Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYIR_134181475874774733560.0
PYIW_199691475873375927500.0
PYU1_G0017331475873274426140.0
PYAP_177631475879453117060.0
PHYCA_5114151475874471015840.0
PHYSO_3489031475876653315520.0
PPTG_171291475874553815420.0
PHYKE_839514758142070715420.0
PHYRA_810981475874170415210.0
PITG_184581475874770915210.0
PYAR_135711475866651214960.0
HYAP_071041475872167014300.0
PHALS_064761475872670813652e-178
PYVX_235901475868968913259e-173
CCA228431475858653910331e-130
CCI441111475857653610085e-127
SPRG_06355147587135747273e-84
SDRG_01763147587365827074e-81
H257_117731382110264212132e-16
PPTG_113651382111064702114e-16
PHYSO_4705331382110844162115e-16
H310_082921382110074252053e-15
SDRG_045751382110034282043e-15
SPRG_126211382110034091991e-14
H257_0193413355510223851936e-14
PITG_172501382110464131928e-14
PYU1_G002110138219994461703e-11
PYIR_141071382111764211687e-11
PYAP_222301382111164441679e-11
SDRG_079831335559913811642e-10
SPRG_1903013355510003781543e-09
PYIW_157171382111214441462e-08
PYVX_215131382114462371429e-08
PYAR_14788138217953801274e-06
PYU1_G0018568811987134870.24
PYVX_14828970565107830.66
PHALS_07874970541105801.3
PYIR_18103970542107801.3
H257_02565139367100571801.5
PYIW_21597132841048172792.3
PYAR_23233970542107782.6
PPTG_10263970541105773.0
PYU1_G001876970539105773.4
H257_0754713398294469773.9
PHYKE_2649398355982764.4
PHYSO_321022970540105764.7
PHYCA_53267610954166277764.8
PHYCA_572705970543105755.0
PITG_01099970541105755.5
PYVX_247627443725764745.9
SPRG_1772213249412422706.2
SDRG_09955139544064162756.5
PYAP_20633970539105747.3
PHYCA_5040531199562956747.4
PHYKE_4131970543105748.0
PYVX_20285935756217668.1
PITG_148181199562956748.5
PPTG_157931199563856738.8
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYIR_13418

Length=747
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYIR_13418                                                            1297       0.0   
PYIW_19969                                                            1063       0.0   
PYU1_G001733                                                          1011       0.0   
PYAP_17763                                                            661        0.0   
PHYCA_511415                                                          614        0.0   
PHYSO_348903                                                          602        0.0   
PPTG_17129                                                            598        0.0   
PHYKE_8395                                                            598        0.0   
PHYRA_81098                                                           590        0.0   
PITG_18458                                                            590        0.0   
PYAR_13571                                                            580        0.0   
HYAP_07104                                                            555        0.0   
PHALS_06476                                                           530        2e-178
PYVX_23590                                                            514        9e-173
CCA22843                                                              402        1e-130
CCI44111                                                              392        5e-127
SPRG_06355                                                            284        3e-84 
SDRG_01763                                                            276        4e-81 
H257_11773                                                            86.7       2e-16 
PPTG_11365                                                            85.9       4e-16 
PHYSO_470533                                                          85.9       5e-16 
H310_08292                                                            83.6       3e-15 
SDRG_04575                                                            83.2       3e-15 
SPRG_12621                                                            81.3       1e-14 
H257_01934                                                            79.0       6e-14 
PITG_17250                                                            78.6       8e-14 
PYU1_G002110                                                          70.1       3e-11 
PYIR_14107                                                            69.3       7e-11 
PYAP_22230                                                            68.9       9e-11 
SDRG_07983                                                            67.8       2e-10 
SPRG_19030                                                            63.9       3e-09 
PYIW_15717                                                            60.8       2e-08 
PYVX_21513                                                            59.3       9e-08 
PYAR_14788                                                            53.5       4e-06 
PYU1_G001856                                                          38.1       0.24  
PYVX_14828                                                            36.6       0.66  
PHALS_07874                                                           35.4       1.3   
PYIR_18103                                                            35.4       1.3   
H257_02565                                                            35.4       1.5   
PYIW_21597                                                            35.0       2.3   
PYAR_23233                                                            34.7       2.6   
PPTG_10263                                                            34.3       3.0   
PYU1_G001876                                                          34.3       3.4   
H257_07547                                                            34.3       3.9   
PHYKE_2649                                                            33.9       4.4   
PHYSO_321022                                                          33.9       4.7   
PHYCA_532676                                                          33.9       4.8   
PHYCA_572705                                                          33.5       5.0   
PITG_01099                                                            33.5       5.5   
PYVX_24762                                                            33.1       5.9   
SPRG_17722                                                            31.6       6.2   
SDRG_09955                                                            33.5       6.5   
PYAP_20633                                                            33.1       7.3   
PHYCA_504053                                                          33.1       7.4   
PHYKE_4131                                                            33.1       8.0   
PYVX_20285                                                            30.0       8.1   
PITG_14818                                                            33.1       8.5   
PPTG_15793                                                            32.7       8.8   

>PYIR_13418
Length=747

 Score = 1297 bits (3356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 747/747 (100%), Positives = 747/747 (100%), Gaps = 0/747 (0%)

Query  1    MHklksklssskskQKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRnttmntsaa  60
            MHKLKSKLSSSKSKQKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRNTTMNTSAA
Sbjct  1    MHKLKSKLSSSKSKQKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRNTTMNTSAA  60

Query  61   sstssymsDDVEEMFYngsangnanpsasarsTDNFGRsttssmrstdtysNGNASRATG  120
            SSTSSYMSDDVEEMFYNGSANGNANPSASARSTDNFGRSTTSSMRSTDTYSNGNASRATG
Sbjct  61   SSTSSYMSDDVEEMFYNGSANGNANPSASARSTDNFGRSTTSSMRSTDTYSNGNASRATG  120

Query  121  GSLRVTDMYRTTEQMRGTNLMPLQEDEVLPaasratttmatasNGGNPIDALRAELSEMK  180
            GSLRVTDMYRTTEQMRGTNLMPLQEDEVLPAASRATTTMATASNGGNPIDALRAELSEMK
Sbjct  121  GSLRVTDMYRTTEQMRGTNLMPLQEDEVLPAASRATTTMATASNGGNPIDALRAELSEMK  180

Query  181  LEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQP  240
            LEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQP
Sbjct  181  LEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQP  240

Query  241  ELSSDELDTISRTTALYTSKATKERRATREDSAPVLVRASSRLTQLAPVADDALSTPLLQ  300
            ELSSDELDTISRTTALYTSKATKERRATREDSAPVLVRASSRLTQLAPVADDALSTPLLQ
Sbjct  241  ELSSDELDTISRTTALYTSKATKERRATREDSAPVLVRASSRLTQLAPVADDALSTPLLQ  300

Query  301  HQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSG  360
            HQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSG
Sbjct  301  HQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSG  360

Query  361  KSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLK  420
            KSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLK
Sbjct  361  KSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLK  420

Query  421  YVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELP  480
            YVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELP
Sbjct  421  YVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELP  480

Query  481  TWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREI  540
            TWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREI
Sbjct  481  TWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREI  540

Query  541  LKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRS  600
            LKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRS
Sbjct  541  LKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRS  600

Query  601  RIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRI  660
            RIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRI
Sbjct  601  RIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRI  660

Query  661  ETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQdssdthsaasseassnnvsnvsta  720
            ETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSAASSEASSNNVSNVSTA
Sbjct  661  ETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQDSSDTHSAASSEASSNNVSNVSTA  720

Query  721  sshLSYVVPPPAAPKVNFKPVGILKKK  747
            SSHLSYVVPPPAAPKVNFKPVGILKKK
Sbjct  721  SSHLSYVVPPPAAPKVNFKPVGILKKK  747

>PYIW_19969
Length=733

 Score = 1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/759 (81%), Positives = 667/759 (88%), Gaps = 38/759 (5%)

Query  1    MHklksklssskskQKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRnttmntsaa  60
            MHKLKSKLSSSKSKQ+RLERAQSD+V   A DE++LRMSKHVQEEAHRFQRNTTMNTS+A
Sbjct  1    MHKLKSKLSSSKSKQRRLERAQSDSVRATAADEDSLRMSKHVQEEAHRFQRNTTMNTSSA  60

Query  61   sstssymsDDVEEMFYngsangnanpsasarsTDNFGRsttssmrstdtysNGNASRATG  120
            SSTSSYMSDDVE+MFYNG    + + S  +  TD +GRST +S RS         SRATG
Sbjct  61   SSTSSYMSDDVEDMFYNGGDARSTSSSVRS--TDTYGRSTAASTRS-----TDTYSRATG  113

Query  121  GSLRVTDMYRTTEQMRGT-NLMPLQEDEVLPaasratttmatasNG---------GNPID  170
            GSLRVTD+YRTTEQ+RGT NL+PLQEDEVLPAASR TTT    +NG         G+ +D
Sbjct  114  GSLRVTDVYRTTEQLRGTANLIPLQEDEVLPAASRTTTTSQMPTNGNYSNGNSGGGSQLD  173

Query  171  ALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDAS  230
            ALR ELSEMKLEVQAIRREMMNEMHVTRYDVLKE+TMLKGTI+QLVTALE+KG       
Sbjct  174  ALRTELSEMKLEVQAIRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKG-------  226

Query  231  GAAVGAEAQPELSSDELDTISRTTALYTSKATKERRATR-EDSAPVLVRASSRLTQLAPV  289
                       LS+DE++TISRTTAL+TSKATK+RRATR E S+P+LVRASSRLTQLAPV
Sbjct  227  -----------LSTDEINTISRTTALFTSKATKDRRATRDESSSPMLVRASSRLTQLAPV  275

Query  290  ADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDN  349
            AD+ALSTPLLQHQIDEMFPL+ECS EL A ++ YD SSREWA+ERFQEW+DSRFNVGVDN
Sbjct  276  ADEALSTPLLQHQIDEMFPLIECSDELVALSRTYDSSSREWAVERFQEWIDSRFNVGVDN  335

Query  350  LLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPL  409
            LLALVG+GGSGKSTL GAL DKFHDN+VA+HLC FDRKSKSSPRNVLLSLVNQ+ISNLPL
Sbjct  336  LLALVGEGGSGKSTLAGALSDKFHDNIVAIHLCTFDRKSKSSPRNVLLSLVNQMISNLPL  395

Query  410  FKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLL  469
            FKNQLARLNLKYVLEE+DP+VLARK+LVDPLCALEEP+TAKVF+ DG+DQCKS+GRNDLL
Sbjct  396  FKNQLARLNLKYVLEESDPVVLARKLLVDPLCALEEPMTAKVFMIDGLDQCKSRGRNDLL  455

Query  470  DFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNF  529
            DFLAVIIPELPTW+GVFITSKPSPELPA+LAI+SLLDFSAKNTNYMNDT+I+INDIIG+F
Sbjct  456  DFLAVIIPELPTWIGVFITSKPSPELPARLAISSLLDFSAKNTNYMNDTVIMINDIIGSF  515

Query  530  SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyee  589
            SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEE
Sbjct  516  SDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEE  575

Query  590  iFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVD  649
            IFEDKFGKGR+RIWKKVQPLLELIVTAASGPYALITE QAQEQF+LSKEDIRTIRR+FVD
Sbjct  576  IFEDKFGKGRNRIWKKVQPLLELIVTAASGPYALITETQAQEQFALSKEDIRTIRRSFVD  635

Query  650  IIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQLHHQ-dssdthsaasse  708
            II V HGTYRIE SALFEWLVDPQRAGEQFYVDVSGGM+ LRQLHHQ  S      +S  
Sbjct  636  IIDVRHGTYRIENSALFEWLVDPQRAGEQFYVDVSGGMSALRQLHHQDSSETHSVGSSDG  695

Query  709  assnnvsnvstasshLSYVVPPPAAPKVNFKPVGILKKK  747
            +SSN  SNVSTASSHLSYVV PP  PKVNFKPVGILKKK
Sbjct  696  SSSNATSNVSTASSHLSYVV-PPPVPKVNFKPVGILKKK  733

>PYU1_G001733
Length=732

 Score = 1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/744 (76%), Positives = 624/744 (84%), Gaps = 38/744 (5%)

Query  15   QKRLERAQSDAVTVRAT-DEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEE  73
            +KR+ERAQSD V  RAT DE+ LRMSKHV E+AHR+ RNTTMNTSAASSTSSYMSDDVE+
Sbjct  16   RKRVERAQSDGV--RATADEDALRMSKHVAEDAHRYARNTTMNTSAASSTSSYMSDDVED  73

Query  74   MFYngsangnanpsasarsTDNFGRsttssmrstdtysNGNASRATGG-----SLRVTDM  128
            MFY                  N G   T S     T    ++ R   G     SLRVTD+
Sbjct  74   MFY------------------NGGGGITRSTSDYTTGRTTSSMRDANGMNRSTSLRVTDV  115

Query  129  YRTTEQMRGTNLMPLQEDEVLPaasratttmatasNGGNPIDALRAELSEMKLEVQAIRR  188
            YRTTEQ+R TNLMPL EDEVLPAA R TT  A    GG+  DALRAEL EMK E+Q IRR
Sbjct  116  YRTTEQLRNTNLMPLNEDEVLPAAMRTTTGAA----GGSEADALRAELVEMKQEMQTIRR  171

Query  189  EMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELD  248
            EMMNEMHVTRYDVLKEITMLKGTIIQLV ALESKGVR+LDA G    AE QPELS  +LD
Sbjct  172  EMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGV---AEPQPELSPAQLD  228

Query  249  TISRTTALYTSKATKERRATREDSA-PVLVRAS-SRLTQLAPVADDALSTPLLQHQIDEM  306
            TI+RTTA++TSKATK+R A RE +A P ++R + SRLTQLAPVADDALSTPLLQHQID+M
Sbjct  229  TITRTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDM  288

Query  307  FPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTG  366
            FPLV+ S +LQ  AQ +DP+SREWA ERFQ+WVDSRFNVG DNLLALVGDGGSGKSTL G
Sbjct  289  FPLVDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVG  348

Query  367  ALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEET  426
            ALCD+FHDN+VA+HLC FDRKSKSSPRNVLLSLVNQLI+NLPLFKNQLARLNLKYVLEET
Sbjct  349  ALCDRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEET  408

Query  427  DPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGVF  486
            DPLVLARKVLVDPLCALEEPLTAKV + DGIDQCKSK RNDLLDFLA IIPE PTW+G+F
Sbjct  409  DPLVLARKVLVDPLCALEEPLTAKVLLVDGIDQCKSKDRNDLLDFLAAIIPEFPTWLGIF  468

Query  487  ITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSG  546
            ITSKPSPELPAKLAITSLLDFS KN NYMNDTIILINDIIGNFSDKDV +AR+ILKRKSG
Sbjct  469  ITSKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSG  528

Query  547  GNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKV  606
            GNFTFLDFTKQALSHPGMEE+NGY+PLDVLHDLPESIYEIY+EIFEDKFGKG +R+WKKV
Sbjct  529  GNFTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKV  588

Query  607  QPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALF  666
            QPLL+LIVTAASGPYALITE QAQEQFSLS++DIR IRRAF DII V HGTYR+ETSA++
Sbjct  589  QPLLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMY  648

Query  667  EWLVDPQRAGEQFYVDVSGGMNLLRQLHHQdss-dthsaasseassnnvsnvstasshLS  725
            EWLVDPQR+GEQFYV++S  M++LR+LH + S+     A+S  +S +  SNVSTASS+LS
Sbjct  649  EWLVDPQRSGEQFYVNISASMDILRRLHRKSSTDTHSVASSESSSHHTPSNVSTASSYLS  708

Query  726  YVVPPPAAP--KVNFKPVGILKKK  747
              VPPPAAP  KVNFKPVGILKKK
Sbjct  709  LNVPPPAAPAQKVNFKPVGILKKK  732

>PYAP_17763
Length=794

 Score = 661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/531 (61%), Positives = 415/531 (78%), Gaps = 7/531 (1%)

Query  170  DALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLD-  228
            D LRAEL EMK E+QAI+REMMNEMH+TRYDVLKE+TMLKGTI+QLV+ ++  G    D 
Sbjct  181  DLLRAELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDT  240

Query  229  ASGAAVGAEAQP---ELSSDELDTISRTTALYTSKATKER-RATREDSAPVLVRA-SSRL  283
            A+ AA+G +  P   ELS +E + +SR T    SK TKER   TRED  P ++R+ SSRL
Sbjct  241  ATAAAMGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRL  300

Query  284  TQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRF  343
            TQLAPV D ALSTPL Q QID+MFPL++ S E+Q  ++  +  SREW  +R QEW+DSRF
Sbjct  301  TQLAPVDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRF  360

Query  344  NVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQL  403
            NVG D +LA+VGD GSGK+    ++CDK+ D VVA H C FDRK+KSSPRNVLLSLVNQL
Sbjct  361  NVGADVVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQL  420

Query  404  ISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSK  463
             S+LP+FK+QLARLNLKYVLEETD   L+RKVL+DPL ALEEPLT K  VFD IDQC++ 
Sbjct  421  TSSLPMFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTG  480

Query  464  -GRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILI  522
             G NDL DFL+ IIPE P W+G  ++SKPSPE    + ++S+LDFSA+N NYMNDT+ LI
Sbjct  481  VGYNDLQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLI  540

Query  523  NDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPES  582
            NDI   F D D  +A++ILK KSGGN+++L+FTKQALS+PGMEE +G++P+DVLHDLP+S
Sbjct  541  NDIAAVFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQS  600

Query  583  iyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRT  642
            +YEIYEEIFEDKFGKGR+R+W+K  P+L+LI TAASGPYA ITE    +  S +K+++R 
Sbjct  601  LYEIYEEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRM  660

Query  643  IRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            +RRAF+DII++ HGTY I +SA+++WL D QR GEQ+++DV+  + +LR++
Sbjct  661  LRRAFIDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKV  711

>PHYCA_511415
Length=744

 Score = 614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/710 (48%), Positives = 460/710 (65%), Gaps = 96/710 (14%)

Query  30   ATDEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsas  89
            A DE++LR+ K  Q++A RF R+TT+  +   +      DDVEEMFY             
Sbjct  21   ALDEDSLRL-KQQQDDAVRFDRSTTLADTVNVT------DDVEEMFY-------------  60

Query  90   arsTDNFGRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQMRGTNLM--PLQEDE  147
                   GR               N +R+T  S      YRTTEQ+RG NL    L E+ 
Sbjct  61   -------GR---------------NTNRSTTAS--EMPQYRTTEQIRGNNLTLSALHEEA  96

Query  148  VLP-------------aasratttmatasNGGN-----------------------PIDA  171
            V P             A + +    +T  N GN                        ++ 
Sbjct  97   VTPSASNVSSSFSQFSATTPSNYAASTPGNVGNNTYHGFSSALNTAGTSRVISEDFELER  156

Query  172  LRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASG  231
            LR+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+T+LKG I QL  A      +    S 
Sbjct  157  LRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAA------QHSSPSV  210

Query  232  AAVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLA  287
            ++  + +   LS++E   ++R T+  TS AT++R    R     + P   RAS RLTQLA
Sbjct  211  SSTESSSSDPLSAEERAALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARASVRLTQLA  270

Query  288  PVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGV  347
            PVAD+ALSTPL   QI+EMFPL++ +++L A A+   P SR WA+ R +EW+D+RFNVG 
Sbjct  271  PVADNALSTPLSSQQINEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGT  330

Query  348  DNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNL  407
            D LLA+VG+GG+GKS   G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ NL
Sbjct  331  DTLLAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNL  390

Query  408  PLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGR  465
            PLFKNQLARLNLKYVLEE DP++LA KVLVDPL A+EEP+ A   + DGIDQC +   GR
Sbjct  391  PLFKNQLARLNLKYVLEEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGR  450

Query  466  NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDI  525
            N+LL F A +IP+LP+W+G  ++SKPS +L  +L ++S+LDFSAKN  ++ D   L++DI
Sbjct  451  NELLQFFAQVIPQLPSWIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDI  510

Query  526  IGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDN--GYIPLDVLHDLPESi  583
              NFSD D  +A+++LK KSGGNF +L+FTKQALSHPGM   +  G +PL VLH+LPE++
Sbjct  511  ARNFSDDDAAEAKKVLKHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETL  570

Query  584  yeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTI  643
            Y+IY EIFEDKFG+GR+R+W K +PLL+L+V AASGPY+ +TE QA+E F L+ ED+R +
Sbjct  571  YDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRML  630

Query  644  RRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            RR+FVD++AV HG+YRIE+SAL  WL DP R+ EQFY  +   ++ LR++
Sbjct  631  RRSFVDLVAVKHGSYRIESSALCAWLSDPARSEEQFYFSIDDALHALRKM  680

>PHYSO_348903
Length=766

 Score = 602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/533 (56%), Positives = 393/533 (74%), Gaps = 13/533 (2%)

Query  169  IDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLD  228
            ++ LRAE+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG + QL  A  S       
Sbjct  174  LERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSS  233

Query  229  ASGAAVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLT  284
               +++       LS+D+   + R T+  TS AT+ER    RA  + + P   RAS RLT
Sbjct  234  TDSSSLDP-----LSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARASVRLT  288

Query  285  QLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFN  344
            QLAPVADDALSTPL   QI+EMFPL++ ++EL A A+   P SR WA+ R +EW+DSRFN
Sbjct  289  QLAPVADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFN  348

Query  345  VGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLI  404
             G D LLA+VG+GG+GKS   G +  +F  N++A H C FDRKSKS+PRNVLLS+V+Q++
Sbjct  349  TGSDILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIV  408

Query  405  SNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--S  462
             N P FKNQLARLNLKYVLEE DP++LA KVLVDPL ALEEP+ A   + DGIDQC   +
Sbjct  409  DNYPPFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGA  468

Query  463  KGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILI  522
            +GRN+LL+F A IIP+LPTWVG  ++SKPS +L  +L ++S+LDFSA+N  ++ D   L+
Sbjct  469  QGRNELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLV  528

Query  523  NDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLP  580
             DI  NFSD D  +A+ +LK+KSGGNF +L+FTKQALSHPGM      G +PL VL+DLP
Sbjct  529  EDIARNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLP  588

Query  581  ESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDI  640
            E++Y+IY EIFEDKFG+GR+R+W K +PLL+L+V AASGPY+ +TE QA+E F+L+ ED+
Sbjct  589  ETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDL  648

Query  641  RTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            R +RR+FVD++AV HG+YRIE+SAL  WL DP R+ EQFY  +   +  LRQ+
Sbjct  649  RMLRRSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQM  701

>PPTG_17129
Length=745

 Score = 598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/538 (55%), Positives = 399/538 (74%), Gaps = 13/538 (2%)

Query  164  NGGNPIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKG  223
            +G   ++ LR+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL TA +   
Sbjct  151  SGDFELERLRSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQL-TATQ---  206

Query  224  VRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRA  279
              S   S ++  + +   LS++E   ++R T+  TS+AT++R    R     + P   RA
Sbjct  207  -HSAPPSVSSTESSSSDPLSAEERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA  265

Query  280  SSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWV  339
            S RLTQLAPVAD+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+
Sbjct  266  SVRLTQLAPVADNALSTPLSPQQINEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWL  325

Query  340  DSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSL  399
            D+RFNVG D LLA+VG+GG+GKS   G +  +F  N++A H C FDRKSKSSPRNVLLS+
Sbjct  326  DARFNVGNDTLLAVVGEGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSM  385

Query  400  VNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQ  459
            V+QL+ NLP FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ A   + DGIDQ
Sbjct  386  VHQLVDNLPSFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQ  445

Query  460  CKS--KGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMND  517
            C +   GRN+LL+F A +IP+LP+WVG  I+SKPS +L  +L ++S+LDFSAKN  ++ D
Sbjct  446  CAAGLNGRNELLEFFAQVIPQLPSWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVAD  505

Query  518  TIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDV  575
               +++DI  NFSD D  +A+++LK+KSGGNF +L+FTKQALSHPGM      G +PL+V
Sbjct  506  VSSIVDDIARNFSDDDTAEAKKVLKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEV  565

Query  576  LHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSL  635
            LH+LPE++Y+IY EIFEDKFG+GR+R+W K +PLL+LIV AA+GPY+ +TE QA+E F  
Sbjct  566  LHELPETLYDIYAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKF  625

Query  636  SKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            + ED+R +RR+FVD++AV HG YRIE+SAL  WL DP R+ EQFY  +   +  LR++
Sbjct  626  TAEDLRMLRRSFVDLVAVKHGAYRIESSALCAWLSDPARSEEQFYFSIDDALQALRKM  683

>PHYKE_8395
Length=1420

 Score = 598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/707 (48%), Positives = 450/707 (64%), Gaps = 92/707 (13%)

Query  30    ATDEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsas  89
             A DE++LR++K  Q++A RF RNT M  +   S      DDVE+MFY             
Sbjct  691   ALDEDSLRLNKQ-QQDADRFDRNTAMTDTVNVS------DDVEDMFY-------------  730

Query  90    arsTDNFGRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQEDE  147
                    GRSTT S          N S            YRTTEQMRGTN  L  L E+E
Sbjct  731   -------GRSTTQSQL-------SNTSDVPS--------YRTTEQMRGTNSTLTALHEEE  768

Query  148   VLPaasratttmatasNGGNP---------------------------------IDALRA  174
              +  ++   +    +S    P                                 +  LRA
Sbjct  769   AMTPSASHLSNSFASSYASTPGNYQNPPTFNGFNTTHSTGLSRTISEDTYNNNEVSRLRA  828

Query  175   ELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAV  234
             EL E+K EVQ IRRE+MNE+H+TRYDVLKE+T+LKG + QL +A ++ G  S   S ++ 
Sbjct  829   ELQEVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQL-SAAQTTGSVSPSTSSSSD  887

Query  235   GAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPVA  290
                A      ++   ++R  +  TSK TK+R    R       P   RAS RLTQLAPVA
Sbjct  888   PLSA------EDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVA  941

Query  291   DDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNL  350
             D+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+D+RFNVG D +
Sbjct  942   DNALSTPLNPQQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTV  1001

Query  351   LALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLF  410
             LA+VGDGG+GKS   G +  +F  N++A H C FDRKSKS+PRNVLLS V+QL+ NLP F
Sbjct  1002  LAVVGDGGTGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPF  1061

Query  411   KNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGRNDL  468
             KNQLARLNLKYVLEE+DP +LA KV VDPL A+EEP+ A   + +G+DQC +   GRN+L
Sbjct  1062  KNQLARLNLKYVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNEL  1121

Query  469   LDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN  528
             L+FL+ IIP+LP+WVG  I+SKP  +   +L ++S+LDFSAKN  +++D   L++DI  N
Sbjct  1122  LEFLSQIIPQLPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARN  1181

Query  529   FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPG--MEEDNGYIPLDVLHDLPESiyei  586
             FSD+D  +A+ +LKRKSGGNF +L+FTKQALSHPG  M    G +PL+VL DLP+S+++I
Sbjct  1182  FSDEDSAEAKRVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDI  1241

Query  587   yeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRA  646
             Y EIFEDKFG+GR+RIW K +PLL+LIV AA+GPY+ +TE QA+E F  + ED+R +RR+
Sbjct  1242  YTEIFEDKFGQGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRS  1301

Query  647   FVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
             FVD++ V HG YR+E+SAL  WL DP R+ EQFY+ V   +  LR+L
Sbjct  1302  FVDLVEVKHGAYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKL  1348

>PHYRA_81098
Length=741

 Score = 590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/704 (48%), Positives = 451/704 (64%), Gaps = 97/704 (14%)

Query  30   ATDEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsas  89
            A DE++LR+ K  Q++A R  R+TT+  +   +      DDVEEMFY             
Sbjct  22   ALDEDSLRL-KQTQDDALRLDRSTTLTDTVNVT------DDVEEMFY-------------  61

Query  90   arsTDNFGRsttssmrstdtysNGNASRATGGSLRVTDM--YRTTEQMRGTN--LMPLQE  145
                                          GG   V+D+  YRTTEQ+RGT+  L  L E
Sbjct  62   ------------------------------GGRSTVSDVPQYRTTEQLRGTHMTLSALHE  91

Query  146  DE--------------VLPaasratttmatasNGGN-----------------PIDALRA  174
            D                 P+   A+T     + G                    ++ LR+
Sbjct  92   DAEASNASSSFSQFSATTPSNYAASTPGHVPNQGAYHDFSTAHSTTRAISDAFELERLRS  151

Query  175  ELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAV  234
            E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL          S  AS ++ 
Sbjct  152  EVVEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQLAATQH----LSPAASVSST  207

Query  235  GAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPVA  290
             + +   LS+DE   ++R T+  TS AT+ER    RA    + P   RAS RLTQLAPVA
Sbjct  208  ESSSSDPLSADERAALTRQTSTKTSSATRERLAASRANIHKTPPPAARASVRLTQLAPVA  267

Query  291  DDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNL  350
            D+ALSTPL   QI++MFPL++ ++EL A A++  P SR WA+ R +EW+D+RFNVG D L
Sbjct  268  DNALSTPLTPQQINDMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTL  327

Query  351  LALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLF  410
            LA+VG+GG+GKS   G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ +LP F
Sbjct  328  LAVVGEGGTGKSAFLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPF  387

Query  411  KNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KGRNDL  468
            KNQLARLNLKYVLEE DP VLA KVLVDPL A+EEP+ A   + DGIDQC +  +GRN+L
Sbjct  388  KNQLARLNLKYVLEEADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNEL  447

Query  469  LDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN  528
            L+F A +IP LP+WVG  ++SKPS +L  +L ++S+LDFSAKN  +++D   L+ D+  N
Sbjct  448  LEFFAQVIPLLPSWVGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARN  507

Query  529  FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESiyei  586
            FSD D  +A+++LK+KSGGNF +L+FTKQALSHPGM      G +PL VLH+LPE++Y+I
Sbjct  508  FSDNDAAEAKKVLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDI  567

Query  587  yeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRA  646
            Y EIFEDKFG+GR+R+W K +PLL+LIV AA+GPY+L+TE QA++ F+L+ ED+R +R +
Sbjct  568  YAEIFEDKFGQGRARVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHS  627

Query  647  FVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
            FVD++AV HG YRIE+SAL  WL DP R+ EQFY  +   +  L
Sbjct  628  FVDLVAVRHGAYRIESSALCGWLSDPARSEEQFYFAIDDAIQAL  671

>PITG_18458
Length=747

 Score = 590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/709 (47%), Positives = 456/709 (64%), Gaps = 95/709 (13%)

Query  30   ATDEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsas  89
            A DE++LR+ +   ++  RF R+TT+  +   +      DDVEEMFY             
Sbjct  21   ALDEDSLRLKQTQDDDPVRFDRSTTLADTVNVT------DDVEEMFY-------------  61

Query  90   arsTDNFGRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQMRGTN--LMPLQED-  146
                                       R+T  +      YRTTEQ+RG N  L  L ED 
Sbjct  62   --------------------------GRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDV  95

Query  147  ----------------EVLPa------------------asratttmatasNGGNPIDAL  172
                               P+                   ++ TT M+ A +G   ++ L
Sbjct  96   EASNVSNVSSSFSQFSATTPSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVSGDFELERL  155

Query  173  RAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGA  232
            R+E+ E+K EV+AIRRE+MNE+HVTRYDVLKE+ +LKG I QL TA +        AS +
Sbjct  156  RSEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAIAQL-TATQHIA----PASVS  210

Query  233  AVGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAP  288
            +  + +   LS DE   ++R T+  TS+AT++R    R     + P   RAS RLTQLAP
Sbjct  211  STESSSSDPLSPDERAALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARASVRLTQLAP  270

Query  289  VADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVD  348
            VAD+ALSTPL   QI+EMFPL++ ++EL A A+   P +R WA+ R +EW+D+R+N+G D
Sbjct  271  VADNALSTPLNPQQINEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGND  330

Query  349  NLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLP  408
             LLA+VG+GG+GKST  G +  +F  N++A H C FDRKSKSSPRNVLLS+V+QL+ +LP
Sbjct  331  TLLAVVGEGGTGKSTFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLP  390

Query  409  LFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRN  466
             FKNQLARLNLKYVLEE DP +LA KVLVDPL A+EEP+ A   + DGIDQC   S GRN
Sbjct  391  SFKNQLARLNLKYVLEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRN  450

Query  467  DLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDII  526
            +LL+  A +IP+LP+WVG  ++SKPS +L  +L ++S+LDFSAKN  ++ D   L++DI 
Sbjct  451  ELLELFAQVIPQLPSWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIA  510

Query  527  GNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGM--EEDNGYIPLDVLHDLPESiy  584
             NFSD D  +A+++LK+KSGGNF +L+FTKQALSHPG+      G +PL+VLH+LPE++Y
Sbjct  511  RNFSDDDAAEAKKVLKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLY  570

Query  585  eiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIR  644
            +IY EIFEDKFG+GR+R+W K +PLL+L+V AA+GPY+ +TE QA+E F+L+ ED+R +R
Sbjct  571  DIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLR  630

Query  645  RAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            R+FVD+++V HG+YRIE+SAL  WL DP R+ EQFY  V   +  LR++
Sbjct  631  RSFVDLVSVKHGSYRIESSALCAWLSDPARSEEQFYFSVDDALLALRKI  679

>PYAR_13571
Length=666

 Score = 580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/512 (58%), Positives = 371/512 (72%), Gaps = 51/512 (10%)

Query  185  AIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSS  244
            AIRREMMNEMH +RYDVLKE+TMLKGTI QL+                            
Sbjct  120  AIRREMMNEMHTSRYDVLKEVTMLKGTITQLI----------------------------  151

Query  245  DELDTISRTTALYTSKATKER-RATREDSAPVLVRASS-RLTQLAPVADDALSTPLLQHQ  302
               +T++R T    SK+TKER   TR+D  P L+RA+S RLTQLAPV D ALSTPL Q Q
Sbjct  152  ---ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208

Query  303  IDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKS  362
            IDE+FPL++ S E+Q  A+  D  +REWA +R QEW+DSRFNVG D LLA+VGD G+GK+
Sbjct  209  IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268

Query  363  TLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYV  422
                             H C F+RK KSSPRNVLLS+VNQL + LP FK+QLARLNLKYV
Sbjct  269  -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311

Query  423  LEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK-SKGRNDLLDFLAVIIPELPT  481
            LEETD L LARKVLVDPL +LEEPLTAK  + DG+DQC  + G NDLLDFL+V++PE P+
Sbjct  312  LEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPS  371

Query  482  WVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREIL  541
            W+G  IT+KPSPE   K+ +TSLLDFSAKN  Y+NDT +L+ DI+  F  +D   A +IL
Sbjct  372  WLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQIL  431

Query  542  KRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSR  601
            K KS GN+++L+FT+QA+S+PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR+R
Sbjct  432  KTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491

Query  602  IWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIE  661
            +W+K  P+L+LI TAASGPYA ITE    +  S +K+D+R +RRAF+DII++ HGTY I 
Sbjct  492  LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIV  551

Query  662  TSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            +SALF+WL DPQR GE ++VDV+  + +LR++
Sbjct  552  SSALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583

>HYAP_07104
Length=721

 Score = 555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/670 (46%), Positives = 429/670 (64%), Gaps = 25/670 (4%)

Query  32   DEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsasar  91
            DE+++R+ K  Q+   R  R+ T+  +   +      DDVEEMFY+ +   + N     R
Sbjct  20   DEDSMRL-KQNQDHVVRLDRSGTLTDTVNET------DDVEEMFYSSTQTRSTNGPPQYR  72

Query  92   sTDNF-GRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQMRGTNLMPLQE-DEVL  149
            ST+   GR  T +        N +A   +GGS   +   + ++     + + L      L
Sbjct  73   STEQLPGRLLTLTSL------NEDAETPSGGSNASSSFSQFSDHATSISSVNLTSTHHHL  126

Query  150  PaasratttmatasNGGNPIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLK  209
              ++   +         + ++ LR EL E+K EV AIR+ ++NE+HVTRYDVLKE+ +LK
Sbjct  127  TTSTSMMSHPRAVGGASSELEQLRFELIEVKQEVAAIRQHVVNELHVTRYDVLKELALLK  186

Query  210  GTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKER----  265
            G I QL             +   ++       LSS +   ++R T+  TS AT++R    
Sbjct  187  GAIAQLTGTFPPPTT----SVPLSIQRSVSNPLSSADRGALTRQTSTMTSSATRDRLAAS  242

Query  266  RATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDP  325
            R       P   RAS RLTQLAPVAD ALSTPL   Q++++FPL++ +TEL A A+   P
Sbjct  243  RVNTYKPPPPAARASVRLTQLAPVADSALSTPLSSVQMNDLFPLIDFTTELAAHARRLTP  302

Query  326  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  385
             SR WA+ R +EW++SRF  G+D LLA+VG+GGSGKS   G +  ++   +VA H C FD
Sbjct  303  GSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAFCGTVAQQYRGQLVAAHCCQFD  362

Query  386  RKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEE  445
            RK KSSPRNVLLS+V+QL+ NLPLFKNQLARLNLKYVLEE DP++LA KVLVDPL ALE+
Sbjct  363  RKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLEEADPVLLASKVLVDPLNALED  422

Query  446  PLTAKVFVFDGIDQCK--SKGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITS  503
            P+     + DGIDQC     GRN+LL+FLA +IP+LP+W+GV ++SKPS +L  +L ++S
Sbjct  423  PVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSWLGVIVSSKPSSKLAKRLPVSS  482

Query  504  LLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPG  563
            +LDFSAKN  ++ D   L+++I  +F  +DV +A+E+LK KSGGNF +L+FTKQALS   
Sbjct  483  VLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLKHKSGGNFAYLEFTKQALSGMA  542

Query  564  MEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYAL  623
                 G + +DVL +LPE++Y+IY EIFEDKFG GR+R+W K + +L+L + A +GPY+ 
Sbjct  543  SVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARVWSKAEQVLQLAIGATAGPYSP  602

Query  624  ITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDV  683
            +TE QAQE F L+ ED+R +RR+FVD++AV HG YRIE SAL  WL DP RA EQFY ++
Sbjct  603  VTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIENSALCAWLCDPARAEEQFYFNI  662

Query  684  SGGMNLLRQL  693
               +  LR++
Sbjct  663  DDALQALRKM  672

>PHALS_06476
Length=726

 Score = 530 bits (1365),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 317/708 (45%), Positives = 427/708 (60%), Gaps = 118/708 (17%)

Query  32   DEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEMFYngsangnanpsasar  91
            ++++LR  KH Q+E  R  R+ T+  +   +      DDVEEMFY               
Sbjct  27   NDDSLR-RKHTQDETVRVDRSATLTDTVNMT------DDVEEMFY---------------  64

Query  92   sTDNFGRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQMRGTNL--MPLQED---  146
                                  N S AT G       YRTTEQ+RG NL    L ED   
Sbjct  65   ----------------------NRSTATSG----IPQYRTTEQIRGNNLALYALHEDFET  98

Query  147  ---------------EVLPaasratt------------------tmatasNGGNPIDALR  173
                              P++  A+T                  +   A +G   ++ L 
Sbjct  99   QSTASDASSSFSQFSATTPSSYAASTPGNHAGIHHDFSTMYNTTSTLPAISGDFDLERLH  158

Query  174  AELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAA  233
            +E+ ++K EV+ IRRE+MNE+HVTRYDVLKE+T+LKG I QL +        S+ ++ ++
Sbjct  159  SEVLKIKSEVKTIRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSS  218

Query  234  VGAEAQPELSSDELDTISRTTALYTSKATKER----RATREDSAPVLVRASSRLTQLAPV  289
                     SSDE   ++R T   TS+AT++R    R     + P  +RAS+RLTQLAPV
Sbjct  219  SSDPL----SSDERAALTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPV  274

Query  290  ADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDN  349
            ADDALSTPL   QI+E FPL++ ++EL A A++  P SR WA+ R QEW+D+RF++G D 
Sbjct  275  ADDALSTPLNSQQINESFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDT  334

Query  350  LLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPL  409
            LLA+VG+GGSGKS   G +  +F  N++A H C FDRKSKS PRNVLLS+V+QL+ NLPL
Sbjct  335  LLAVVGEGGSGKSAFCGTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPL  394

Query  410  FKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK--SKGRND  467
            FKNQLARLNL+YVLEETDP +LA KVL+DPL ALEEP  +   + DGIDQC   S GRN+
Sbjct  395  FKNQLARLNLRYVLEETDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNE  454

Query  468  LLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIG  527
            LL+F++ II  LP+WVG  ++SKPS +L   L ++S+LDFSAKN  ++ D   L+ DI  
Sbjct  455  LLEFISQIISLLPSWVGFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQ  514

Query  528  NFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGME--EDNGYIPLDVLHDLPESiye  585
             FSD D  +A+ +L +KSGGNF +L+FTKQALSHPGM     NG +PL VL +LPE++Y+
Sbjct  515  YFSDDDAVEAKRMLTKKSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYD  574

Query  586  iyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRR  645
            IY EIFEDKFG+G +R W K +PLL+LIV AA+GPY+L+TE QA++Q  L+ +D+R +RR
Sbjct  575  IYAEIFEDKFGQGHARAWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRR  634

Query  646  AFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693
            +FVDI+AV H                     EQFY  +   +  LR++
Sbjct  635  SFVDIVAVKH--------------------EEQFYFSIEDALLALRKM  662

>PYVX_23590
Length=689

 Score = 514 bits (1325),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 318/689 (46%), Positives = 426/689 (62%), Gaps = 101/689 (15%)

Query  15   QKRLERAQSDAVTVRATDEETLRMSKHVQEEAHRFQRnttmntsaasstssymsDDVEEM  74
            ++ L+RAQSD V +   D+E+LR+S+ V E+A RFQR+TT+++++++ +       VEEM
Sbjct  18   ERDLKRAQSDGVPL--PDDESLRLSRQVAEDALRFQRHTTLSSASSAMSDD-----VEEM  70

Query  75   FYngsangnanpsasarsTDNFGRsttssmrstdtysNGNASRATGGSLRVTDMYRTTEQ  134
            FY G   G+A     A                        A R+T GS+R TD+YRTTEQ
Sbjct  71   FYGGGPGGHAGHGGHAGHG--------------------GADRSTAGSVRTTDVYRTTEQ  110

Query  135  MRGTNLMPLQEDEVLPaasratttmata---sNGGNPIDALRAELSEMKLEVQAIRREMM  191
            +R T L PL ED VLP A    +   T+   ++G   + ALRAEL++++ E QAIRRE+M
Sbjct  111  LRSTGLEPLAEDRVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAIRREVM  170

Query  192  NEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSDELDTIS  251
            NE+HV RYDVLKE+T+LKG + QL+ AL   G            A ++P  +       +
Sbjct  171  NELHVLRYDVLKEVTVLKGAVAQLLAALAPGGG----------DAGSRPGSAGSATSAAT  220

Query  252  RTTALYTSKATKERRATREDSAPVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVE  311
              ++     +  +R A     AP L          APV D ALS PL   Q+DE+FPLV+
Sbjct  221  TASSSSAELSPADRAAI--GVAPTL----------APVDDAALSAPLRPEQLDELFPLVD  268

Query  312  CSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDK  371
             ST++ AFA+   P +R+WA  R QEW+DSRFNVG D LL +VG  G+GKST  G++CD 
Sbjct  269  ASTDIAAFARARAPGTRDWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDM  328

Query  372  FHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVL  431
               NV+A H C FDRK+KS+PR VLLSLV Q+++NLP FK QLARLNLKYVLEE D  VL
Sbjct  329  LQGNVLATHFCKFDRKAKSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVL  388

Query  432  ARKVLVDPLCALEEPLTAKVFVFDGIDQCKS--KG--RNDLLDFLAVIIPELPTWVGVFI  487
            A KVL+DPL A EEP+TAK  V DG+DQCK+  +G  RN+LL+FLA ++P+LP+W+GV +
Sbjct  389  AGKVLIDPLAACEEPITAKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLV  448

Query  488  TSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGG  547
            +SKP+PEL  +L  TSLLDFS KN  ++ D   L++DI  NF+D    +AR +L+ K+GG
Sbjct  449  SSKPAPELATQLKFTSLLDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGG  508

Query  548  NFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQ  607
            NF +LDFT+QALS PG+  D+G + LD+LHDLPES+YEIY EIFED              
Sbjct  509  NFAYLDFTRQALSSPGL--DDGELELDMLHDLPESLYEIYLEIFED--------------  552

Query  608  PLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFE  667
                                          +D+R ++R+FVDIIAV  G YRIE+SALFE
Sbjct  553  -----------------------------NDDMRLVKRSFVDIIAVRGGCYRIESSALFE  583

Query  668  WLVDPQRAGEQFYVDVSGGMNLLRQLHHQ  696
            WL DP R+GE F+ D   G++ LR+L   
Sbjct  584  WLSDPARSGESFFFDADAGVDELRRLQQH  612

>CCA22843
Length=586

 Score = 402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 216/539 (40%), Positives = 328/539 (61%), Gaps = 26/539 (5%)

Query  167  NPIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRS  226
            N  +A+R E+ +M+ E+Q++R+E++  +  TRYD++KEI  L+G +  +   L    V+S
Sbjct  58   NQFEAVRNEIQDMRNEIQSVRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKS  117

Query  227  ---------LDASGAAVGAEAQPELSSDELDTISRTTAL----YTSKATKERRATREDSA  273
                       A+  A    A+ +       T  R+T +    Y S    ER  T++ S 
Sbjct  118  SPTGTNENHTTANKTAFSESAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSF  177

Query  274  PVLVRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIE  333
               V          P+ +  LS PL + + DEMFP ++C ++L++ A      +R WA++
Sbjct  178  STSV----------PLDESQLSKPLDKDEFDEMFPCIDCFSDLKSNALKLARGTRVWALD  227

Query  334  RFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPR  393
            R +EW++S F    D++L ++G+GGSGKSTL G +C KF   + A H C FDRKS+SS R
Sbjct  228  RVKEWIESNFKSENDHILTIIGEGGSGKSTLAGYICQKFDAKLHAYHFCQFDRKSRSSSR  287

Query  394  NVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFV  453
            +V+LSLV+Q  S  PL+K QL  LNL+Y+L+E++PLV+A K+L++PL A+    + + FV
Sbjct  288  DVVLSLVSQFASKNPLYKRQLTCLNLRYILKESNPLVMANKLLIEPLRAIPVSNSTRGFV  347

Query  454  -FDGIDQCKSKGR-NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKN  511
             FDGIDQC  +   NDLLD ++ I    P+ +G  +TSK SP   AK    S++    +N
Sbjct  348  LFDGIDQCLVENESNDLLDLISHITQRFPSCIGFVVTSKASPAFDAKFKSKSIIHLHERN  407

Query  512  TNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYI  571
              +MND+ IL+ + I NF  K   +A +IL RKSGGN  +L FT++ALSHP +  +  ++
Sbjct  408  GKFMNDSRILMENSILNFEPKHTNEACDILMRKSGGNGLYLQFTERALSHPILHGERTFL  467

Query  572  PLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQE  631
             LDVL +LP+S+ +I+  IFEDKFG+G  R+WK V+P+LE IV AA+G + L+ E Q ++
Sbjct  468  SLDVLDELPDSVDDIFFTIFEDKFGQGHQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQ  527

Query  632  QFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
            +F L KE+ R ++R+F DII      YRI TS+LF WL+   R+ + FY+D   G+  L
Sbjct  528  RFQLGKEEWRMMKRSFTDIICCGTEGYRIITSSLFAWLIVENRS-QHFYIDPKAGIKFL  585

>CCI44111
Length=576

 Score = 392 bits (1008),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 214/536 (40%), Positives = 320/536 (60%), Gaps = 25/536 (5%)

Query  169  IDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALES------K  222
            I+A R E+  M+ E+Q +R+E++  +  TRYD+LKEI  LKG +  +   ++S       
Sbjct  53   IEAFRDEIKGMRKEIQNVRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKIN  112

Query  223  GVRSLDASGAAVGAEAQPELSSDELDTISRTTAL----YTSKATKERRATREDSAPVLVR  278
             +    A+G+A    A          T  R+T L    + ++   +    RE   P L+ 
Sbjct  113  KLNHTTANGSACSEGADDNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLM-  171

Query  279  ASSRLTQLAPVADDA-LSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQE  337
                        D+A LS PL + +IDEMFPL++CS ++++ A      +R WA++   +
Sbjct  172  ----------TMDEANLSKPLSKDEIDEMFPLIDCSGDVESNALKLASGTRGWALDHITK  221

Query  338  WVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLL  397
            W+ S F  G + +L +VG+GG+GKSTL G +C KF  N+ A H   FDRK  SS R+V+L
Sbjct  222  WIQSNFENGNERVLTIVGEGGAGKSTLAGYVCQKFAANLHAYHFFQFDRKLGSSSRDVVL  281

Query  398  SLVNQLISNLPLFKNQLARLNLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFV-FDG  456
            SLV+Q  S L L+K QL RLNL+Y+L E++PLV+A K+L+DPL A+ E  +   FV FDG
Sbjct  282  SLVSQFASKLQLYKRQLTRLNLRYILAESNPLVMATKLLIDPLRAIPESDSTFGFVLFDG  341

Query  457  IDQCKSKGR-NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYM  515
            IDQC  K + NDLL+ L+ I    P+W+G  +TSK  P   A+L   S++     N +++
Sbjct  342  IDQCLVKNQSNDLLELLSHITERFPSWIGFVVTSKAFPAFAARLKTNSVIHLDGSNVHFL  401

Query  516  NDTIILINDIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDV  575
             D+ IL+ +++  F  K   +A +IL RKSGGN  +L F  +ALSHP +  +  ++ LDV
Sbjct  402  QDSRILMENLLLYFEPKHTNEACDILMRKSGGNSLYLQFINRALSHPILHGEQTFLSLDV  461

Query  576  LHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSL  635
            L +LPES+ EI   IF+DKFG+G  R+WK  +P+LE+IV AA+GPY L+ E+Q ++QF L
Sbjct  462  LDELPESVDEIIFTIFDDKFGQGHQRVWKNAKPILEVIVAAAAGPYPLVGESQIKQQFEL  521

Query  636  SKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLLR  691
             + + R I RAF DII      YRI  S+L++WLV  +R+ + F+++       LR
Sbjct  522  RENEWRMINRAFTDIIHCGTDGYRIINSSLYDWLVVEKRS-QHFHLNPQAVFKFLR  576

>SPRG_06355
Length=713

 Score = 284 bits (727),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 191/574 (33%), Positives = 309/574 (54%), Gaps = 68/574 (12%)

Query  168  PIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKG----  223
            P  A+ A + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +     
Sbjct  138  PSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAA  197

Query  224  ---VRSLD-----ASGAAVGAEAQPELSSDE-------------LDTISRTTALYTSKAT  262
               +R+ D      S A V +EA  E S+ E             L   SRT +    ++T
Sbjct  198  TPLLRTEDRKLSVMSDATVSSEADSESSTLEEPEVFEPNPKVPYLPAASRTPSPPKREST  257

Query  263  KERRATREDSAPVLVRASSRLTQLA-----------------PVADDALSTPLLQHQIDE  305
              R + R  S   L R SS+L++ +                 P+ D AL+ P  ++ +++
Sbjct  258  VVRESIRASSK--LSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQ  314

Query  306  MFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLT  365
              P +      Q  A    PS+R WAI ++ +W           +L +VG  G+GKSTL 
Sbjct  315  HLPFLNT----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLL  370

Query  366  GALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEE  425
              L   + + ++A H   +D +  +S   +L+SL +Q+   LP F+ QL RLNL Y+++E
Sbjct  371  SHLVSNYPEQIMASHFVRYDERHATS--AILMSLAHQISCKLPDFQQQLVRLNLAYLIQE  428

Query  426  TDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGV  485
             DP+VLA K+L++PL ++  PL ++V V D +D+  S    +L+  LA +  E P+WV  
Sbjct  429  PDPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTNLISLLADVALEFPSWVLF  488

Query  486  FITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN--FSDKDVPQAREILKR  543
             ++S+P   +   L    +L F  ++  +  D  I +  ++      DK++     +LK 
Sbjct  489  LLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDKNI---LFLLKA  545

Query  544  KSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIW  603
            KS G+F +L F  QA +    E D G I      +LP+++YEIY+++FE+K+GKGR R+W
Sbjct  546  KSQGSFLYLQFVDQAFAMIHSEIDAGMI-----LELPKTLYEIYDQVFEEKYGKGRRRVW  600

Query  604  KKVQPLLELIVTAASGPY-----ALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNH--G  656
            +KVQP+LE IV AA+  +       +TE+  Q  F L + D+  I R+F DI+AV+   G
Sbjct  601  QKVQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETG  660

Query  657  TYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
             YR+++  LF++LVD  R+ E  +++V  G++ L
Sbjct  661  VYRLQSKGLFDYLVDTSRSQEVAHINVERGVHYL  694

>SDRG_01763
Length=736

 Score = 276 bits (707),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 188/582 (32%), Positives = 308/582 (53%), Gaps = 74/582 (13%)

Query  168  PIDALRAELSEMKLEVQAIRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKG----  223
            P  A+ A + EMK  V  IRR++M E+H T+YD+LKE+TML+G ++QLV A+  +     
Sbjct  151  PSMAMDAAVDEMKRHVDGIRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQSTPRA  210

Query  224  -----VRSLD-----ASGAAVGAEAQPELSSDE-------------LDTISRTTALYTSK  260
                 +R+ D      S A V +EA  E S+ E             L   SRT +    +
Sbjct  211  VATPLLRTEDRKLSVMSDATVSSEADSEDSTHEEPEVFEPNPKVPYLPAASRTPSPPKRE  270

Query  261  ATKERRATREDS-----APVLVRASSRLTQLA------------------PVADDALSTP  297
            +T  R +TR  S     +  L R SS+L++ +                  P+ D AL+ P
Sbjct  271  STVFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSKLLFRESTRQPIKDQALTQP  330

Query  298  LLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDG  357
              ++ +++  P +      Q  A    PS+R WAI ++ +W           +L +VG  
Sbjct  331  -WENVLNQHLPFLNT----QRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGA  385

Query  358  GSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARL  417
            G+GKSTL   L   + + ++A H   +D   + +P  +L+SL +Q+   LP ++ QL RL
Sbjct  386  GAGKSTLLSHLVSNYPEQIMASHFVRYDE--RHAPSAILMSLAHQISCKLPDYQQQLVRL  443

Query  418  NLKYVLEETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIP  477
            NL Y+++E DP+VLA K+L++PL ++  PL ++V V D +D+  S    +L+  LA +  
Sbjct  444  NLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGANLISLLADVAL  503

Query  478  ELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGN--FSDKDVP  535
            E P+WV   ++S+    +   L    +L F  ++  +  D  I +  ++      DK++ 
Sbjct  504  EFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDKHGLDDKNI-  562

Query  536  QAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKF  595
                +LK KS G+F +L F  QA S    E D G I      +LP++++EIY+++FE+K+
Sbjct  563  --LFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAGMIL-----ELPKTLHEIYDQVFEEKY  615

Query  596  GKGRSRIWKKVQPLLELIVTAASGPY-----ALITENQAQEQFSLSKEDIRTIRRAFVDI  650
            GKGR R+W+KVQ +LE IV AA+  +       +TE+  Q  F L + D+  I R+F DI
Sbjct  616  GKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDI  675

Query  651  IAVNH--GTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
            + V+   G YR+++  LF++LVD  R+ E  +++V  G++ L
Sbjct  676  VTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINVERGIHYL  717

>H257_11773
Length=1026

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 179/421 (43%), Gaps = 33/421 (8%)

Query  277  VRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQ  336
            V+ + RL QL       L     Q ++  +F       E+  F Q +  + REW +++  
Sbjct  421  VKYAVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEISKFTQGF--AGREWVMDQLT  478

Query  337  EWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVL  396
            EW  S           + G  G+GK+ +  ++       V A HL   + +   + R  +
Sbjct  479  EWKASS-----SQTFWITGQIGTGKTAVAASVIQN-QPEVRAFHLVSKEDEQTQNHRRCV  532

Query  397  LSLVNQLISNLPLFKNQLARLN--LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VFV  453
            LSL  QL + LP +   L + +  L+ ++  +    L   +LV PL A+ +P T   V +
Sbjct  533  LSLAYQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVIL  592

Query  454  FDGID--QCKSKGRNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKL-AITSLLDFSAK  510
             DG+D  Q  +   N  +  LA  +  LP WV   +TS+  P +  KL  +   +     
Sbjct  593  IDGLDAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKC  652

Query  511  NTNYMNDTIILINDIIGNF---SDKDVPQA--REILKRKSGGNFTFLDFTKQALSHPGME  565
                 +D +  +   +  F   +DKDVP A  R I++R S G F +      ALS   + 
Sbjct  653  GHQTRDDMLKYLQLALVQFVANADKDVPAATLRFIVER-SEGLFLYASHIVNALSQKRLT  711

Query  566  EDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALIT  625
                   LD L   P  +     + FED+F          V+PLLE ++ AA  P  + T
Sbjct  712  -------LDKLESFPVGMGGYLRQYFEDQFTALHYE--TSVRPLLE-VLCAAFEPLHMST  761

Query  626  ENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQFYVDVSG  685
             +   +  S +  D     ++ + +   N    +   +++FEWL D   AG +F+V  + 
Sbjct  762  LHNIMKWDSYAHRDFLGSFKSLLYVSDENE--LKPFHTSVFEWLEDAHAAG-RFFVCAAN  818

Query  686  G  686
            G
Sbjct  819  G  819

>PPTG_11365
Length=1106

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 109/470 (23%), Positives = 185/470 (39%), Gaps = 72/470 (15%)

Query  277  VRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQ  336
            VR  SR  QL    +  L     Q ++  +        ++    +N+    REW  E+FQ
Sbjct  454  VRYESRKDQLISALEGTLDHEGQQARLFSLLAPFNFQRQISHLTENF--IGREWLFEQFQ  511

Query  337  EWV------DSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKS  390
             WV       S   +    +  +VG  GSGK+++   +     + + A HL   + +   
Sbjct  512  RWVQGSAASSSTRELSNQRVFWVVGQIGSGKTSVAACMVQSCPE-IAAFHLATQEDEQTH  570

Query  391  SPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLCALEEP  446
            + R  +LSL  QL + LP + + L        LEE  P+     L   +L+ PL A+  P
Sbjct  571  NARRCILSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGPLTAIARP  627

Query  447  LTAK--VFVFDGIDQC------------------KSKGRNDLLDFLAVIIPELPTWVGVF  486
               K  V + DG++                    ++K     +  L +++  LP WV + 
Sbjct  628  SKYKSLVLLIDGVEWLIPASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLPEWVRIV  687

Query  487  ITSKPSPELPAKLAITSLLDFSAKNTNYMNDTII--LINDII------------------  526
            + S+  P + +KL      D + +   + ND  I   IN  +                  
Sbjct  688  LLSREEPPVLSKLRAFDPPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEKAAAQIG  747

Query  527  ---GNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESi  583
               GN  +  + Q  E++ R+S G F +     QA+S        G + L  L +LP  +
Sbjct  748  TDSGNNHEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLHLHELAELPVGM  800

Query  584  yeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTI  643
                ++ F   F         +V+P+LE +  AA  P  + T  +  E     + D  T+
Sbjct  801  GAYLQQFFASHFAD-HDMYKHRVRPVLE-VCCAAYEPLPVATIARVLEWDVYEQRDAATV  858

Query  644  RRAFVDIIAVNH---GTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
              +   I A N     T R   +++ +W+ D   +G  F+VDV+ G   L
Sbjct  859  LGSLFSIEAGNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDVASGHERL  907

>PHYSO_470533
Length=1084

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 102/416 (25%), Positives = 167/416 (40%), Gaps = 71/416 (17%)

Query  328  REWAIERFQEWVDSRFNVGVD---------NLLALVGDGGSGKSTLTGALCDKFHDNVVA  378
            REW  ERFQ+WV     +             +  LVG  GSGK+++   +     + + A
Sbjct  472  REWLFERFQQWVQGSTTLSTSTQTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPE-IAA  530

Query  379  MHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARK  434
             H    + +   + R  +LSL  QL + LP + + L        LEE  P+     L  +
Sbjct  531  FHFARQEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVSQ  587

Query  435  VLVDPLCALEEPLTAK--VFVFDGIDQC----------------KSKGRNDLLDFLAVII  476
            +L+ PL A+  P T K  V + DGI+                   SK    L+  L  + 
Sbjct  588  LLIGPLNAIARPTTYKSLVLLIDGIEWLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALA  647

Query  477  PELPTWVGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTII--LIN-----------  523
              LP WV V + S+  P + +KL      D    +  + ND  I   +N           
Sbjct  648  SRLPDWVRVVVLSREDPPVLSKLHAFEPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEV  707

Query  524  ----------DIIGNFSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPL  573
                      D+  N  +  + Q  E++ R+S G F +     QA++        G + L
Sbjct  708  DFAKASEQAVDVPANNHEFGLEQVVELIARRSEGLFLYAVNVVQAIT-------EGRLRL  760

Query  574  DVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITENQAQEQF  633
              L +LP  +    ++ F   F        ++V+P+LE ++ AA  P  L T  +  E  
Sbjct  761  HELAELPVGMGAYLQQFFASHFSD-HDMYKQRVRPVLE-VLCAAYEPLPLATLARVLEWD  818

Query  634  SLSKEDIRTIRRAFVDIIA---VNHGTYRIETSALFEWLVDPQRAGEQFYVDVSGG  686
               + D  ++  +   I A    N    R   S++ +W+ D   +G+ F+VDV+ G
Sbjct  819  VYEQRDASSVLGSLFCIEAGYDANSQLLRPFHSSVLDWIQDSNSSGD-FFVDVASG  873

>H310_08292
Length=1007

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 100/425 (24%), Positives = 175/425 (41%), Gaps = 41/425 (10%)

Query  277  VRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQ  336
            V+ + R+ QL       L     Q ++  +F       E+  F Q +  + REW +++  
Sbjct  406  VKYAVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIAKFTQGF--AGREWVMDQLT  463

Query  337  EWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVL  396
            +W              + G  G+GK+ L   +       V A HL   D +   +PR  +
Sbjct  464  QW-----KASASQTFWVTGQIGTGKTALAAYIIQS-QPEVRAFHLVSKDDEQTQNPRRCI  517

Query  397  LSLVNQLISNLPLFKNQLARLN-LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VFVF  454
            LSL  QL + LP +   L +   L+ ++  +    L   +LV PL A+ +P T   V + 
Sbjct  518  LSLAYQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILL  577

Query  455  DGIDQCKSKGR--NDLLDFLAVIIPELPTWVGVFITSKPSPELPAKL-------AITSLL  505
            DG+D  +      N  +  L  ++ +LP+WV +  TS+  P +  KL       A+   +
Sbjct  578  DGLDAFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCV  637

Query  506  DFSAKNT-NYMNDTIILINDIIGNFSDKDVP-QAREILKRKSGGNFTFLDFTKQALSHPG  563
            D S+ +   Y+   ++     +       VP +    +  +S G F +      AL    
Sbjct  638  DQSSADMLKYLQAALV---PFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHALHQKR  694

Query  564  MEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASG-PYA  622
            +        LD L   P  +     + FED+F          ++PLLE++  A    P A
Sbjct  695  LT-------LDKLESFPVGMGGYLRQFFEDQFSAHHYE--TSIRPLLEVLCAALEPMPMA  745

Query  623  LITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHG-TYRIETSALFEWLVDPQRAGEQFYV  681
            ++ +    + +S      R    AF  ++ V+     +   +++FEWL D   AG +F+V
Sbjct  746  MLHDVMKWDTYSH-----RDCLGAFKSLLYVSESDDIKPFHTSVFEWLQDANAAG-RFFV  799

Query  682  DVSGG  686
             V  G
Sbjct  800  RVEHG  804

>SDRG_04575
Length=1003

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 102/428 (24%), Positives = 182/428 (43%), Gaps = 46/428 (11%)

Query  282  RLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDS  341
            RL Q+A      L    LQ ++  +F       ++  + Q +  + REW + +  +W  +
Sbjct  404  RLAQIATALRGKLDHDGLQARLFSIFSPFSFQNQISKYTQGF--AGREWVLHQLDQWKQT  461

Query  342  RFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVN  401
                  D +  + G  G+GKS L   +       + A HL   + +   S R  +LSL  
Sbjct  462  H-----DQVFWITGQIGTGKSALAAYIIQS-RPEIRAFHLVCKEDEQTQSHRRCILSLAY  515

Query  402  QLISNLPLFKNQLARLN-LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VFVFDGIDQ  459
            QL + LP + + L + + L+ V+  +  + L   +LV PL A+ EP T   V + DG+D 
Sbjct  516  QLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVILLDGLDS  575

Query  460  CKSKGRND--LLDFLAVIIPELPTWVGVFITSKPSPELPAKL-------AITSLLDFSAK  510
             +     D  L+  L  ++ +LP+WV V +TS+  P +  KL       A+   +D S +
Sbjct  576  LEDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKLQGFTPQIALDKCVDNSRQ  635

Query  511  NT-NYMNDTII----------LINDIIGNFS-DKDVPQAREILKRKSGGNFTFLDFTKQA  558
            +  NY+   ++            + + G    ++D    R++L R   G F +      A
Sbjct  636  DIMNYLQRALVPYLPSVRHRRRCSSLRGAPKVERDATTHRDLLLRI--GLFLYASHIVHA  693

Query  559  LSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAAS  618
            LS          + LD L   P  +     + FE +F     +  + ++PLLE ++ AA 
Sbjct  694  LS-------QHRLTLDHLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-VLCAAY  743

Query  619  GPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAGEQ  678
             P  L       +  S  + ++    ++ + +   N    +   +++ EWL D   AG  
Sbjct  744  EPLTLDMLRAIMQWDSYVQHEMLASFKSLLYVTDSN--VLKPFHTSVLEWLQDSNAAGP-  800

Query  679  FYVDVSGG  686
            F+  V  G
Sbjct  801  FFARVEHG  808

>SPRG_12621
Length=1003

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 99/409 (24%), Positives = 179/409 (44%), Gaps = 40/409 (10%)

Query  282  RLTQLAPVADDALSTPLLQHQIDEMF-PLVECSTELQAFAQNYDPSSREWAIERFQEWVD  340
            RL Q+A      L    LQ ++  +F P    S +   + Q +  + REW +++  +W  
Sbjct  419  RLAQIATALRGKLDHDGLQARLFSIFSPF---SFQTNKYTQGF--AGREWVLDQLDQWKQ  473

Query  341  SRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLV  400
            +      D +  + G  G+GKS L   +       V A HL   + +   S R  +LSL 
Sbjct  474  TH-----DQVFWVTGQIGTGKSALAAYIIQS-RPEVRAFHLVCKEDEQTQSHRRCVLSLA  527

Query  401  NQLISNLPLFKNQLARLN-LKYVLEETDPLVLARKVLVDPLCALEEPLTAK-VFVFDGID  458
             QL + LP + + L + + L+ V+  +  + L   +LV PL A+ EP T   V + DG+D
Sbjct  528  YQLTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVILLDGLD  587

Query  459  QCKSKGRND--LLDFLAVIIPELPTWVGVFITSKPSPELPAKL-------AITSLLDFSA  509
              +     D  L+  L  ++ +LP+WV V +TS+  P +  KL       A+    D S 
Sbjct  588  SLEDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGFAPQIALDKCADHSR  647

Query  510  KNT-NYMNDTIILINDIIGNFSDKDVPQAR-EILKRKSGGNFTFLDFTKQALSHPGMEED  567
            ++  +Y+   ++     + + +   VP+A  + +  ++ G F +      ALS   +  D
Sbjct  648  QDIMSYLQKALL---PYLPSTTAGVVPEATLQFIAGRAEGLFLYASHIVHALSQHRLTLD  704

Query  568  NGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITEN  627
            N       L   P  +     + FE +F     +  + ++PLLE ++ AA  P  L    
Sbjct  705  N-------LEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-VLCAAYEPLTLDMLR  754

Query  628  QAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIETSALFEWLVDPQRAG  676
               +  S  + ++    ++ + +   N    +   +++ EWL D   AG
Sbjct  755  AIMQWDSYVQHEMLASFKSLLYVTDSN--VLKPFHTSVLEWLQDSNAAG  801

>H257_01934
Length=1022

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 94/385 (24%), Positives = 164/385 (43%), Gaps = 34/385 (9%)

Query  314  TELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFH  373
            +++    Q Y    R W +  F EWV S  +     +  L G  GSGK+ L   +     
Sbjct  451  SQISTATQGY--CGRAWVLHEFDEWVTSPPS-NARRVFLLTGVIGSGKTALAAHIIQN-R  506

Query  374  DNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEET----DPL  429
              VVA HL   + +   + R  +L+LV QL + LP + N L   + K  LEET    +  
Sbjct  507  PEVVAFHLASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK--SQKEPLEETVFVGNLA  564

Query  430  VLARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPELPTWVGVFITS  489
             L +++L+ PL  +  P +  V + DGI +C     ++L+  L   +   P W+    TS
Sbjct  565  DLVQELLIAPLERIATPPSTMVILIDGI-ECFPCADDNLVAILTASLNRWPAWMRFVFTS  623

Query  490  KPSPELPAKLAITSL----LDFSAKNTNYMNDTIILINDIIGNFSDKD---VPQAREILK  542
            +  P + + L    L    LD +   +    D    ++  +G+  D      P   ++L 
Sbjct  624  REDPRVLSLLQAYMLPPIALDLACAQSK--RDVRQYLDTALGSHFDISPPMPPHVIDLLV  681

Query  543  RKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRI  602
             ++ G F +      ++S       +G   LD L ++P ++     + F  +F     + 
Sbjct  682  DRTQGLFLYARHLVDSIS-------SGQWNLDNLDNVPTTMGGFLHQNFATQF-PVVDKY  733

Query  603  WKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIET  662
               V+P+LE +V AA  P   +T +             + ++  F  +     G   +  
Sbjct  734  KVDVRPVLE-VVCAAHEP---LTLDALSAIMHFDVYQAQKLQSDFGSLFHAGEGGVILPF  789

Query  663  S-ALFEWLVDPQRAGEQFYVDVSGG  686
              +L +WL DP+ AG+ ++VDV  G
Sbjct  790  HLSLLDWLQDPRSAGD-YFVDVCTG  813

>PITG_17250
Length=1046

 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 101/413 (24%), Positives = 169/413 (41%), Gaps = 65/413 (16%)

Query  328  REWAIERFQEWVD----SRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCV  383
            REW  + FQ WV     S   +    +  ++G  GSGKS++   +     + + A H   
Sbjct  450  REWLFQLFQRWVQGSAASTRELSNQRVFWVIGQIGSGKSSVAACMVQACPE-IAAFHFAT  508

Query  384  FDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDP  439
             + +   + R  +LSL  QL + LP + + L        LEE  P+     L   +L+ P
Sbjct  509  QEDEQTHNARRCVLSLAYQLTTQLPEYAHYLQS---HEPLEEMVPVASFVELVTHLLIGP  565

Query  440  LCALEEPLTAK--VFVFDGID-----QC---------KSKGRNDLLDFLAVIIPELPTWV  483
            L A+  P   K  V + DG++      C         +SK    L+  L +++  LP WV
Sbjct  566  LNAIARPSKYKSLVLLIDGVEWLLPASCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWV  625

Query  484  GVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTII-----------LINDI-------  525
             + + S+  P + +KL      D   +     ND  I            ++D+       
Sbjct  626  RIVLLSREEPPVLSKLHAFDPPDVIIEQFKLQNDQDIRRFISSSLSKLNLSDVDFEQASA  685

Query  526  -IGNFSDK---DVPQAREILKRKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPE  581
             IG+ SD     + Q  E++ R+S G F +     QA+S        G + L  L +LP 
Sbjct  686  QIGSGSDTGEFGMEQVVELIARRSEGLFLYAVNVVQAIS-------EGRLRLHELAELPV  738

Query  582  SiyeiyeeiFEDKFGKGRSRIWK-KVQPLLELIVTAASGPYALITENQAQEQFSLSKEDI  640
             +     + F   F      ++K +++P+LE +  AA  P  L T  +  E     + D 
Sbjct  739  GMGAYLHQFFASHFAD--HDVYKHRIRPVLE-VCCAAYEPLPLATLARVLEWDVYEQRDA  795

Query  641  RTIRRAFVDIIAVNH---GTYRIETSALFEWLVDPQRAGEQFYVDVSGGMNLL  690
              +  +   I A +       R   S++ +W+ D   +G  F+VDV+ G   L
Sbjct  796  AAMLGSLFSIEAGHDPEAQLLRPFHSSVLDWVRDSNSSG-VFFVDVASGHERL  847

>PYU1_G002110
Length=999

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 103/446 (23%), Positives = 185/446 (41%), Gaps = 58/446 (13%)

Query  277  VRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVECSTELQAFAQNYDPSSREWAIERFQ  336
            VR S R  QL       L     Q ++  +   V    ++   A  +    R+W I +  
Sbjct  383  VRYSMRKDQLITALQGQLDHEGQQARLHSILAPVPFQQQISKLASRF--VGRKWLIAQLT  440

Query  337  EWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVL  396
            +W+DS        +  + G  GSGK+ L   L     + + A H    + +   + R  +
Sbjct  441  KWIDSP---TASQMFWVTGQIGSGKTALAARLVQTIPE-IKAFHFAFEEDEQTQNARRCV  496

Query  397  LSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPL---CALEEPLTA  449
            LSL  QL + L   K+  A L  +  LEE  P+     L   +L+ PL     L+   T 
Sbjct  497  LSLAYQLTTQL---KDYAAFLQAREPLEELVPVSTFNELVTHLLIKPLNEIAQLQSQNTP  553

Query  450  KVFVFDGIDQCKSKGRND----------------LLDFLAVIIPELPTWVGVFITSKPSP  493
             V + DG++   S G++D                L+  L  ++ +LP WV V + S+  P
Sbjct  554  LVLLIDGLENL-SDGKSDVSSLPVMTSRQSFAQCLVSALPSLVSQLPKWVRVIVLSRNDP  612

Query  494  ELPAKL-------AITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAR-EILKRKS  545
             + AKL        + + +  + ++     +  +  +   G  S K +P  + +++  +S
Sbjct  613  AINAKLQNFTPNIVLEAYVKENKEDIKQFIEKSLCSSASTGLSSGKTLPPDQIDLIVERS  672

Query  546  GGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKK  605
             G F +     Q+L      E+  +    V   LP  +     + F   FG  + +  + 
Sbjct  673  EGLFLYAANVVQSL------EEKWFA---VGQSLPIGMNGYLYDFFVSHFGAKQYK--RL  721

Query  606  VQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVN-HGTYRIETSA  664
            ++P+LE ++ AA  P +L T         L   + + I  AF  ++++   G+ R   S+
Sbjct  722  IRPVLE-VLCAAFEPLSLPT---IASILKLQTNEQQEIATAFGSLLSIGADGSVRPFHSS  777

Query  665  LFEWLVDPQRAGEQFYVDVSGGMNLL  690
            +  W+ + Q   + FYVDV+ G  L+
Sbjct  778  VLNWVQELQSV-DPFYVDVATGHELI  802

>PYIR_14107
Length=1176

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 89/421 (21%), Positives = 175/421 (42%), Gaps = 78/421 (19%)

Query  326  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  385
            + REW   + + W+ S     V     + G  GSGK+ L   +     + + A H  + +
Sbjct  548  AGREWLFMQLENWIASPTATQV---FWVTGQIGSGKTALAARMVQVIPE-IAAFHFALQE  603

Query  386  RKSKSSPRNVLLSLVNQLISNLPLFKNQL-ARLNLKYVLEETDPLVLARKVLVDPLCALE  444
             +   + R  +LSL  QL + LP +   L +R  L+ ++  ++   L  ++LV+PL  + 
Sbjct  604  DEQTQNARRCVLSLAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIA  663

Query  445  EPLTAK--VFVFDGI--------------------------------DQCKSKGRND--L  468
             P + K  V + DG+                                D C S    D  L
Sbjct  664  RPQSTKPLVLLIDGLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECL  723

Query  469  LDFLAVIIPELPTWVGVFITSKPSPELPAKL-AITSLLDFSAKNTNYMNDTIILINDIIG  527
            +  L  ++  LP WV V + S+  P + AKL   T  +   +  +    D    + +++G
Sbjct  724  VSALPSLVARLPNWVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQQDIKRYVENMLG  783

Query  528  N---------------------FSDKDVPQAREILKRKSGGNFTFLDFTKQALSHPGMEE  566
                                  FS+K  P+  +++ ++S G F +     Q++     EE
Sbjct  784  ESPATTLRRGIYGSASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSI-----EE  838

Query  567  DNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLLELIVTAASGPYALITE  626
                + +D L  LP  +   + + F+  F + + +    ++P+LE ++ A+  P++L   
Sbjct  839  KR--LAVDQLESLPIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLE-VLCASFEPFSLWN-  892

Query  627  NQAQEQFSLSKEDIRTIRRAFVDIIAVN-HGTYRIETSALFEWLVDPQRAGEQFYVDVSG  685
                   +    D + I  +F  ++++   G  R   S++ +W+ DP  AG +++V+++ 
Sbjct  893  --IVSILNWDVYDQQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAG-KYFVNIAN  949

Query  686  G  686
            G
Sbjct  950  G  950

>PYAP_22230
Length=1116

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 97/444 (22%), Positives = 173/444 (39%), Gaps = 96/444 (22%)

Query  326  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  385
            + R W +E  ++W+++    G   +  + G  GSGK+++   +  +    + A H  + D
Sbjct  494  TGRAWLLESIRQWINTPVTSG-SKVFWVTGQIGSGKTSVAARMV-QLMPEIAAFHFALQD  551

Query  386  RKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPL----VLARKVLVDPLC  441
                   R  +LSL  QL + LP +      L     LEE  P+     L   +LV+PL 
Sbjct  552  DDQTQLARRCVLSLAYQLTTQLPEYA---VFLQTGDPLEEIVPVSSVQALLTHLLVNPLN  608

Query  442  ALEEPLTAK--VFVFDGIDQ---------------------------------C-KSKGR  465
            A+  P + K  V + DG++                                  C +S G 
Sbjct  609  AIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGTGSTNSTTASLCDESSGS  668

Query  466  ND--LLDFLAVIIPELPTWVGVFITSKPSPELPAKLAITS---LLDFSAK----------  510
            +D  L+  L  +I  LP WV V + S+  P +  KL + +    LD   +          
Sbjct  669  SDECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSIALDRHERENEADIREFV  728

Query  511  ---------NTNYMNDTI------------ILINDIIGNFSDKDVPQAREILKRKSGGNF  549
                      +++++ T+            I    +  N   K   +  E++ ++S G F
Sbjct  729  EMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNTPRKISAEQVEVITKRSEGLF  788

Query  550  TFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPL  609
             +     QA+       + G + +D L  LP  +     + FE  F     +   K++P+
Sbjct  789  LYAANIVQAI-------EEGRLAVDQLETLPVGLGGYLRQFFESHFDDATYK--TKIRPV  839

Query  610  LELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTY-RIETSALFEW  668
            LE++  A    Y  +T       F  S  + + +  +F  ++ V+   Y R   S++ EW
Sbjct  840  LEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSALLFVSDDDYVRPFHSSVLEW  895

Query  669  LVDPQRAGEQFYVDVSGGMNLLRQ  692
            + D + AG  F  DV+ G   + Q
Sbjct  896  VQDFKTAG-AFLTDVALGHERIAQ  918

>SDRG_07983
Length=991

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 90/381 (24%), Positives = 153/381 (40%), Gaps = 55/381 (14%)

Query  327  SREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDR  386
            +REW + ++  WV +        +  + G  GSGKS +   +       + A HL   + 
Sbjct  441  AREWVLAKYDAWVQTP---NGSRIFVMSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  496

Query  387  KSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLCA  442
                S R  +LSLV QL + LP + N    +N +  LEE  P+     L   +L+ PL A
Sbjct  497  DQTQSARRCVLSLVYQLSTQLPEYANV---INSQEPLEEIVPVKSLVDLIHALLIAPLSA  553

Query  443  LEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPEL---PTWVGVFITSKPSPEL----  495
            +  P +  V + DGID C   G      F+A +   +   P+WV     ++  P +    
Sbjct  554  IAHPASILVLLIDGID-CFEPG------FVATLTAHMDLWPSWVRFVFGTREDPSVLQTL  606

Query  496  -----PAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFT  550
                 PA     SL D       Y++   + +   + + S     +  + +  +S G F 
Sbjct  607  QAYMPPAVSLDPSLPDSKLDIKAYLH---LALTPQLTSESQSKRNEIVDFIAARSEGLFL  663

Query  551  FLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQPLL  610
            +      A++        G + L+ L   P S+    +  F+ +F        K ++P+L
Sbjct  664  YARHLVNAIA-------VGQLQLNQLDAFPTSMGGCLQHCFDAQF-PSIEYYKKTIRPVL  715

Query  611  ELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFV-----DIIAVNHGTYRIETSAL  665
            E ++ AA+ P  L             ++DI     +       DII   H       S++
Sbjct  716  E-VLCAANEPLPLSMFRSILALAVYEQQDILAWFGSLFYITDSDIIKPFH-------SSV  767

Query  666  FEWLVDPQRAGEQFYVDVSGG  686
             +WL D + AG  ++VD   G
Sbjct  768  LDWLQDAKSAGP-YFVDAENG  787

>SPRG_19030
Length=1000

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 87/378 (23%), Positives = 156/378 (41%), Gaps = 49/378 (13%)

Query  327  SREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDR  386
            +REW + ++  WV +        +  + G  GSGKS +   +       + A HL   + 
Sbjct  449  AREWVLAKYDAWVQTPNG---SRIFVVSGVIGSGKSAIMAQIIQN-RPEIAAFHLASHEE  504

Query  387  KSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV----LARKVLVDPLCA  442
                S R  +LSLV QL + LP + N    LN +  LEE  P+     L   +L+ PL A
Sbjct  505  DQTQSARRCVLSLVYQLSTQLPEYANV---LNSQEPLEEIVPVKSLVDLIHALLIAPLSA  561

Query  443  LEEPLTAKVFVFDGIDQCKSKGRNDLLDFLAVIIPEL---PTWVGVFITSKPSPEL----  495
            +  P +  V + DGI+ C   G      F+A +   +   P+WV     ++  P +    
Sbjct  562  IAHPASILVLLIDGIE-CFEPG------FVATLTAHMDLWPSWVRFVFGTREDPSVLQTL  614

Query  496  -----PAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILKRKSGGNFT  550
                 PA     SL +       Y++   + +   +   S     +  + +  ++ G F 
Sbjct  615  QAYMPPAVSLDPSLYESKLDIKAYLH---LALTPQLTTESQGKRNEIVDFIAARAEGLFL  671

Query  551  FLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGK-GRSRIWKKVQPL  609
            +      A++        G + L+ L   P S+    +  F+ +F   G  +  K ++P+
Sbjct  672  YARHLVNAIA-------VGQLQLNELDAFPTSMGGCLQHCFDAQFPSIGYYK--KTIRPV  722

Query  610  LELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAV-NHGTYRIETSALFEW  668
            LE ++ AA+ P  L   +  +   SL   +   I   F  +  + +    +   S++ +W
Sbjct  723  LE-VLCAANEPLPL---SMFRSILSLDVYEQHDILAWFGSLFYITDSDIIKPFHSSVLDW  778

Query  669  LVDPQRAGEQFYVDVSGG  686
            L D + AG  ++VD   G
Sbjct  779  LQDAKSAGP-YFVDAENG  795

>PYIW_15717
Length=1121

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 96/444 (22%), Positives = 176/444 (40%), Gaps = 104/444 (23%)

Query  326  SSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFD  385
            + REW   + + W+ S        +  + G  GSGK+ L   +  +    + A H  + +
Sbjct  523  AGREWLFAQLESWIASP---SAAQVFWVTGQIGSGKTALAARMV-QLIPEIAAFHFALQE  578

Query  386  RKSKSSPRNVLLSLVNQLISNLPLFKNQL-ARLNLKYVLEETDPLVLARKVLVDPLCALE  444
             +   + R  +LSL  QL + LP + + L +R  L+ ++  ++   L  ++LV+PL  + 
Sbjct  579  DEQTQNARRCVLSLAYQLTTQLPQYASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIA  638

Query  445  EPLTAK---VFVFDGIDQC--------------------KSKGRN------------DLL  469
             P TA    V + DG++                      +S G N             L+
Sbjct  639  RPQTATKPLVLLIDGLEHLVSDKNAQLMATSPMGRPSFGRSSGSNFANHGQSLSNDECLV  698

Query  470  DFLAVIIPELPTWVGVFITSKPSPELPAKLAITS---LLD-FSAKNTNYMNDTIILINDI  525
              L  ++  LP WV V + S+  P + AKL   +   +LD F  +N     D    +  I
Sbjct  699  SALPSLVARLPKWVRVVLLSRKDPAIIAKLQGHTPNVVLDRFEREN---QQDIKSYVEKI  755

Query  526  IGNFSDKDV------------------------------------------PQAREILKR  543
            +G  S + V                                          P+   ++ +
Sbjct  756  LGEPSPQQVGVYGSPGQPPAPMLMPRNRSPSISTLPGSNAISAGVQTSKLSPEQVNLIVK  815

Query  544  KSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIW  603
            +S G F +     Q++     EE    +P+  L  LP  +   + + F+  F + + +  
Sbjct  816  RSEGLFLYAVNIVQSI-----EERR--LPVSQLESLPIGMGGYFRQFFDSHFDEQQYK--  866

Query  604  KKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVN-HGTYRIET  662
              ++P+LE ++ A+  P++L T        S S  D + I  +F  ++ V   G  R   
Sbjct  867  DSIRPVLE-VLCASFEPFSLAT---IASILSWSVYDQQEIAASFGSLLFVGADGNIRPFH  922

Query  663  SALFEWLVDPQRAGEQFYVDVSGG  686
            S++ +W+ D   AGE ++ DV+ G
Sbjct  923  SSVLDWVQDLATAGE-YFADVANG  945

>PYVX_21513
Length=1446

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 56/237 (24%), Positives = 99/237 (42%), Gaps = 31/237 (13%)

Query  277  VRASSRLTQLAPVADDALSTPLLQHQIDEMFPLVE-CSTELQAFAQNYDPSSREWAIERF  335
            VR ++R  QLA      L     + Q   +F L+   S + Q     Y  + R+W  +R 
Sbjct  389  VRYAARKDQLATALRGQLDH---EGQQARLFSLLSPFSFQQQISKLTYRFTGRDWLFKRV  445

Query  336  QEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNV  395
            Q+W++   +     +  + G  GSGK+++   +   F + + A H  + +       R  
Sbjct  446  QQWINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPE-IAAFHFALQEDDQTHIARRC  504

Query  396  LLSLVNQLISNLPLFKNQLARLNLKYVLEETDPL----VLARKVLVDPLCALEEPLTAKV  451
            +LSL  QL + LP +      L  +  LEE  P+     L   +LV+PL  ++ P    +
Sbjct  505  VLSLAYQLTTQLPEYG---VFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLI  561

Query  452  FVFDGIDQCKSKGR------------------NDLLDFLAVIIPELPTWVGVFITSK  490
             + DG+ +C   G                     L+  L  ++  LP+WV + + S+
Sbjct  562  LLIDGL-ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSR  617

>PYAR_14788
Length=795

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 81/380 (21%), Positives = 149/380 (39%), Gaps = 65/380 (17%)

Query  353  LVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKN  412
            + G  G+GK+++   +     + + A H  + +       R  +LSL  QL + LP +  
Sbjct  421  VTGQIGAGKTSVAAKMVQTIPE-IAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYA-  478

Query  413  QLARLNLKYVLEETDPLV----LARKVLVDPLCALEEPLTAK--VFVFDGIDQCKSK--G  464
                L     LEE  P+     L   +L+ PL A+  P + K  + + DG++   S   G
Sbjct  479  --VFLQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGG  536

Query  465  RNDLLDFLAVIIPELPTWVGVFITSKPSPELPAKLA------------------ITSLLD  506
                +  L  +I  LP+WV V + S+    +  KL                   I   ++
Sbjct  537  AGGGVSLLPSLIARLPSWVRVILLSREDHTIVMKLQDYSPSVSLDRREQENEEDIRGFVE  596

Query  507  FSAKNTNYMNDTIILIN-------DIIGNFSDKDVPQAR------------EILKRKSGG  547
             +  + ++   +    +        I  +F++   P A             E++ ++S G
Sbjct  597  AALCSPSHSKHSATAGSTQRHRSPSITSSFAES-APAASSPSVCKISSEQVELITKRSEG  655

Query  548  NFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESiyeiyeeiFEDKFGKGRSRIWKKVQ  607
             F +     Q++       + G + +D L  LP  +     + FE  F     +   K++
Sbjct  656  LFLYAVNIVQSI-------EEGRLSVDQLASLPLGLGGYLRQFFESHFDDTTYK--TKIR  706

Query  608  PLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAV-NHGTYRIETSALF  666
            P+LE++  A    Y  +T       F  S  D   +  +F  +  + + G  R   S++ 
Sbjct  707  PVLEVLCAA----YEPMTTAMLASIFHWSTYDQHEMTTSFSALFCISDDGYMRPFHSSVL  762

Query  667  EWLVDPQRAGEQFYVDVSGG  686
            EW+ D + AG  F  DV+ G
Sbjct  763  EWVQDIKTAG-LFLADVALG  781

>PYU1_G001856
Length=1987

 Score = 38.1 bits (87),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 62/134 (46%), Gaps = 19/134 (14%)

Query  332  IERFQEWVDSRFNVGVDNLLALV---GDGGSG-----KSTLTGALCDKFHDNV---VAMH  380
            I+ F EW  +      D  L+     G+G SG     KS L G LC + H ++   V   
Sbjct  245  IDFFNEWPSTALQYVADRFLSQAPQHGNGSSGFGFPTKSAL-GLLCVEIHQSIGYEVVEF  303

Query  381  LCVFDRKSKSSPRNV--LLSLVNQLI-SNLPLFKNQLARLNLKYV-LEETDPLVLARKVL  436
               + RK   +P++   L++L  +L+  N  L + +L RL    + LEET+ LV     L
Sbjct  304  FAKYKRKVYITPQHFLDLIALFGKLLRENRGLLEAKLQRLTTGVIKLEETNALV---NTL  360

Query  437  VDPLCALEEPLTAK  450
             D L AL+  L  K
Sbjct  361  QDELVALQPILVEK  374

>PYVX_14828
Length=565

 Score = 36.6 bits (83),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (48%), Gaps = 14/107 (13%)

Query  459  QCKSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMN  516
            Q ++   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  355  QYRNYAPDDLVDLMAKLLALVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  411

Query  517  DTIILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
            D  ++ ND+      I    D+ VP   E+++R    SGG  TFL +
Sbjct  412  DLGLVCNDVRTREVGIKGIHDQQVPDQVELVRRDYVASGGWETFLSY  458

>PHALS_07874
Length=541

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/105 (26%), Positives = 50/105 (48%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I N  D+ VP   E+++R    +GG  TFL +
Sbjct  390  GLVCNDVRTREVGIKNIHDQSVPDQVELVRRDYVANGGWETFLSY  434

>PYIR_18103
Length=542

 Score = 35.4 bits (80),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 52/107 (49%), Gaps = 14/107 (13%)

Query  459  QCKSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMN  516
            Q K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  332  QYKNYSPDDLVDLMAKLLAMVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  388

Query  517  DTIILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
            D  ++ ND+      I +  D+ VP   E+++R    +GG  TFL +
Sbjct  389  DLGLVCNDVRTREVGIKSIHDQTVPDQVELVRRDYVANGGWETFLSY  435

>H257_02565
Length=1005

 Score = 35.4 bits (80),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query  323  YDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFH--DNVVAMH  380
            YDP+S  W ++     V++ F +G  + + +VG  G GKSTL G L   +   D V+A+ 
Sbjct  683  YDPTSDVWNLQD----VNATFPIG--HYVCIVGPSGCGKSTLLGCLMQFYEPSDGVIAVD  736

Query  381  LCVFDRKSKSS  391
                   SKSS
Sbjct  737  DHNLHAYSKSS  747

>PYIW_21597
Length=1048

 Score = 35.0 bits (79),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 73/172 (42%), Gaps = 21/172 (12%)

Query  215  LVTALESKGVRSLDASGAAVGAEAQPELSSDELDTISRTTALYTSKATKERRATREDSAP  274
            ++ A+ S G +  +A+   V A+ +P LS  EL ++ R       K++K+  A  ED   
Sbjct  1    MLPAMHSLGRKPTNAT-IDVAADLKPSLSRKELRSLKRGD----KKSSKKAPAADEDKEN  55

Query  275  VLVRASSRLTQL-APVADDALSTPLLQHQIDEMFPLVECSTELQAFAQ-NYDPSSREWAI  332
            V+  A   L+   A  A D+ S    + +     P++  +++   F    +D   +   +
Sbjct  56   VVGMADLALSDAHATAASDSGSLAKKEREGGGGEPIIFATSQQSRFHTVTFDEFGKNVLL  115

Query  333  ERFQEWV--------------DSRFNVGVDNLLALVGDGGSGKSTLTGALCD  370
             +F  W+              D++  +       LVG  G GKSTL  AL D
Sbjct  116  NQFTLWIAPPAGNVQAVELLRDTQLKLNYGTNYGLVGPNGIGKSTLLQALAD  167

>PYAR_23233
Length=542

 Score = 34.7 bits (78),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (49%), Gaps = 14/107 (13%)

Query  459  QCKSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMN  516
            Q K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M 
Sbjct  332  QYKNYSPDDLVDLMARLLAIVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MK  388

Query  517  DTIILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
            D  ++ ND+      I +  D+ +P   E+++R    +GG  TFL +
Sbjct  389  DLGLVCNDVRTREVGIKSIHDQTIPDQVELVRRDYVANGGWETFLSY  435

>PPTG_10263
Length=541

 Score = 34.3 bits (77),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 48/105 (46%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  519  IILINDI------IGNFSDKDVPQAREILKRKSGGNF---TFLDF  554
             ++ ND+      I    D+ VP   E+++R  G N    TFL +
Sbjct  390  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYGANGGWETFLSY  434

>PYU1_G001876
Length=539

 Score = 34.3 bits (77),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 51/105 (49%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  331  KNYSPDDLVDLMAKLLAMVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MKDL  387

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I +  D+ VP   E+++R    +GG  TFL +
Sbjct  388  GLVCNDVRTREVGIKSIHDQTVPDQVELVRRDYVANGGWETFLSY  432

>H257_07547
Length=944

 Score = 34.3 bits (77),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (6%)

Query  310  VECSTELQA--FAQNYDPSSREWAIERFQEWV--DSRFNVGVDNLLALVGDGGSGKSTLT  365
            +E + ++Q   F+ N DPS R+ A E        D    +  + L  +VG  GSGKS+L 
Sbjct  457  IEATVQMQHANFSWNIDPSGRQEASENEGPMTLKDISLTIAPNTLTIVVGPVGSGKSSLI  516

Query  366  GALCDKFHD  374
             AL  + H 
Sbjct  517  SALLGEIHQ  525

>PHYKE_2649
Length=559

 Score = 33.9 bits (76),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 3/82 (4%)

Query  340  DSRFNVGVDNLLALVGDGGSGKSTLTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSL  399
            D  F V     +A+VG  GSGK+T T  L  +F+D VV+  +C+  +   S  +  L   
Sbjct  334  DVSFTVPTGKTVAIVGSTGSGKTT-TSRLLFRFYD-VVSGKICINGQDITSVRQKSLRQC  391

Query  400  VNQLISNLPLFKNQLARLNLKY  421
            +  +  +  +F + + R NL Y
Sbjct  392  IGIVPQDTVMFNDSI-RYNLTY  412

>PHYSO_321022
Length=540

 Score = 33.9 bits (76),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  332  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  388

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  389  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  433

>PHYCA_532676
Length=1662

 Score = 33.9 bits (76),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 38/77 (49%), Gaps = 6/77 (8%)

Query  350  LLALVGDGGSGKSTLTGALCDKF--HDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNL  407
            L  ++G  GSGKS+L   L  +F    NV       ++  S+   R+ L     QL+S +
Sbjct  324  LTLVLGQPGSGKSSLMKILSGRFPASKNVTVEGEVTYNGTSQEELRSKL----PQLVSYV  379

Query  408  PLFKNQLARLNLKYVLE  424
            P     LARL++K  LE
Sbjct  380  PQHDKHLARLSVKETLE  396

>PHYCA_572705
Length=543

 Score = 33.5 bits (75),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  335  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  391

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  392  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  436

>PITG_01099
Length=541

 Score = 33.5 bits (75),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  333  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  389

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  390  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLSY  434

>PYVX_24762
Length=257

 Score = 33.1 bits (74),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 7/64 (11%)

Query  312  CSTELQAFAQNYD-PSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKSTLTGALCD  370
            C+ +++A   N+  PS  E  I R     D   N+     +A  G  G GKSTL G L +
Sbjct  18   CAGKIEAINVNFTYPSRPEAPILR-----DYNVNIESGQTVAFAGASGGGKSTLIG-LLE  71

Query  371  KFHD  374
            +F+D
Sbjct  72   RFYD  75

>SPRG_17722
Length=124

 Score = 31.6 bits (70),  Expect = 6.2, Method: Composition-based stats.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)

Query  309  LVECSTELQAFAQNYDPSSREW  330
            +V CS +  AF  NY+PS R+W
Sbjct  70   IVSCSHDRSAFVWNYNPSERKW  91

>SDRG_09955
Length=4064

 Score = 33.5 bits (75),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (46%), Gaps = 19/162 (12%)

Query  314   TELQAFAQNYDPSSREWAIERFQE-WVDSRFNVGVDNLLALVGDGGSGKSTLTGALCDKF  372
             T + ++  +  PS R   + R+Q+  VD+     V+ L A++G+GG  +   T A+ D  
Sbjct  2938  TAISSYIGDVPPSDRTELVTRWQQVLVDAGVIFSVNLLAAMMGEGGLQELRATCAIADAG  2997

Query  373   HDNVVAMHLCVFDRKSKSSPR--NVLLSLVNQLISNLPLFKNQLARLNLKYVLEETDPLV  430
                 +AM+L    R  K +P+  + LL   + + +N   +   + RL+++ V  + DP++
Sbjct  2998  ----IAMNLFYLQRW-KEAPKLQHFLLIDPHGIAAN---WIKTVERLSVEAVSAD-DPML  3048

Query  431   LARKVLVDPLCALEEPLTAKVFVFDGIDQCKSKGRNDLLDFL  472
             LAR         +  P    + V D + QC        L  L
Sbjct  3049  LAR-------FEMSPPNPNYILVVDRVAQCNEGSLWAFLQLL  3083

>PYAP_20633
Length=539

 Score = 33.1 bits (74),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 25/105 (24%), Positives = 51/105 (49%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+   +DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  331  KNYSPDDLVDLMARLLAIVPPWTRVYRIQRDIPMPLVTSGVEHGNLRELALAR---MKDL  387

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I +  D+ +P   E+++R    +GG  TFL +
Sbjct  388  GLVCNDVRTREVGIKSIHDQTIPDHVELVRRDYVANGGWETFLSY  432

>PHYCA_504053
Length=629

 Score = 33.1 bits (74),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query  620  PYALITENQAQEQFSLSKEDIRTIRR--AFVDIIAVNHGTYRIETSALFEWLVDPQ  673
            P  LIT ++ ++Q  ++ E +  +RR    V ++A+  G YR   S++  WL+D Q
Sbjct  8    PVPLITFSEDEDQLKVNDEAVELLRRIDGHVAVVAM-AGLYRTGKSSMLNWLLDRQ  62

>PHYKE_4131
Length=543

 Score = 33.1 bits (74),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 26/105 (25%), Positives = 49/105 (47%), Gaps = 14/105 (13%)

Query  461  KSKGRNDLLDFLAVIIPELPTWVGVFITSK--PSPELPAKLAITSLLDFSAKNTNYMNDT  518
            K+    DL+D +A ++  +P W  V+   +  P P + + +   +L + +      M D 
Sbjct  335  KNYSPEDLVDLMARLLALVPPWTRVYRVQRDIPMPLVTSGVEHGNLRELALAR---MRDL  391

Query  519  IILINDI------IGNFSDKDVPQAREILKR---KSGGNFTFLDF  554
             ++ ND+      I    D+ VP   E+++R    +GG  TFL +
Sbjct  392  GLVCNDVRTREVGIKGIHDQSVPDQVELVRRDYVANGGWETFLAY  436

>PYVX_20285
Length=62

 Score = 30.0 bits (66),  Expect = 8.1, Method: Composition-based stats.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)

Query  353  LVGDGGSGKSTLTGALC  369
            +VGD G GK+TL GALC
Sbjct  10   VVGDSGVGKTTLLGALC  26

>PITG_14818
Length=629

 Score = 33.1 bits (74),  Expect = 8.5, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query  620  PYALITENQAQEQFSLSKEDIRTIRR--AFVDIIAVNHGTYRIETSALFEWLVDPQ  673
            P  LIT ++ ++Q  ++ E +  +RR    V ++A+  G YR   S++  WL+D Q
Sbjct  8    PVPLITFSEDEDQLKVNDEAVELLRRIDGHVAVVAMA-GLYRTGKSSMLNWLLDRQ  62

>PPTG_15793
Length=638

 Score = 32.7 bits (73),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query  620  PYALITENQAQEQFSLSKEDIRTIRR--AFVDIIAVNHGTYRIETSALFEWLVDPQ  673
            P  LIT ++ ++Q  ++ E +  +RR    V ++A+  G YR   S++  WL+D Q
Sbjct  16   PVPLITFSEDEDQLKVNDEAVELLRRIDGHVAVVAMA-GLYRTGKSSMLNWLLDRQ  70

Lambda      K        H        a         alpha
   0.318    0.134    0.380    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 60068934432

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40