSLHLTVDSELERVLWIHLLGAV---V  118

Query  137  EVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKLAAT  183
            E VQN L  A++R +T G + +++ +     S    P++Q   L  T
Sbjct  119  EQVQNVLPKAQRRLKTMGSKIDTSPRKTLPLSTPRRPRIQTLTLLGT  165

>SDRG_01407
Length=815

 Score = 38.9 bits (89),  Expect = 0.050, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYLV +GA+L   YY ++D
Sbjct  85   EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKD  117

>PITG_17893
Length=747

 Score = 38.9 bits (89),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 55/133 (41%), Gaps = 21/133 (16%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH RK+W+ RY V   + L+  YY   D+S                  YV 
Sbjct  218  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYT--DSSCAKLKGEVLLFHPQTRVHYVD  273

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL---D  144
                    V V GGR+  F  + VG      Y  L +    L D   W+  +++AL   D
Sbjct  274  --------VHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDALLCRD  319

Query  145  AAKKRSRTGGFQD  157
            +   + R G + D
Sbjct  320  SYHPQGRAGPYFD  332

>H310_06378
Length=837

 Score = 38.9 bits (89),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EG+V K+GH  ++W+VRY    G NL ++YYE+++
Sbjct  59  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETKE  91

>PITG_07652
Length=1094

 Score = 38.9 bits (89),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 15/167 (9%)

Query  26   PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFY  85
            P   +G   K+G +   W   YL  +GA L+V  +ESR     +       +        
Sbjct  69   PIHWDGPAHKKGDWLPRWDDVYLSLDGATLRV--FESRGRFLEAQEQEQQQMQQDGNCTV  126

Query  86   VSSVEKHEYWVGVMGGRE--KPFGFKLVG-------HAPKKGYIELDIFVESLGDLNKWV  136
            VS  +KH Y V  +      +P GF +         H      +E  +++  LG +   V
Sbjct  127  VSD-KKHSYTVTSVEKENVGRPHGFYVKTKEKSKSLHLTVDSELERVLWIHLLGAV---V  182

Query  137  EVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKLAAT  183
            E VQN L  A++R +T G + +++ +     S    P++Q   L  T
Sbjct  183  EQVQNVLPKAQRRLKTMGSKIDTSPRKTLPLSTPRRPRIQTLTLLGT  229

>PPTG_04553
Length=904

 Score = 38.5 bits (88),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 55/133 (41%), Gaps = 21/133 (16%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH RK+W+ RY V   + L+  YY   D+S                  YV 
Sbjct  361  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYA--DSSCTKLKGEVLLFHPQTRVHYVD  416

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL---D  144
                    V V GGR+  F  + VG      Y  L +    L D   W+  +++AL   D
Sbjct  417  --------VHVAGGRDASFAIQ-VG----PDYTLL-LQAAQLRDRENWMYCIEDALLCRD  462

Query  145  AAKKRSRTGGFQD  157
            +   + R G + D
Sbjct  463  SYHPQGRPGPYFD  475

>H257_13567
Length=836

 Score = 38.5 bits (88),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 26/35 (74%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EG+V K+GH  ++W+VRY    G NL ++YYE+++
Sbjct  61  EGFVQKKGHLVRNWKVRYFTLEG-NL-LSYYETKE  93

>PHYKE_4910
Length=375

 Score = 38.1 bits (87),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (59%), Gaps = 2/46 (4%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            GA  +  P +  G+V K G   +SW+ R+LV  GA L  AYY++ D
Sbjct  118  GAMGRTDPVTYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKNTD  161

>CCA18023
Length=1138

 Score = 38.5 bits (88),  Expect = 0.065, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 28/56 (50%), Gaps = 10/56 (18%)

Query  17   NGGAGDKFKPTSC--------EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            N     +F P+S         EGYV K+G +   W  RYLV +GA L   YY +++
Sbjct  104  NTAPTSQFPPSSVFQQHQVHWEGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKE  157

>SPRG_00890
Length=883

 Score = 38.5 bits (88),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EGYV K+G +   W  RYLV +GA+L   YY ++D
Sbjct  31  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNTKD  63

>PYAP_18636
Length=1009

 Score = 38.5 bits (88),  Expect = 0.069, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 50/119 (42%), Gaps = 22/119 (18%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSV  89
            EGYV K+G +   W  RYLV +GA L   YY +++                +G   +S V
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGATL--TYYNTKE--------EARSGRNLRGRMIISKV  152

Query  90   EKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKK  148
                Y      G+   F  + +GH     +  L    E   D+  WVE++Q A+D   K
Sbjct  153  RPENY------GKAHGFLLETMGHK----HFHLCCSTELEKDM--WVEMMQAAIDEGVK  199

>SDRG_05150
Length=787

 Score = 38.5 bits (88),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           T  EGY+ K+GH  ++WR RY V +G      YY S++A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>SPRG_08346
Length=797

 Score = 38.5 bits (88),  Expect = 0.072, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           T  EGY+ K+GH  ++WR RY V +G      YY S++A
Sbjct  32  TDWEGYIWKQGHVVRNWRNRYAVLSGTCF--TYYASKEA  68

>PYIR_13120
Length=814

 Score = 38.1 bits (87),  Expect = 0.080, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 27/44 (61%), Gaps = 3/44 (7%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            D F+ T  EGY+ K+GH  +SWR RY + +G     +YY S++ 
Sbjct  100  DMFE-TDWEGYLWKQGHVVRSWRYRYAILSGTTF--SYYVSKEV  140

>PHYRA_82543
Length=1199

 Score = 38.1 bits (87),  Expect = 0.096, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  61  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  93

>PPTG_19371
Length=1195

 Score = 38.1 bits (87),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  103

>PHYSO_484541
Length=911

 Score = 37.7 bits (86),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 36/146 (25%), Positives = 60/146 (41%), Gaps = 29/146 (20%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvp  78
            G  +   P  C G++ K G   K+W+ RY   +G  L   Y++S +              
Sbjct  771  GTAETEDPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKSDNG-------------  815

Query  79   vpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEV  138
                SF V           V+  R K    ++     +K    L +  E+  DL++W++ 
Sbjct  816  ALLRSFTVCH---------VVTLRTKKLCLEITTEVGRK----LLVASETQADLDRWLDH  862

Query  139  VQNALDAAKKRSRTGGFQDNSTTKTM  164
            +  A+ AA+KR + GG      T+TM
Sbjct  863  LHRAI-AAEKRKKHGGDAPQRKTETM  887

>PYU1_G012859
Length=1183

 Score = 38.1 bits (87),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            KP    G++ K+GH  +SW+ RY V +G +LQ  Y+E+ D
Sbjct  491  KPEVKYGWLLKQGHLIRSWKQRYFVLHGDSLQ--YFENID  528

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 0/29 (0%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            +CEG++ K+GH  K W+ RY   N   L+
Sbjct  358  TCEGWLLKQGHKSKRWKRRYFTLNNDMLE  386

>PHYSO_544598
Length=1163

 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  19  EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  51

>SDRG_08800
Length=881

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EG+V+K+GH  ++W++RY     +NL ++YYES++
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESKE  98

>H310_04843
Length=968

 Score = 37.7 bits (86),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYLV +GA+L   YY S++
Sbjct  103  EGYVRKKGDWLPRWEERYLVLDGASL--TYYNSKE  135

>PITG_19213
Length=1201

 Score = 37.7 bits (86),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  71   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  103

>PHALS_04098
Length=1183

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGYV K+G +   W  RYL+ +GA L   YY S++
Sbjct  75   EGYVRKKGDWLPRWEERYLILDGATL--TYYNSKE  107

>SPRG_05449
Length=723

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 27/35 (77%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EG+V+K+GH  ++W++RY     +NL ++YYES++
Sbjct  66  EGFVSKKGHLVRNWKLRYFTLE-SNL-LSYYESKE  98

>PHALS_06699
Length=884

 Score = 37.4 bits (85),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 47/116 (41%), Gaps = 18/116 (16%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH  K+W+ RY V + + L+  YY   DA                   YV 
Sbjct  335  SMSGWLRKRGHVCKNWKDRYFVLHKSVLR--YYS--DACCTKLKGEVLLFHPQTCVHYVD  390

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
                    V V GGR+  F  + VG         L +  E L D   W+  +++AL
Sbjct  391  --------VHVTGGRDASFAIQ-VG-----SEYTLLLQAERLSDRENWMYCIEDAL  432

>CCI40991
Length=801

 Score = 36.6 bits (83),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  27   TSCEGYVTKRGHFRKSWRVRYLVFNGA--NLQVAYYES  62
            T  EGY+ K+GH  +SWR RY V +G   +  VA+ +S
Sbjct  106  TDWEGYIWKQGHVVRSWRYRYAVLSGTCFSCNVAHLQS  143

>SDRG_02135
Length=306

 Score = 36.2 bits (82),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 2/33 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           EGY+ K+GH  K+WR RY     A+L  AYY+S
Sbjct  2   EGYLLKQGHVVKNWRRRYFRLVDASL--AYYDS  32

>PHALS_06336
Length=511

 Score = 36.2 bits (82),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  26   PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            P +  G+V K G   +SW+ R+LV  GA L  AYY++ D
Sbjct  131  PATYAGWVFKEGSLVRSWKKRFLVCKGAEL--AYYKNTD  167

>PYVX_14593
Length=964

 Score = 36.6 bits (83),  Expect = 0.28, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 8/56 (14%)

Query  7    PDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            PDA LAT+  +GG     K   C G++ K+G    SW+ RY    G+ L+  YY+S
Sbjct  592  PDA-LATNSLDGG-----KLAECHGWMLKQGGSTTSWKRRYFTLYGSTLK--YYKS  639

>CCA25510
Length=1139

 Score = 36.6 bits (83),  Expect = 0.29, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            GY+ K+G F KSWR RY +       +AYY S++
Sbjct  197  GYLVKQGSFWKSWRRRYFILRRDVPILAYYTSKE  230

>PYIR_17453
Length=2619

 Score = 36.6 bits (83),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query  29    CEGYVTKRGHFR-KSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
             CEGYV  R HF   +WR R+ V     L + Y ++  A                    ++
Sbjct  2160  CEGYVRVRHHFLGAAWRERFAVLEDTRLYL-YPDTSAALSEGREQKALEKHD-----LIA  2213

Query  88    SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
               + H  +   +G     FGF++   A   GY+E  + +E   +  KW+  + NA+
Sbjct  2214  VKKWHPTYSTNLGNGSSRFGFRVENEA--GGYLECTVIIED--EQTKWLAAITNAV  2265

>PHYRA_73534
Length=1210

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 33/118 (28%), Positives = 49/118 (42%), Gaps = 22/118 (19%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH RK+W+ RY V   + L+  YY   D S                  YV 
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYT--DPSCAKLKGEVLLFHPQTRVHYVD  394

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVES--LGDLNKWVEVVQNAL  143
                    V V GGR+  F  + VG        E  + +++  L D   W+  +++AL
Sbjct  395  --------VHVAGGRDASFAIQ-VG-------PEYTLLLQAAQLRDRENWMYCIEDAL  436

>PHYSO_343629
Length=977

 Score = 36.2 bits (82),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 0/23 (0%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNG  52
            EGYVTKRGH  ++W++R+    G
Sbjct  130  EGYVTKRGHLVRNWKMRFFTLEG  152

>PHYRA_73535
Length=875

 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 47/116 (41%), Gaps = 18/116 (16%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH RK+W+ RY V   + L+  YY   D S                  YV 
Sbjct  339  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYT--DPSCAKLKGEVLLFHPQTRVHYVD  394

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
                    V V GGR+  F  ++    P+     L +    L D   W+  +++AL
Sbjct  395  --------VHVAGGRDASFAIQV---GPE---YTLLLQAAQLRDRENWMYCIEDAL  436

>PYIR_23372
Length=1415

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            S EGY+ K+    +SW+  Y V  G  +  AYYESR+
Sbjct  322  SFEGYLNKKSDLLQSWKATYCVLEGDTM--AYYESRE  356

>PYU1_G012274
Length=873

 Score = 36.2 bits (82),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            S EGY+ K+    +SW+  Y V  G  +  AYYESR+
Sbjct  310  SFEGYLNKKSDLLQSWKALYCVLEGETM--AYYESRE  344

>HYAP_04457
Length=1203

 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EGYV K+G +   W  RYL+ +G  L   YY S++
Sbjct  62  EGYVRKKGDWLPRWEERYLILDGPTL--TYYNSKE  94

>CCA19033
Length=1883

 Score = 36.2 bits (82),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  30    EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
             EGY+ KRGH   S R RY V    N  + Y+E+++
Sbjct  1021  EGYLLKRGHRIPSMRKRYFVLQSVNETLRYFETKE  1055

>PYIR_14494
Length=819

 Score = 35.8 bits (81),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 31/136 (23%), Positives = 53/136 (39%), Gaps = 34/136 (25%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            C G++ K G   K+W++RY   NGA L  +Y++S +     +                  
Sbjct  716  CSGWLRKEGSTIKNWKLRYFTLNGATL--SYFKSDNGPLLKTLKV---------------  758

Query  89   VEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKK  148
                     V+  R K F  ++   + +K    L I  ES  +  +W+  +  A+   K 
Sbjct  759  -------CHVLVMRTKKFCLEITTESGRK----LLIAAESNAEYERWLAALHQAVSTEKT  807

Query  149  RSRTGGFQDNSTTKTM  164
            R      ++N T K M
Sbjct  808  R------KENPTPKIM  817

 Score = 35.4 bits (80),  Expect = 0.58, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 1/37 (3%)

Query  21   GDKFKPTS-CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            G+ F  T+ CEG++ KRG    +W+ R+   NG  LQ
Sbjct  256  GETFAETNLCEGWLYKRGQRSTAWKRRFFTLNGFQLQ  292

>PYU1_G003229
Length=810

 Score = 35.8 bits (81),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 1/37 (3%)

Query  21   GDKFKPTS-CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            G+ F  T+ CEG++ KRG    +W+ R+   NG  LQ
Sbjct  251  GETFNETNMCEGWLYKRGQRSTAWKKRFFTLNGFQLQ  287

 Score = 33.1 bits (74),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 27/49 (55%), Gaps = 9/49 (18%)

Query  13   TSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
            TSGS+ G       T   G++ K+GH  KSW+ R+ V  G+   + Y+E
Sbjct  391  TSGSDSG-------TRKTGWLNKQGHRMKSWKRRFFVVEGST--ITYFE  430

 Score = 31.6 bits (70),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 30/57 (53%), Gaps = 5/57 (9%)

Query  10  KLATSGSNGGA-GDKFKPTSCE--GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           KL  +G+N  A G   K T C+  G+ +K+G   KSW+ RY V  G  L   Y+  R
Sbjct  7   KLHRAGNNVIAVGRVAKSTYCDYSGWASKQGSIIKSWKRRYFVLKGREL--IYFSER  61

>H257_07514
Length=810

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           T  EGYV K+GH  ++WR RY +  G      YY S++
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>H310_07701
Length=811

 Score = 35.8 bits (81),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           T  EGYV K+GH  ++WR RY +  G      YY S++
Sbjct  50  TDWEGYVWKQGHVVRNWRNRYGILTGTCF--TYYSSKE  85

>PHYKE_6662
Length=765

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EG+V K+G +   W  RYL+ +GA L   YY S++
Sbjct  72   EGFVRKKGDWLPRWEERYLILDGATL--TYYNSKE  104

>HYAP_06101
Length=984

 Score = 35.8 bits (81),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query  10   KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V   A+   AYY++
Sbjct  115  RLVRHGSDPMLNDAFYATQVQVGNFVKMGWLTKQGHLWKSWKTRFFVL-FADGTFAYYKN  173

Query  63   R  63
            +
Sbjct  174  K  174

>PHYKE_5588
Length=751

 Score = 35.4 bits (80),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (55%), Gaps = 2/44 (5%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GA D  +P  C G++ K G   K+W+ RY   +G  L   Y++S
Sbjct  431  GAVDVEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  472

 Score = 31.6 bits (70),  Expect = 9.6, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 20/37 (54%), Gaps = 1/37 (3%)

Query  21   GDKFKPTS-CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            G+ F+ +  CEG++ KRG     W+ RY    G  LQ
Sbjct  243  GETFEESVLCEGWLYKRGQRSTEWQRRYFKLKGFTLQ  279

>PHYSO_556164
Length=765

 Score = 35.4 bits (80),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 47/116 (41%), Gaps = 18/116 (16%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVS  87
            S  G++ KRGH RK+W+ RY V   + L+  YY   D+S                  YV 
Sbjct  220  SMSGWLRKRGHVRKNWKARYFVLEKSVLR--YYT--DSSCSKLKGEVLLFHPQTRVHYVD  275

Query  88   SVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
                    V V GGR+  F  ++    P      L +    L D   W+  +++AL
Sbjct  276  --------VHVAGGRDASFAIQV---GPD---YTLLLQAAQLRDRENWMYCIEDAL  317

>PYAP_16161
Length=889

 Score = 35.4 bits (80),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 24/41 (59%), Gaps = 3/41 (7%)

Query  24  FKPTSC-EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           F PT   EGY+ K+G   K W+ R+ V +G  L  +YY SR
Sbjct  23  FDPTFMKEGYLQKKGQMLKGWKQRWFVCDGRTL--SYYGSR  61

>SDRG_14070
Length=630

 Score = 35.0 bits (79),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query  13  TSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           +S S GGA  K +     G + KRGH RK+W  R+ V    +L+  YY+
Sbjct  11  SSASMGGAKKK-EEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>PYVX_13084
Length=1267

 Score = 35.0 bits (79),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            GY+ K+G F K+WR RY V       ++Y+ S+D
Sbjct  242  GYLVKQGSFWKTWRRRYFVLRRDLPVMSYFSSKD  275

>SPRG_11900
Length=605

 Score = 35.0 bits (79),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (3%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            KP  C GY+ K+G   K+WR RY   +G + Q++Y ++
Sbjct  234  KPRLC-GYLLKKGRTVKAWRKRYFSIDGVSNQLSYSDA  270

>SPRG_06021
Length=983

 Score = 35.0 bits (79),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 23/119 (19%), Positives = 50/119 (42%), Gaps = 19/119 (16%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            GY++KRG +RK+W+ RY +    +  + Y +S    +                  V    
Sbjct  139  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDSEQTLELVGQ--------------VPITP  184

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKR  149
                    +G ++ PF F++  H P++    L +   ++ +  KW+  ++  ++  + R
Sbjct  185  NTRVIDNSIGCQKAPFYFEV--HTPRR---VLYLGASTVQEHRKWIRSIRETVELVRSR  238

>PYIW_21901
Length=913

 Score = 35.0 bits (79),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (6%)

Query  7    PDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            PD  LA         D F   S  G++ K GH RK+W+ RY V + + L+  YY
Sbjct  403  PDLVLAAQDEVNAFDDSFL-DSMRGWLRKLGHVRKNWKSRYFVLDRSVLR--YY  453

>CCI43793
Length=1117

 Score = 35.0 bits (79),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            GY+ K+G F KSWR R+ +       +AYY S++
Sbjct  175  GYLVKQGSFWKSWRRRFFILRRDIPVLAYYASKE  208

>SPRG_14955
Length=635

 Score = 35.0 bits (79),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query  13  TSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           +S S GGA  K +     G + KRGH RK+W  R+ V    +L+  YY+
Sbjct  11  SSASVGGAKKK-EEILWSGVLQKRGHLRKNWLTRFFVLTPTHLR--YYK  56

>HYAP_08248
Length=784

 Score = 35.0 bits (79),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 19/27 (70%), Gaps = 0/27 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQV  57
            G +TKRGHF K+W  R+LV +   LQV
Sbjct  84   GALTKRGHFFKAWLPRHLVLSRGALQV  110

>HYAP_13757
Length=262

 Score = 34.3 bits (77),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 2/31 (6%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           G++ KRGH  K+W+ R+ + NGA L   YY+
Sbjct  15  GWLWKRGHTFKTWKKRFFLLNGAAL--TYYK  43

>PPTG_19153
Length=1219

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 63/161 (39%), Gaps = 28/161 (17%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            G +TK+G +R++W+ R+ +       + Y+ S D  +                     + 
Sbjct  147  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI---------------PIT  191

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRS  150
            +    +   GG   PF F++   A       L +  ES  +  +W++  Q   DA     
Sbjct  192  EDTIVLDRSGGGHAPFRFQIRTDAHT-----LLLEAESRENQKRWIDSCQELADAI----  242

Query  151  RTGGFQDNSTTKTMFGFSASASPQLQ---VKKLAATKEDLL  188
            R   F  N T+ + F      S  ++   V  L AT++DLL
Sbjct  243  RASKFSVN-TSMSSFSIDGRRSSLVRGTTVHTLRATEKDLL  282

>PHYSO_489872
Length=1240

 Score = 34.7 bits (78),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 24/117 (21%), Positives = 45/117 (38%), Gaps = 20/117 (17%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            G +TK+G +R++W+ R+ +       + Y+ S D  +                     + 
Sbjct  154  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI---------------PIT  198

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAK  147
            +    +   GG   PF F++   A       L +  ES  +  +W+E  Q   DA +
Sbjct  199  EDTIVLDRSGGGHAPFRFQIRTDAQT-----LLLEAESRENQKRWIEACQELADAIR  250

>PYAP_23478
Length=897

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (8%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            D F  + C G++ K GH RK+W++RY V + + L+  YY
Sbjct  372  DCFLDSMC-GWLRKLGHVRKNWKLRYFVLDKSVLR--YY  407

>PITG_03318
Length=1343

 Score = 34.7 bits (78),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query  10   KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V   ++   AYY++
Sbjct  111  RLVRHGSDPLLNDSFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKN  169

Query  63   R  63
            +
Sbjct  170  K  170

>PPTG_16044
Length=1378

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query  10   KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V   ++   AYY++
Sbjct  111  RLVRHGSDPLLNDSFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKN  169

Query  63   R  63
            +
Sbjct  170  K  170

>PYAR_19291
Length=711

 Score = 34.3 bits (77),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (62%), Gaps = 3/39 (8%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            D F  + C G++ K GH RK+W++RY V   + L+  YY
Sbjct  204  DTFLDSMC-GWLRKLGHVRKNWKMRYFVLEKSVLR--YY  239

>PYIR_15118
Length=1222

 Score = 34.7 bits (78),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F K+WR RY +       ++YY+S
Sbjct  193  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  224

>PHYSO_248481
Length=1283

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query  10   KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V   ++   AYY++
Sbjct  64   RLVRHGSDPLLNDAFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL-FSDGTFAYYKN  122

Query  63   R  63
            +
Sbjct  123  K  123

>SDRG_00080
Length=298

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  14   SGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            S S  G      P +  GYV K+G F K+W+ RY+V +   L   YY S  A
Sbjct  58   SSSRSGNEAPSGPPAFSGYVRKQGSFVKNWKRRYMVLHDDTL--FYYVSERA  107

>PYU1_G009508
Length=328

 Score = 33.9 bits (76),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G + K+WR RY +       ++YY+S
Sbjct  166  GYLVKQGSYWKTWRRRYFILRRDTPVLSYYDS  197

>SPRG_09128
Length=620

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            G++ K GH RKSW+ R+ V +G+ LQ  YY
Sbjct  268  GWLHKLGHRRKSWKHRFFVLDGSVLQ--YY  295

>PHYRA_73297
Length=119

 Score = 32.3 bits (72),  Expect = 1.3, Method: Composition-based stats.
 Identities = 13/29 (45%), Positives = 17/29 (59%), Gaps = 0/29 (0%)

Query  27  TSCEGYVTKRGHFRKSWRVRYLVFNGANL  55
           T  +GY+ +RG   KSWR RY +F    L
Sbjct  3   TVVDGYLERRGRHLKSWRRRYFIFEDGML  31

>SDRG_05567
Length=980

 Score = 34.3 bits (77),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY++KRG +RK+W+ RY +    +  + Y +S
Sbjct  137  GYLSKRGSWRKNWKQRYFILRIDHPSLCYCDS  168

>PYAP_24144
Length=1022

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 19/35 (54%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGY+ K+      WR  Y V  G  L  AYYESR+
Sbjct  314  EGYLHKKSDLLAQWRAIYCVLEGDTL--AYYESRE  346

>PYIW_18911
Length=1196

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 20/32 (63%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F K+WR RY +       ++YY+S
Sbjct  174  GYLVKQGSFWKTWRRRYFILRRDIPVLSYYDS  205

>PHYRA_76931
Length=1212

 Score = 34.3 bits (77),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 30/138 (22%), Positives = 52/138 (38%), Gaps = 27/138 (20%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            G +TK+G +R++W+ R+ +       + Y+ S D  +                     + 
Sbjct  152  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI---------------PIT  196

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRS  150
            +    +   GG   PF F++   A       L +  ES  +  +W++  Q   DA     
Sbjct  197  EDTIILDRSGGGHAPFRFQIRTEAQT-----LLLEAESRENQKRWIDSCQELADAI----  247

Query  151  RTGGFQDNSTTKTMFGFS  168
            R   F   S T +M  FS
Sbjct  248  RASKF---SVTTSMSSFS  262

>H310_00209
Length=1198

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (5%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            D F   + EGY++K+G    +W+  Y V  G  L +A Y+SR+
Sbjct  253  DAFGGIAFEGYLSKKGDLLAAWKSCYCVLEG--LTLAIYDSRE  293

>PYAP_22195
Length=901

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (62%), Gaps = 2/34 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           EGY+ K+G   K W+ R+ V NG  L  +YY SR
Sbjct  38  EGYLQKKGQRLKGWKRRWFVCNGRTL--SYYISR  69

>CCI39367
Length=2046

 Score = 34.3 bits (77),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 1/33 (3%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            G++ K+GH  KSWRVR+ V    +  +AYY  R
Sbjct  86   GWLRKQGHLWKSWRVRFFVLY-TDGTLAYYRKR  117

>CCI45895
Length=1721

 Score = 34.3 bits (77),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 0/35 (0%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGY+ KRGH   S R RY V    +  + Y+E+++
Sbjct  843  EGYLLKRGHRIPSMRKRYFVLQSVDPTLRYFETKE  877

>SDRG_03175
Length=934

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P   EGY+ KRG +   W   Y+V +G +L  AY++  D
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--AYFDKSD  58

>H310_06666
Length=887

 Score = 33.9 bits (76),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           EGY+ K+G   K W+ R+ V +G +L  +YY S+
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSSK  55

>PYAR_25500
Length=473

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 19/35 (54%), Gaps = 2/35 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           EGY+ K+      WR  Y V  G  L  AYYESR+
Sbjct  62  EGYLHKKSEVLSHWRATYCVLEGDTL--AYYESRE  94

>PYIW_18491
Length=1684

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            S EGY+ K+    ++W+  Y V  G  +  AYYESR+
Sbjct  307  SFEGYLNKKSDLLQTWKATYSVLEGDTM--AYYESRE  341

>H257_08182
Length=859

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 6/39 (15%)

Query  27   TSC----EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
            TSC    EG++ K+G   KSW+ RY V +G +L  AYY+
Sbjct  657  TSCMMTQEGWMLKQGKQVKSWKRRYFVVHGTDL--AYYK  693

>H257_03361
Length=699

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           +G++ K+G    SW+ RYLV +G N  ++Y++
Sbjct  11  QGWIQKQGSVVPSWKKRYLVLSGQN--ISYFD  40

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G++ K+G   +SW+ RY V  G N  +AY+++ D
Sbjct  212  GWLDKQGEIVQSWKQRYFVLRGRN--IAYFDTVD  243

>SPRG_00889
Length=994

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 59/142 (42%), Gaps = 22/142 (15%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSV  89
            EG+V K+G +   W  RYLV +G  L   Y +  DA  G +  G   +            
Sbjct  123  EGHVRKKGDWLPRWEPRYLVLDGTTLTY-YSKQHDARSGKNLRGRMVLT-----------  170

Query  90   EKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALD-AAKK  148
                 +VG     +K  GF +      KG+    +   +  + + WVE++Q ALD A+  
Sbjct  171  -----YVGPDFKSKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEASSA  221

Query  149  RSRTGGFQDNSTTKTMFGFSAS  170
             ++    QD+  +   +  S S
Sbjct  222  STKPPPPQDDFMSSPSYDLSRS  243

>PYVX_14527
Length=1269

 Score = 33.9 bits (76),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 2/34 (6%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G+V K G   +SW+ R+LV  GA+L  AYY++ D
Sbjct  589  GWVFKEGSLVRSWKKRFLVAKGADL--AYYKNTD  620

>PPTG_18989
Length=1213

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSWR R+ +       + YY S
Sbjct  188  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  219

>PHALS_03540
Length=904

 Score = 33.9 bits (76),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 22/38 (58%), Gaps = 2/38 (5%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +P  C G++ K G   K+W+ RY   +GA L   Y++S
Sbjct  782  EPVVCSGWLRKEGGTVKNWKRRYFTLHGATL--CYFKS  817

 Score = 33.5 bits (75),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQ  56
            CEG++ KRG     W+ RY +  G  LQ
Sbjct  272  CEGWLYKRGQRSTEWQRRYFILKGYQLQ  299

>PHALS_06568
Length=388

 Score = 33.5 bits (75),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           G+V K+G   KSW+ RY+V +G   Q+ YY++
Sbjct  12  GWVYKQGSIVKSWKKRYMVLSGR--QLTYYDT  41

>PHYSO_556902
Length=454

 Score = 33.5 bits (75),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKR  149
            EL+ F  S+ D+ +WV+ VQNALD  + R
Sbjct  265  ELEAFSASVDDIARWVKAVQNALDVREDR  293

>PYU1_G000724
Length=189

 Score = 32.7 bits (73),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            G++TK+GH  KSW+ R+ V   A+   AYY+++
Sbjct  111  GWLTKQGHMWKSWKTRFFVLF-ADGTFAYYKNK  142

>H257_09823
Length=654

 Score = 33.5 bits (75),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 0/26 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQ  56
            G++ K GH RK+W+ R+ V +G+ LQ
Sbjct  265  GWLYKLGHVRKNWKRRFFVLDGSVLQ  290

>HYAP_09304
Length=1144

 Score = 33.9 bits (76),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSWR R+ +       ++YY S
Sbjct  125  GYLVKQGSFWKSWRRRFFILRRDCPVLSYYTS  156

>PHYRA_81944
Length=1149

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSWR R+ +       + YY S
Sbjct  123  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  154

>PHALS_06334
Length=1064

 Score = 33.5 bits (75),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 50/129 (39%), Gaps = 38/129 (29%)

Query  29   CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSS  88
            C G++ K G   KSW+ RY    G+ L  +YY+S+                   S  V +
Sbjct  726  CVGWLKKEGKNVKSWKWRYFTLYGSKL--SYYKSK-------------TKTLLRSVIVEN  770

Query  89   VEKHE-----YWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
            V  H        V  +GGR                  +L I  ES  + NKW++ +Q A+
Sbjct  771  VVAHPSISLGLIVSTVGGR------------------KLLIRGESKDEFNKWLDAIQAAV  812

Query  144  DAAKKRSRT  152
               ++R  T
Sbjct  813  TVERRRKST  821

>PHALS_07930
Length=1200

 Score = 33.5 bits (75),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            GY+ K+G F KSWR R+ +       + YY S
Sbjct  184  GYLVKQGSFWKSWRRRFFILRRDRPVLCYYTS  215

>H310_01921
Length=341

 Score = 33.1 bits (74),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           G+V K+G   KSW+ RY+V    N Q+ Y+ES
Sbjct  24  GWVYKQGSMIKSWKKRYMVLK--NKQLTYFES  53

>PYAP_16734
Length=1314

 Score = 33.5 bits (75),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 22/117 (19%), Positives = 47/117 (40%), Gaps = 20/117 (17%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            G +TK+G +R++W+ R+ +    +  + YY+S +                       +V 
Sbjct  181  GTLTKQGSWRRNWKTRFFLLRRDHPSLCYYKSEE---------------KLELLGAIAVS  225

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAK  147
                 +    G   P+ F+L     + G   L +  E+  +  +W++  Q  +DA +
Sbjct  226  SDTLVLDKSAGGHAPYRFQL-----RTGDASLLLEAETRENQQRWMDACQELVDAVR  277

>HYAP_02230
Length=1195

 Score = 33.5 bits (75),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 27/136 (20%), Positives = 52/136 (38%), Gaps = 24/136 (18%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSVE  90
            G +TK+G +R++W+ R+ +       + Y+ S D  +                    ++ 
Sbjct  157  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEDKLELLGEI---------------AIT  201

Query  91   KHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKRS  150
            +    +   GG   PF F++   A       L +  ES     +W++  Q   DA     
Sbjct  202  EDTIVLDRSGGGTAPFRFQIRSDAHT-----LLLEAESRDSQKRWMDSCQELADAI----  252

Query  151  RTGGFQDNSTTKTMFG  166
            R   F  N++  ++ G
Sbjct  253  RASKFSVNTSVSSLSG  268

>SPRG_02752
Length=831

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           EG++ K+G    +W+ RY+V  G +  +AYY+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD  36

>PPTG_06130
Length=782

 Score = 33.1 bits (74),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  12   ATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQV  57
            +T G + GA +        G + KRG F K+W  R+LV +   LQV
Sbjct  88   STGGVSAGANNVGHEVILSGALNKRGQFFKTWLPRHLVLSRGALQV  133

>CCI43456
Length=126

 Score = 31.6 bits (70),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  22  DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANL  55
           D+ +  + EG +TKR  + K WR RY +  G  L
Sbjct  13  DRIQNPAFEGELTKRSMWMKEWRKRYFILKGNKL  46

>PYIR_24588
Length=909

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 3/39 (8%)

Query  22   DKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            D F  + C G++ K GH RK+W+ RY V   + L+  YY
Sbjct  404  DSFLDSMC-GWLRKLGHVRKNWKSRYFVLEKSVLR--YY  439

>SPRG_02939
Length=2161

 Score = 33.5 bits (75),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            + EGY+ K+GHF  + + +Y+V  G +L   +Y S DA
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLRGNHL--FFYASYDA  499

>PHYCA_504712
Length=208

 Score = 32.3 bits (72),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 2/44 (5%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            G  +  +P  C G++ K G   K+W+ RY   +G  L   Y++S
Sbjct  75   GTVETEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  116

>HYAP_13688
Length=1036

 Score = 33.1 bits (74),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 61/169 (36%), Gaps = 39/169 (23%)

Query  12   ATSGSNGGAGDKFKPTS------CEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            A  G N     +  P S      C G++ K G   KSW+ RY    GA L  +YY+    
Sbjct  675  ADEGENVSQVSELSPISVNESVGCVGWLRKEGGNVKSWKRRYFTLYGAKL--SYYKCEKG  732

Query  66   skgssssggtgvpvpkgsFYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIF  125
            S                   + SV+     VGV      P G  +     +K  I+ D  
Sbjct  733  S------------------LLRSVDT----VGVTVHPSMPNGLMVATAGGRKLIIQADTN  770

Query  126  VESLGDLNKWVEVVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQ  174
            VE     ++W+  +Q A      R  T      ST  +M  F  +AS +
Sbjct  771  VE----FDRWLNAIQRAASRGHDRRST-----VSTALSMTDFMETASSE  810

>H257_06469
Length=76

 Score = 30.4 bits (67),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAY  59
           EGYV K+GH  KSW+ RY   + +   + Y
Sbjct  2   EGYVFKQGHVVKSWQRRYFRLDTSTSVLEY  31

>PYIR_22259
Length=144

 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 0/25 (0%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANL  55
           GY++KRG   K+WR RY VF    L
Sbjct  19  GYLSKRGERIKTWRRRYFVFQNGCL  43

>SDRG_12776
Length=1184

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 7/51 (14%)

Query  14   SGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            S   G  G  F     EGY+ K+G    +W+  Y V  G  L V  YESR+
Sbjct  217  SSREGWGGIAF-----EGYLNKKGDLLAAWKSCYCVLEGKTLAV--YESRE  260

>PITG_09010
Length=782

 Score = 33.1 bits (74),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 24/46 (52%), Gaps = 0/46 (0%)

Query  12   ATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQV  57
            +T G + GA +        G + KRG F K+W  R+LV +   LQV
Sbjct  88   STGGVSAGANNVGHEVILSGALNKRGQFFKAWLPRHLVLSRGALQV  133

>PHYKE_7856
Length=346

 Score = 32.7 bits (73),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 7/48 (15%)

Query  10  KLATSGSNGGAGDKFKPTSCE-------GYVTKRGHFRKSWRVRYLVF  50
           +L   GS+    D F  T  +       G++TK+GH  KSW+ R+ V 
Sbjct  35  RLVRHGSDPLLNDGFYATQVQVGNFVKMGWLTKQGHMWKSWKTRFFVL  82

>PYAP_16658
Length=294

 Score = 32.7 bits (73),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            GY+ K+G F K+W+ RY +       +AYY S++
Sbjct  152  GYLVKQGSFWKTWKRRYFILRRDINVLAYYTSQE  185

>PPTG_14612
Length=331

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 48/93 (52%), Gaps = 4/93 (4%)

Query  138  VVQNALDAAKKRSRTGGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDALREIEG  197
            +VQ+  D A   +++  +   ++TK  F  +A   P  + K+   T E+LLR  +R  E 
Sbjct  34   IVQDESDPASTFTQSSKYISRASTKRTFRSTADILPSSR-KRRKVTPEELLRRKIRRREV  92

Query  198  AKLIGREAVNEIVVQGEKLDMVESDLGKVEGDL  230
             ++  +  +N+   Q + L  +E D+ K++ D+
Sbjct  93   CRVNQQRYMNK---QRQLLADLEDDICKLQEDI  122

>SDRG_14487
Length=964

 Score = 33.1 bits (74),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 2/32 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
           EG++ K+G    +W+ RY+V  G +  +AYY+
Sbjct  7   EGWIYKQGSLMPTWKKRYMVLKGRH--IAYYD  36

>PPTG_16659
Length=916

 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 2/44 (5%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            G  +  +P  C G++ K G   K+W+ RY   +G  L   Y++S
Sbjct  777  GTAETEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  818

>PYAR_23366
Length=828

 Score = 33.1 bits (74),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (54%), Gaps = 2/41 (5%)

Query  23   KFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            K  P   EGYV +RG +   W   YL  +G  L+  +YES+
Sbjct  69   KMLPILWEGYVRRRGDWLPRWEEMYLTMDGRWLR--FYESK  107

>SDRG_14286
Length=670

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 2/30 (7%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
            G++ K GH RK+W+ R+ V +G+ LQ  YY
Sbjct  277  GWLHKLGHRRKNWKHRFFVLDGSVLQ--YY  304

>PITG_09930
Length=1221

 Score = 33.1 bits (74),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G +TK+G +R++W+ R+ +       + Y+ S D
Sbjct  153  GTLTKQGSWRRNWKTRFFILRSDCPSLCYFTSED  186

>H310_13627
Length=678

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 32/136 (24%), Positives = 57/136 (42%), Gaps = 24/136 (18%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFY----V  86
            G++ K+GH  K+W+ R+ V +G+ L+   Y S D       S    +      F+    V
Sbjct  270  GWLYKQGHILKNWKRRFFVLDGSVLR---YFSEDVDATVPKSTTHKLKGEVLLFHKDTTV  326

Query  87   SSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAA  146
              V+ H      + GR+  F     G     G   L +   SL +   W+  +++A+   
Sbjct  327  HYVDIH------LSGRDFTFAIDTSG-----GGFSLMLQASSLDEREDWIYAIEDAILCR  375

Query  147  KKRSRTGGFQDNSTTK  162
            +       +QD+S T+
Sbjct  376  E------SYQDSSGTE  385

>PHYCA_504798
Length=394

 Score = 32.7 bits (73),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P +  G+V K G   +SW+ R+LV   A L  AYY++ D
Sbjct  6   PVTYAGWVFKEGSLVRSWKKRFLVCKRAEL--AYYKNTD  42

>PHALS_09911
Length=341

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 52/119 (44%), Gaps = 16/119 (13%)

Query  86   VSSVEKHEYWVGVMGGREKPFGFKL--VGHAPKKGYIE-LDIFVESLGDLNKWVEVVQNA  142
             SS EK EY   +  G ++P  ++   V H  K  Y   +D+  ES+G      E+ Q  
Sbjct  172  CSSPEKVEYLHSI--GCDRPINYRSENVFHVLKNEYPRGVDLVFESVGG-----EMFQTC  224

Query  143  LDAAKKRSRT------GGFQDNSTTKTMFGFSASASPQLQVKKLAATKEDLLRDALREI  195
            +D   ++ R        G+QD+S+ K          P   + + A+ +  L  D LREI
Sbjct  225  VDNIARKGRIIVIGAIAGYQDSSSWKQKLTKPEMPLPSKLLARSASVRGFLYNDYLREI  283

>SDRG_00756
Length=2169

 Score = 33.1 bits (74),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
            + EGY+ K+GHF  + + +Y+V  G +  V +Y S DA
Sbjct  464  TVEGYLVKQGHFVPTMKQKYVVLVGNH--VFFYASHDA  499

>PHALS_08097
Length=1069

 Score = 32.7 bits (73),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 9/34 (26%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G++TK+G +R++W+ R+ +       + Y+ S +
Sbjct  144  GFLTKQGSWRRNWKTRFFILRSDCPSLCYFTSEE  177

>H257_01308
Length=897

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           EGY+ K+G   K W+ R+ V +G +L  +YY ++
Sbjct  24  EGYLQKKGQLLKGWKKRWFVCDGRSL--SYYSTK  55

>PITG_00020
Length=927

 Score = 32.7 bits (73),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 2/44 (5%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            G  +  +P  C G++ K G   K+W+ RY   +G  L   Y++S
Sbjct  788  GTAEMEEPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  829

>PYAP_13647
Length=266

 Score = 32.3 bits (72),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 45/84 (54%), Gaps = 4/84 (5%)

Query  161  TKTMFGFSASASPQLQ--VKKLAATK-EDLLRDALREIEGAKLIGREAVNEIVVQGEKLD  217
            T   +G SA A P ++  +KK    K E  L    +++E  K+I  E VN+++ +GEK+D
Sbjct  105  TAIAYGMSAFA-PTMETLMKKYDNLKIETPLSQVRQKMEKVKMIMIENVNQLMERGEKID  163

Query  218  MVESDLGKVEGDLDHADKLLRHMK  241
            ++     K++ D    DK  + +K
Sbjct  164  LLVMRTDKLQQDALKYDKTAKKLK  187

>PHYRA_73431
Length=394

 Score = 32.7 bits (73),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P +  G+V K G   +SW+ R+LV   A L  AYY++ D
Sbjct  6   PVTYAGWVFKEGSLVRSWKKRFLVCKRAEL--AYYKNTD  42

>PPTG_14629
Length=394

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P +  G+V K G   +SW+ R+LV   A L  AYY++ D
Sbjct  6   PVTYAGWVFKEGSLVRSWKKRFLVCKRAEL--AYYKNTD  42

>H257_06698
Length=1199

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (63%), Gaps = 2/35 (6%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            EGY++K+G    +W+  Y V  G  L +A Y+SR+
Sbjct  257  EGYLSKKGDLLAAWKSCYCVLEG--LTLAIYDSRE  289

>SDRG_06288
Length=641

 Score = 32.7 bits (73),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 23/38 (61%), Gaps = 1/38 (3%)

Query  25   KPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            KP  C G + K+G   K+WR RY   +G + Q++Y ++
Sbjct  258  KPRHC-GILLKKGRTVKAWRKRYFSIDGVSNQLSYSDA  294

>HYAP_13689
Length=393

 Score = 32.3 bits (72),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P +  G+V K G   +SW+ R+LV   A  ++AYY++ D
Sbjct  11  PVTFAGWVFKEGSLVRSWKKRFLVCKRA--EMAYYKNTD  47

>SPRG_06273
Length=1047

 Score = 32.7 bits (73),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           G +TK+G F ++WR RY +       + YY S
Sbjct  68  GELTKQGSFWRTWRKRYFILRRDRPMLCYYSS  99

>PHALS_12503
Length=340

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 13/31 (42%), Positives = 20/31 (65%), Gaps = 2/31 (6%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYE  61
            G++ KRGH  K+W+ R+ + NG  L   YY+
Sbjct  101  GWLWKRGHSFKTWKKRFFLLNGVAL--TYYK  129

>PYAR_14615
Length=517

 Score = 32.3 bits (72),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           EG++ K+G   KSW+ R+ V +G  L  +YY SR
Sbjct  38  EGFLQKKGQRFKSWKRRWFVCDGRTL--SYYISR  69

>CCA14309
Length=235

 Score = 32.0 bits (71),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  199  KLIGREAVNEIVVQGEKLDMVESDLGKVEGDLD  231
            K IGR ++NE+ VQ E +      L   EGDLD
Sbjct  191  KFIGRPSINELCVQLELIHANMDHLCTFEGDLD  223

>SDRG_08236
Length=864

 Score = 32.7 bits (73),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  24  FKPTSC-EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           + PT   EGY+ K+G   K W+ R+ V +G +L   Y  S+D
Sbjct  16  YDPTYMKEGYLQKKGQLLKGWKKRWFVCDGRSLSY-YISSKD  56

>SPRG_01860
Length=674

 Score = 32.3 bits (72),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (5%)

Query  24  FKPTSC-EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           + PT   EGY+ K+G   K W+ R+ V +G +L   Y  S+D
Sbjct  16  YDPTYMKEGYLQKKGQLLKGWKKRWFVCDGRSLSY-YISSKD  56

>CCA19097
Length=688

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 22/32 (69%), Gaps = 2/32 (6%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           G+V K+G   K+W+ RY+V NG  L+  YY+S
Sbjct  9   GWVHKQGAVIKTWKRRYMVLNGNVLK--YYDS  38

>PYIR_13168
Length=1353

 Score = 32.7 bits (73),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (70%), Gaps = 1/33 (3%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
            G++TK+GH  K+W+ R+ V   A+   AYY+++
Sbjct  116  GWLTKQGHMWKTWKTRFFVLY-ADGTFAYYKNK  147

>PHYSO_478442
Length=686

 Score = 32.3 bits (72),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 26/46 (57%), Gaps = 10/46 (22%)

Query  27   TSCEGYVTKRG--------HFRKSWRVRYLVFNGANLQVAYYESRD  64
            T  +GY+ K+G          RK+W+ RY + NGANL   Y +++D
Sbjct  556  TVLQGYLIKQGGGGNVLNPLGRKNWKQRYFILNGANL--IYAKTKD  599

>H310_02933
Length=1053

 Score = 32.3 bits (72),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 22/35 (63%), Gaps = 0/35 (0%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            +GY++K+G +RK+W+ RY +       + Y +S +
Sbjct  179  QGYLSKQGSWRKNWKRRYFILRIDEPSLVYCDSEE  213

>PHYCA_504624
Length=449

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 19/29 (66%), Gaps = 0/29 (0%)

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKR  149
            EL  F  S+ D+ +W++ VQNALD  + R
Sbjct  262  ELQAFSASVDDIARWIKAVQNALDVREDR  290

>H310_06667
Length=896

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 25/41 (61%), Gaps = 3/41 (7%)

Query  24  FKPTSC-EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESR  63
           F PT   EGY+ K+G   K W+ R+ V +G +L  +Y+ ++
Sbjct  30  FDPTFMKEGYLQKQGQLLKGWKKRWFVCDGRSL--SYFHTK  68

>PHYRA_78815
Length=919

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 22/44 (50%), Gaps = 2/44 (5%)

Query  19   GAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            G  +   P  C G++ K G   K+W+ RY   +G  L   Y++S
Sbjct  784  GTAETEDPVVCSGWLRKEGGTVKNWKRRYFTLHGPTL--CYFKS  825

>SDRG_01838
Length=1043

 Score = 32.3 bits (72),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 0/32 (0%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
           G +TK+G F ++WR RY +       + YY S
Sbjct  68  GNLTKQGSFWRTWRKRYFILRRDRPMLCYYSS  99

>SDRG_01408
Length=916

 Score = 32.3 bits (72),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 35/141 (25%), Positives = 56/141 (40%), Gaps = 21/141 (15%)

Query  30   EGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgsFYVSSV  89
            EG+V K+G +   W  RYLV +G  L   Y +  DA  G +  G   +            
Sbjct  125  EGHVRKKGDWLPRWEPRYLVLDGTTLTY-YSKQHDARSGKNLRGRMVLT-----------  172

Query  90   EKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNALDAAKKR  149
                 +VG     +K  GF +      KG+    +   +  + + WVE++Q ALD A   
Sbjct  173  -----YVGPDFKGKKAHGFMI----ETKGHKRFHLCCATELEKDMWVEMMQTALDEANGA  223

Query  150  SRTGGFQDNSTTKTMFGFSAS  170
            +      D+  +   +  S S
Sbjct  224  ANKPAQDDDFMSSPSYDLSRS  244

>PYIW_17571
Length=1330

 Score = 32.3 bits (72),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G +TK G +R++W+ R+ +       + YY S D
Sbjct  175  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSED  208

>H310_14473
Length=613

 Score = 32.3 bits (72),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (57%), Gaps = 2/30 (7%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
           G + KRGH RK+W  R+ V     L+  YY
Sbjct  27  GILLKRGHLRKNWLTRFFVLTSGALR--YY  54

>H310_09363
Length=1954

 Score = 32.3 bits (72),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query  3    ILRVPDAKLATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            + R+P   L    +N  + +  K TSC GY+ KRG    + + RY++     L   YY++
Sbjct  821  VARIPMDVLVLDTTNTSSQNN-KRTSCAGYLMKRGEVNVTMQRRYMILQDNEL--VYYKT  877

>H257_02642
Length=975

 Score = 32.3 bits (72),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P   EGY+ KRG +   W    +V +G  L+V+YY+  D
Sbjct  27  PIQWEGYLRKRGDWLPRWDYYLVVLDG--LRVSYYDRLD  63

>PYAP_19776
Length=1185

 Score = 32.3 bits (72),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query  186  DLLR--DALREIEGAKLIGREAVNEIVVQGEKLDMVESDLGKVEGDLDHADKLLRHMKRP  243
            DLL+  D +  +E  K++G     +I+ Q   LD+   +L KVE D  H D   R +  P
Sbjct  651  DLLQHADKILVVEHGKIVGDGTYRDIIAQFPALDITTQELDKVEKDNIHDDLFRRVLGAP  710

Query  244  MLHLF  248
            +   F
Sbjct  711  VNRYF  715

>SDRG_05608
Length=121

 Score = 30.8 bits (68),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANL  55
           EG +TKR  + K WR RY V  G  L
Sbjct  13  EGELTKRSVWLKEWRARYFVLKGNKL  38

>SPRG_16312
Length=261

 Score = 32.0 bits (71),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRDA  65
           P    GYV K+G F K+W+ R++V +   L   YY S  A
Sbjct  38  PPDFSGYVRKQGSFVKNWKRRFMVLHDDTL--FYYVSERA  75

>PYVX_22589
Length=1375

 Score = 32.3 bits (72),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 15/37 (41%), Positives = 21/37 (57%), Gaps = 2/37 (5%)

Query  28   SCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            S EGY+ K+     +W+V Y V     L  AY+ESR+
Sbjct  279  SFEGYLNKKSDLLPNWKVTYCVLEEDTL--AYFESRE  313

>SPRG_01654
Length=923

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 2/39 (5%)

Query  26  PTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
           P   EGY+ KRG +   W   Y+V +G +L   Y++  D
Sbjct  22  PLRWEGYLRKRGDWLPRWDTYYVVLSGVDL--TYFDKSD  58

>PYIW_17818
Length=1188

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (65%), Gaps = 2/34 (6%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G++ K+G   KSW+ RY V  G +LQ  Y+++ D
Sbjct  505  GWLLKQGSLIKSWKRRYFVLEGDSLQ--YFDNID  536

 Score = 32.3 bits (72),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (54%), Gaps = 2/39 (5%)

Query  24   FKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
              P  C G++ K G   K+W+ RY   +G  L+  Y++S
Sbjct  825  LTPGGCSGWLNKEGGTIKTWKRRYFSLHGTTLR--YFKS  861

>PITG_02106
Length=1015

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 17/52 (33%), Positives = 27/52 (52%), Gaps = 2/52 (4%)

Query  11   LATSGSNGGAGDKFKPTSCEGYVTKRGHFRKSWRVRYLVFNGANLQVAYYES  62
            +++S S  G  +      C G++ K G   KSW+ RY    G+ L  +YY+S
Sbjct  658  ISSSSSEQGDQEAAAAQGCVGWLRKEGGKVKSWKRRYFALYGSRL--SYYKS  707

>PHYRA_78920
Length=453

 Score = 32.0 bits (71),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  121  ELDIFVESLGDLNKWVEVVQNALDAAKKR  149
            EL+ F  S+ D+ +W++ VQNALD  + R
Sbjct  264  ELEGFSASIDDIARWIKAVQNALDVREDR  292

>H257_00729
Length=121

 Score = 30.8 bits (68),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANLQVA  58
           EG +TKR  + K WR RY V  G  L   
Sbjct  13  EGELTKRSVWLKEWRTRYFVLKGNKLYFC  41

>PYIR_16539
Length=1346

 Score = 32.3 bits (72),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQVAYYESRD  64
            G +TK G +R++W+ R+ +       + YY S D
Sbjct  171  GTLTKEGSWRRNWKTRFFILRRDFPSLCYYTSED  204

>H257_09028
Length=556

 Score = 32.0 bits (71),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 49/123 (40%), Gaps = 25/123 (20%)

Query  26   PTSCEGYVTKRGHFRKS--WRVRYLVFNGANLQVAYYESRDAskgssssggtgvpvpkgs  83
            PT C GYV  + H + S  W+ RY V    +L + +Y++ +A+      G          
Sbjct  19   PTLCTGYVYNQ-HEKNSIIWKKRYCVLQENSLYIFHYDNAEAATQGELKGKIP-------  70

Query  84   FYVSSVEKHEYWVGVMGGREKPFGFKLVGHAPKKGYIELDIFVESLGDLNKWVEVVQNAL  143
               SSV     W G      KP GF+      K   +  D   E L    KWV  +Q  L
Sbjct  71   --YSSVHD---WEG------KPHGFQFYTPTNKCYKVYTDTEEEKL----KWVSTMQKQL  115

Query  144  DAA  146
            D A
Sbjct  116  DDA  118

>PPTG_10755
Length=723

 Score = 32.3 bits (72),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (57%), Gaps = 3/46 (7%)

Query  17   NGGAGDKFKPTSCEGYVTKRG-HFRKSWRVRYLVFNGANLQVAYYE  61
            +GG     K     G + KRG  +RK W++RY+  +G   Q+AYYE
Sbjct  89   HGGQELWVKAPVVSGSLEKRGFRWRKKWKLRYVELDGR--QLAYYE  132

>SPRG_02502
Length=121

 Score = 30.8 bits (68),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANL  55
           EG +TKR  + K WR RY V  G  L
Sbjct  13  EGELTKRSVWLKEWRARYFVLKGNKL  38

>PHYCA_98948
Length=124

 Score = 30.8 bits (68),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  30  EGYVTKRGHFRKSWRVRYLVFNGANL  55
           +GY+ +RG   KSWR RY +F    L
Sbjct  5   DGYLLRRGRHLKSWRRRYFIFEDGIL  30

>PITG_00416
Length=698

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (57%), Gaps = 3/46 (7%)

Query  17   NGGAGDKFKPTSCEGYVTKRG-HFRKSWRVRYLVFNGANLQVAYYE  61
            +GG     K     G + KRG  +RK W++RY+  +G   Q+AYYE
Sbjct  65   HGGQELWVKAPVVSGALEKRGFRWRKKWKLRYVELDGR--QLAYYE  108

>PHYSO_563553
Length=797

 Score = 32.0 bits (71),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  31   GYVTKRGHFRKSWRVRYLVFNGANLQV  57
            G +TKRG F K+W  R+LV +   LQV
Sbjct  110  GALTKRGQFFKTWIPRHLVLSRGALQV  136

>H257_13346
Length=587

 Score = 32.0 bits (71),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 2/30 (7%)

Query  31  GYVTKRGHFRKSWRVRYLVFNGANLQVAYY  60
           G + KRGH RK+W +R+ V     L+  YY
Sbjct  25  GILLKRGHVRKNWLMRFFVLTSGALR--YY  52

Lambda      K        H        a         alpha
   0.315    0.132    0.376    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 23760432168

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40