Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_24096932032272279844e-136
PYAP_22273932032681637639e-102
PYU1_G001742932042131624922e-61
PYIR_25089854042621634953e-61
PHYSO_341599109791851634866e-61
PPTG_10635528561991634851e-60
PHYCA_14369109792481634892e-60
PYU1_G001740147522061624852e-60
PPTG_10636109792461634882e-60
PPTG_17122147522041634842e-60
PYIR_26546866052391634854e-60
PHYSO_536424606911971634807e-60
PHYSO_507031586531971634807e-60
PYU1_G001741854041991624763e-59
PYAP_22278932042891664826e-59
PHYKE_3446231281991634721e-58
PHYRA_84190720132061634722e-58
PHYCA_129425147522041634712e-58
PPTG_15264231281941654685e-58
PPTG_17366239131941654685e-58
PHYSO_284086147522041634677e-58
PHYKE_8389147522041634677e-58
PPTG_10634720132081624661e-57
PYVX_18173449665001634872e-57
PYU1_G001744568762131624652e-57
PHYCA_102550457052681634692e-57
PHYRA_85631109792281634644e-57
PHYCA_102852242061951634615e-57
PYAP_22279854042231654628e-57
PITG_18450147522031634601e-56
PHYRA_81106147522021634591e-56
PYU1_G001739932032661634632e-56
PHYCA_102624720131951634572e-56
PYIR_26626147522121634592e-56
PPTG_10643457052501654612e-56
PHYRA_82864231281931634554e-56
PYIW_18791854041941644537e-56
PHYKE_7718109792201634567e-56
PHYKE_8388568762051634512e-55
PHALS_00498109791991634502e-55
PHYSO_477820568762021634451e-54
PPTG_10048213141901634381e-53
PHYRA_81107568762021634382e-53
PPTG_17121568762021634347e-53
PHYCA_511409568762041634303e-52
PHYKE_9185445762811674261e-50
PPTG_14255469372681674251e-50
PYVX_18174854042041664191e-50
PHYCA_510817445761881674172e-50
PHALS_03284309411881634153e-50
PHYSO_417649445761851674111e-49
PYU1_G001738534612261624123e-49
PHYSO_499978231281741414031e-48
PHYSO_501575820771741414031e-48
PPTG_14254445761881673999e-48
PYVX_18176568762011633948e-47
PHYSO_343376532371721313892e-46
PHYCA_53693413059831674142e-45
PPTG_0882086622501683857e-45
PHYSO_353401534611461403611e-42
PHYSO_254168462841701533631e-42
PITG_1049986623231543742e-42
PITG_13520109791711323595e-42
PHYSO_262732469371881673606e-42
PPTG_17123147532011623608e-42
PYIW_18788932032441643649e-42
PHYRA_81105534612011613563e-41
PHYCA_537323449662001393563e-41
PITG_18452147538561623721e-39
PHYSO_527908600641741503362e-38
PYAP_18131991722261143323e-37
HYAP_07096534612511623134e-34
PHYSO_341596528562311143098e-34
PHYCA_14368528562191632992e-32
PHYSO_340369526762001672931e-31
PHYSO_342364529831941382824e-30
PYU1_G007476539131951702754e-29
PYU1_G005323943552511352761e-28
PHYSO_246676457051871632675e-28
PYIW_27477823991801272658e-28
PYIR_1643542333041292712e-27
PYU1_G005324845341911342605e-27
PYU1_G005326463491911342605e-27
PYU1_G00532842331911342605e-27
PYU1_G005325943562071342617e-27
PYAP_18709943552351682611e-26
PYIW_18792932041251002512e-26
PYIW_19151831912481392593e-26
PYIR_1644442341821332544e-26
PYAP_246891014392521332542e-25
PYIR_16443823992751312543e-25
PHYSO_533903604652081392493e-25
PYAP_18711943562101342485e-25
PYAR_14260845342121332452e-24
PHYCA_12942213313531012513e-24
PYU1_G01469042342951332458e-24
PYAR_14256943551991332363e-23
PITG_1193697753331772433e-23
PYIR_23585845342401642366e-23
PHYCA_13036542352661362378e-23
PYAP_1871342341841312319e-23
PHYSO_48395542353201362391e-22
PHYRA_78176597733121772353e-22
PHYCA_12727044782791362316e-22
PITG_0527144782781362316e-22
PPTG_0461842353261362329e-22
PITG_0494942353371362311e-21
PHYKE_600144782891382292e-21
PHYKE_6077188563221772302e-21
PHYCA_534296526713091332292e-21
PPTG_03138188562941352282e-21
PHYSO_533747604512061372233e-21
PHALS_0317644782071382233e-21
CCI4738117292111492233e-21
PYAR_206171040482541672253e-21
PYIR_19612831912601402253e-21
PHYKE_10578778802391072244e-21
PYU1_G00151997822651382254e-21
PHYSO_34033244782951362264e-21
PYIR_2213497753001802274e-21
PHALS_03177526712591382254e-21
PHYSO_340333526712841362255e-21
PHYRA_7868968382961362265e-21
PHYSO_438103557212381792227e-21
PHYRA_73607194343431382268e-21
PYVX_2250897752981352241e-20
PHYKE_2809752822911282231e-20
CCA1717917291851492152e-20
PHYRA_7358242353261342222e-20
PHYCA_98479819502761102202e-20
PHYRA_78175764333191802223e-20
PITG_0494842342321322173e-20
PPTG_1422144782751382193e-20
PHYRA_7914038074241062243e-20
PHYSO_533682604462781332194e-20
PHYSO_459106194342231292155e-20
PHYCA_1961197755311812245e-20
PHYCA_69583463492241042147e-20
PHYRA_74651699693441342207e-20
PHALS_0539242353671342208e-20
PYVX_14662510865401552238e-20
PHYRA_7358442332871392178e-20
PPTG_04622696962731432168e-20
PHYKE_6076764332722072169e-20
PHYSO_524101597733081352179e-20
PHYRA_78174188562791352161e-19
PYIW_2196497752651802151e-19
H310_0636217301971292101e-19
PHYRA_7817797753241352162e-19
PHYRA_83494464352241062122e-19
PHYCA_19612188566101352202e-19
PHYRA_83500718143941062182e-19
PHYSO_48552442342781552142e-19
PPTG_0461942342761322133e-19
PHYSO_24648197753181352143e-19
PHYKE_6079597733021352133e-19
PHYRA_78161375713731352153e-19
PHYRA_78169188573901352154e-19
PYU1_G00152797792781552114e-19
PYU1_G00152397762781552114e-19
PYU1_G00586817292671342115e-19
PHYKE_2937571983661382145e-19
PHYKE_391342343211672135e-19
SDRG_075651244122781702115e-19
H257_1355017302661722105e-19
PHALS_0539442342881632116e-19
PHALS_03179308833721332146e-19
PPTG_0313997753201782126e-19
SDRG_081291363312181692077e-19
PPTG_0462042333421362128e-19
PYIW_2557397812791742098e-19
PPTG_04803375052681522091e-18
PPTG_0316097913791362121e-18
PPTG_04647194343271372101e-18
PHYRA_86016727462361052061e-18
PHYKE_607897753171352101e-18
PPTG_0750738072991062091e-18
PYAP_18221944962261392051e-18
PPTG_07509718142991062091e-18
PHYRA_85794726192301532051e-18
PYVX_2251097785961352131e-18
PHYRA_77971705552301532052e-18
PYIR_24421899032131332042e-18
SDRG_154261258855231692122e-18
PITG_0494742332981332082e-18
PHYCA_534473423310501362122e-18
PHYRA_73606571983661382092e-18
PYIR_24743851643571352092e-18
PYVX_19277793613311772083e-18
PPTG_03143188573681352093e-18
PHYCA_19598375713901342093e-18
SPRG_19916161733051692073e-18
PPTG_07521450302811102063e-18
PHYRA_86752732363001062064e-18
PYU1_G00152697803341242074e-18
PYIW_187905687686791924e-18
PYU1_G007364851643161332065e-18
PHYCA_531163194343141372055e-18
PHALS_02044930992371412017e-18
SPRG_077971259813181342047e-18
SDRG_165341259793201462047e-18
PHYSO_25505646349269982011e-17
PHYRA_7358342346301452071e-17
PPTG_03153597733141342031e-17
PHYSO_488921574612961372021e-17
PHYRA_86241728921951001971e-17
SPRG_077991259833451362031e-17
PHYKE_6002526711971291971e-17
PYIW_1552617302561392001e-17
PHALS_10635341192961352011e-17
PHYSO_329293510323101372021e-17
PYIR_2533497822721392001e-17
SDRG_081371363342821492002e-17
PYAR_2411397811921721952e-17
SPRG_077951259793351462012e-17
PHYCA_12943369712871061992e-17
PHYSO_525076188573661352013e-17
PHALS_04411944962621341974e-17
PHYCA_97965401872881061984e-17
PYIR_26867868821631271915e-17
PHYKE_2454751493741331996e-17
PYU1_G001514188574691252006e-17
PHYCA_12331697763161341977e-17
SPRG_2216117303001691967e-17
PHYSO_37402597823001261968e-17
PHYRA_77290574613091771968e-17
PHYRA_7816797822841261968e-17
PPTG_04617696934961041999e-17
PHYCA_14560574613001881969e-17
PYAP_222571003612471321931e-16
PYIR_2048317302871571951e-16
PYIW_168101650732161381911e-16
PYU1_G00151697753041801951e-16
PHYRA_9365046349231931921e-16
SDRG_009481259833521361961e-16
PYIR_2048117292771311941e-16
PYIW_242891643031961401891e-16
PPTG_0315697874451341972e-16
PYU1_G005872161732971411942e-16
PYU1_G005871944962841411932e-16
PHYSO_31868397763521361952e-16
PHYKE_574938073001051942e-16
PHYSO_484051571982851301932e-16
PYAP_236721009052571031922e-16
PHYRA_83499204334731051962e-16
PYU1_G005985820772001421892e-16
PHYCA_103479510323141831942e-16
PPTG_07516464352941061932e-16
PHYKE_1029517292921341932e-16
PHYSO_37451853913116981832e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_24096

Length=227
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR_24096                                                            383        4e-136
PYAP_22273                                                            298        9e-102
PYU1_G001742                                                          194        2e-61 
PYIR_25089                                                            195        3e-61 
PHYSO_341599                                                          191        6e-61 
PPTG_10635                                                            191        1e-60 
PHYCA_14369                                                           192        2e-60 
PYU1_G001740                                                          191        2e-60 
PPTG_10636                                                            192        2e-60 
PPTG_17122                                                            191        2e-60 
PYIR_26546                                                            191        4e-60 
PHYSO_536424                                                          189        7e-60 
PHYSO_507031                                                          189        7e-60 
PYU1_G001741                                                          187        3e-59 
PYAP_22278                                                            190        6e-59 
PHYKE_3446                                                            186        1e-58 
PHYRA_84190                                                           186        2e-58 
PHYCA_129425                                                          186        2e-58 
PPTG_15264                                                            184        5e-58 
PPTG_17366                                                            184        5e-58 
PHYSO_284086                                                          184        7e-58 
PHYKE_8389                                                            184        7e-58 
PPTG_10634                                                            184        1e-57 
PYVX_18173                                                            192        2e-57 
PYU1_G001744                                                          183        2e-57 
PHYCA_102550                                                          185        2e-57 
PHYRA_85631                                                           183        4e-57 
PHYCA_102852                                                          182        5e-57 
PYAP_22279                                                            182        8e-57 
PITG_18450                                                            181        1e-56 
PHYRA_81106                                                           181        1e-56 
PYU1_G001739                                                          182        2e-56 
PHYCA_102624                                                          180        2e-56 
PYIR_26626                                                            181        2e-56 
PPTG_10643                                                            182        2e-56 
PHYRA_82864                                                           179        4e-56 
PYIW_18791                                                            179        7e-56 
PHYKE_7718                                                            180        7e-56 
PHYKE_8388                                                            178        2e-55 
PHALS_00498                                                           177        2e-55 
PHYSO_477820                                                          176        1e-54 
PPTG_10048                                                            173        1e-53 
PHYRA_81107                                                           173        2e-53 
PPTG_17121                                                            171        7e-53 
PHYCA_511409                                                          170        3e-52 
PHYKE_9185                                                            168        1e-50 
PPTG_14255                                                            168        1e-50 
PYVX_18174                                                            166        1e-50 
PHYCA_510817                                                          165        2e-50 
PHALS_03284                                                           164        3e-50 
PHYSO_417649                                                          162        1e-49 
PYU1_G001738                                                          163        3e-49 
PHYSO_499978                                                          159        1e-48 
PHYSO_501575                                                          159        1e-48 
PPTG_14254                                                            158        9e-48 
PYVX_18176                                                            156        8e-47 
PHYSO_343376                                                          154        2e-46 
PHYCA_536934                                                          164        2e-45 
PPTG_08820                                                            152        7e-45 
PHYSO_353401                                                          143        1e-42 
PHYSO_254168                                                          144        1e-42 
PITG_10499                                                            148        2e-42 
PITG_13520                                                            142        5e-42 
PHYSO_262732                                                          143        6e-42 
PPTG_17123                                                            143        8e-42 
PYIW_18788                                                            144        9e-42 
PHYRA_81105                                                           141        3e-41 
PHYCA_537323                                                          141        3e-41 
PITG_18452                                                            147        1e-39 
PHYSO_527908                                                          134        2e-38 
PYAP_18131                                                            132        3e-37 
HYAP_07096                                                            125        4e-34 
PHYSO_341596                                                          123        8e-34 
PHYCA_14368                                                           119        2e-32 
PHYSO_340369                                                          117        1e-31 
PHYSO_342364                                                          113        4e-30 
PYU1_G007476                                                          110        4e-29 
PYU1_G005323                                                          110        1e-28 
PHYSO_246676                                                          107        5e-28 
PYIW_27477                                                            106        8e-28 
PYIR_16435                                                            108        2e-27 
PYU1_G005324                                                          104        5e-27 
PYU1_G005326                                                          104        5e-27 
PYU1_G005328                                                          104        5e-27 
PYU1_G005325                                                          105        7e-27 
PYAP_18709                                                            105        1e-26 
PYIW_18792                                                            101        2e-26 
PYIW_19151                                                            104        3e-26 
PYIR_16444                                                            102        4e-26 
PYAP_24689                                                            102        2e-25 
PYIR_16443                                                            102        3e-25 
PHYSO_533903                                                          100        3e-25 
PYAP_18711                                                            100        5e-25 
PYAR_14260                                                            99.0       2e-24 
PHYCA_12942                                                           101        3e-24 
PYU1_G014690                                                          99.0       8e-24 
PYAR_14256                                                            95.5       3e-23 
PITG_11936                                                            98.2       3e-23 
PYIR_23585                                                            95.5       6e-23 
PHYCA_130365                                                          95.9       8e-23 
PYAP_18713                                                            93.6       9e-23 
PHYSO_483955                                                          96.7       1e-22 
PHYRA_78176                                                           95.1       3e-22 
PHYCA_127270                                                          93.6       6e-22 
PITG_05271                                                            93.6       6e-22 
PPTG_04618                                                            94.0       9e-22 
PITG_04949                                                            93.6       1e-21 
PHYKE_6001                                                            92.8       2e-21 
PHYKE_6077                                                            93.2       2e-21 
PHYCA_534296                                                          92.8       2e-21 
PPTG_03138                                                            92.4       2e-21 
PHYSO_533747                                                          90.5       3e-21 
PHALS_03176                                                           90.5       3e-21 
CCI47381                                                              90.5       3e-21 
PYAR_20617                                                            91.3       3e-21 
PYIR_19612                                                            91.3       3e-21 
PHYKE_10578                                                           90.9       4e-21 
PYU1_G001519                                                          91.3       4e-21 
PHYSO_340332                                                          91.7       4e-21 
PYIR_22134                                                            92.0       4e-21 
PHALS_03177                                                           91.3       4e-21 
PHYSO_340333                                                          91.3       5e-21 
PHYRA_78689                                                           91.7       5e-21 
PHYSO_438103                                                          90.1       7e-21 
PHYRA_73607                                                           91.7       8e-21 
PYVX_22508                                                            90.9       1e-20 
PHYKE_2809                                                            90.5       1e-20 
CCA17179                                                              87.4       2e-20 
PHYRA_73582                                                           90.1       2e-20 
PHYCA_98479                                                           89.4       2e-20 
PHYRA_78175                                                           90.1       3e-20 
PITG_04948                                                            88.2       3e-20 
PPTG_14221                                                            89.0       3e-20 
PHYRA_79140                                                           90.9       3e-20 
PHYSO_533682                                                          89.0       4e-20 
PHYSO_459106                                                          87.4       5e-20 
PHYCA_19611                                                           90.9       5e-20 
PHYCA_69583                                                           87.0       7e-20 
PHYRA_74651                                                           89.4       7e-20 
PHALS_05392                                                           89.4       8e-20 
PYVX_14662                                                            90.5       8e-20 
PHYRA_73584                                                           88.2       8e-20 
PPTG_04622                                                            87.8       8e-20 
PHYKE_6076                                                            87.8       9e-20 
PHYSO_524101                                                          88.2       9e-20 
PHYRA_78174                                                           87.8       1e-19 
PYIW_21964                                                            87.4       1e-19 
H310_06362                                                            85.5       1e-19 
PHYRA_78177                                                           87.8       2e-19 
PHYRA_83494                                                           86.3       2e-19 
PHYCA_19612                                                           89.4       2e-19 
PHYRA_83500                                                           88.6       2e-19 
PHYSO_485524                                                          87.0       2e-19 
PPTG_04619                                                            86.7       3e-19 
PHYSO_246481                                                          87.0       3e-19 
PHYKE_6079                                                            86.7       3e-19 
PHYRA_78161                                                           87.4       3e-19 
PHYRA_78169                                                           87.4       4e-19 
PYU1_G001527                                                          85.9       4e-19 
PYU1_G001523                                                          85.9       4e-19 
PYU1_G005868                                                          85.9       5e-19 
PHYKE_2937                                                            87.0       5e-19 
PHYKE_3913                                                            86.7       5e-19 
SDRG_07565                                                            85.9       5e-19 
H257_13550                                                            85.5       5e-19 
PHALS_05394                                                           85.9       6e-19 
PHALS_03179                                                           87.0       6e-19 
PPTG_03139                                                            86.3       6e-19 
SDRG_08129                                                            84.3       7e-19 
PPTG_04620                                                            86.3       8e-19 
PYIW_25573                                                            85.1       8e-19 
PPTG_04803                                                            85.1       1e-18 
PPTG_03160                                                            86.3       1e-18 
PPTG_04647                                                            85.5       1e-18 
PHYRA_86016                                                           84.0       1e-18 
PHYKE_6078                                                            85.5       1e-18 
PPTG_07507                                                            85.1       1e-18 
PYAP_18221                                                            83.6       1e-18 
PPTG_07509                                                            85.1       1e-18 
PHYRA_85794                                                           83.6       1e-18 
PYVX_22510                                                            86.7       1e-18 
PHYRA_77971                                                           83.6       2e-18 
PYIR_24421                                                            83.2       2e-18 
SDRG_15426                                                            86.3       2e-18 
PITG_04947                                                            84.7       2e-18 
PHYCA_534473                                                          86.3       2e-18 
PHYRA_73606                                                           85.1       2e-18 
PYIR_24743                                                            85.1       2e-18 
PYVX_19277                                                            84.7       3e-18 
PPTG_03143                                                            85.1       3e-18 
PHYCA_19598                                                           85.1       3e-18 
SPRG_19916                                                            84.3       3e-18 
PPTG_07521                                                            84.0       3e-18 
PHYRA_86752                                                           84.0       4e-18 
PYU1_G001526                                                          84.3       4e-18 
PYIW_18790                                                            78.6       4e-18 
PYU1_G007364                                                          84.0       5e-18 
PHYCA_531163                                                          83.6       5e-18 
PHALS_02044                                                           82.0       7e-18 
SPRG_07797                                                            83.2       7e-18 
SDRG_16534                                                            83.2       7e-18 
PHYSO_255056                                                          82.0       1e-17 
PHYRA_73583                                                           84.3       1e-17 
PPTG_03153                                                            82.8       1e-17 
PHYSO_488921                                                          82.4       1e-17 
PHYRA_86241                                                           80.5       1e-17 
SPRG_07799                                                            82.8       1e-17 
PHYKE_6002                                                            80.5       1e-17 
PYIW_15526                                                            81.6       1e-17 
PHALS_10635                                                           82.0       1e-17 
PHYSO_329293                                                          82.4       1e-17 
PYIR_25334                                                            81.6       1e-17 
SDRG_08137                                                            81.6       2e-17 
PYAR_24113                                                            79.7       2e-17 
SPRG_07795                                                            82.0       2e-17 
PHYCA_12943                                                           81.3       2e-17 
PHYSO_525076                                                          82.0       3e-17 
PHALS_04411                                                           80.5       4e-17 
PHYCA_97965                                                           80.9       4e-17 
PYIR_26867                                                            78.2       5e-17 
PHYKE_2454                                                            81.3       6e-17 
PYU1_G001514                                                          81.6       6e-17 
PHYCA_123316                                                          80.5       7e-17 
SPRG_22161                                                            80.1       7e-17 
PHYSO_374025                                                          80.1       8e-17 
PHYRA_77290                                                           80.1       8e-17 
PHYRA_78167                                                           80.1       8e-17 
PPTG_04617                                                            81.3       9e-17 
PHYCA_14560                                                           80.1       9e-17 
PYAP_22257                                                            79.0       1e-16 
PYIR_20483                                                            79.7       1e-16 
PYIW_16810                                                            78.2       1e-16 
PYU1_G001516                                                          79.7       1e-16 
PHYRA_93650                                                           78.6       1e-16 
SDRG_00948                                                            80.1       1e-16 
PYIR_20481                                                            79.3       1e-16 
PYIW_24289                                                            77.4       1e-16 
PPTG_03156                                                            80.5       2e-16 
PYU1_G005872                                                          79.3       2e-16 
PYU1_G005871                                                          79.0       2e-16 
PHYSO_318683                                                          79.7       2e-16 
PHYKE_5749                                                            79.3       2e-16 
PHYSO_484051                                                          79.0       2e-16 
PYAP_23672                                                            78.6       2e-16 
PHYRA_83499                                                           80.1       2e-16 
PYU1_G005985                                                          77.4       2e-16 
PHYCA_103479                                                          79.3       2e-16 
PPTG_07516                                                            79.0       2e-16 
PHYKE_10295                                                           79.0       2e-16 
PHYSO_374518                                                          75.1       2e-16 
PPTG_07520                                                            79.0       2e-16 
SDRG_08782                                                            80.1       2e-16 
PHYCA_18729                                                           79.7       2e-16 
SPRG_19917                                                            77.8       3e-16 
PHYKE_10296                                                           79.7       4e-16 
PYAP_18226                                                            77.0       4e-16 
PHYCA_12944                                                           75.9       4e-16 
PYVX_16138                                                            79.3       5e-16 
PHYRA_73581                                                           77.8       6e-16 
PHYSO_324715                                                          77.0       8e-16 
PHYCA_10471                                                           77.4       8e-16 
PHYCA_112615                                                          75.5       9e-16 
PPTG_18166                                                            78.2       1e-15 
PYIW_25463                                                            75.5       1e-15 
PYU1_G005873                                                          75.5       1e-15 
PITG_11937                                                            77.0       1e-15 
PHYRA_84947                                                           76.3       1e-15 
PHYSO_426658                                                          75.1       1e-15 
PHYRA_78172                                                           77.4       1e-15 
PHYKE_6069                                                            76.6       2e-15 
PITG_11944                                                            76.6       2e-15 
PYAP_24691                                                            73.6       2e-15 
PHALS_01293                                                           77.0       2e-15 
H257_11264                                                            76.3       2e-15 
PYIR_15187                                                            74.7       2e-15 
PHYKE_1913                                                            75.9       2e-15 
PYAP_16338                                                            75.9       2e-15 
PPTG_03145                                                            76.3       2e-15 
PYIR_14463                                                            76.6       3e-15 
SPRG_07796                                                            76.3       3e-15 
PHYCA_18657                                                           75.9       3e-15 
PHYRA_78625                                                           77.0       3e-15 
SPRG_07627                                                            77.0       3e-15 
PHYRA_78626                                                           77.0       3e-15 
PYU1_G005866                                                          73.9       3e-15 
PYU1_G005869                                                          75.1       3e-15 
PYIW_24288                                                            74.3       3e-15 
PHYRA_80750                                                           75.5       3e-15 
SDRG_17318                                                            74.7       3e-15 
PITG_08202                                                            73.9       3e-15 
PHYSO_262844                                                          75.5       4e-15 
PYU1_G001524                                                          75.5       4e-15 
H310_05433                                                            75.9       4e-15 
PHYKE_7445                                                            75.9       5e-15 
PYIR_22549                                                            74.7       5e-15 
PYU1_G001528                                                          74.7       5e-15 
PYVX_20783                                                            74.7       5e-15 
H257_11265                                                            74.7       6e-15 
SPRG_04679                                                            73.9       7e-15 
HYAP_11923                                                            75.9       7e-15 
PYIR_25999                                                            75.1       9e-15 
PYAR_24818                                                            72.8       9e-15 
PHYKE_8390                                                            71.2       1e-14 
PPTG_03161                                                            75.1       1e-14 
PYIW_24287                                                            74.7       1e-14 
PITG_11942                                                            73.9       1e-14 
PHYCA_552912                                                          75.1       1e-14 
PHYCA_120062                                                          72.8       1e-14 
PYVX_24563                                                            73.6       1e-14 
PHYRA_77293                                                           73.9       1e-14 
H310_05432                                                            73.6       2e-14 
SDRG_16535                                                            73.6       2e-14 
PPTG_20376                                                            71.6       2e-14 
PHYSO_375794                                                          70.1       2e-14 
PITG_01966                                                            73.6       2e-14 
PYAP_22462                                                            72.0       3e-14 
PYAP_18584                                                            71.6       3e-14 
PHYCA_132255                                                          69.7       3e-14 
PHYKE_3912                                                            72.0       4e-14 
PHYRA_86201                                                           72.4       4e-14 
PHYRA_86751                                                           70.1       4e-14 
PPTG_03140                                                            73.2       4e-14 
SDRG_17317                                                            68.9       5e-14 
PHYSO_488139                                                          72.0       5e-14 
PHYRA_78164                                                           72.4       5e-14 
PYVX_20789                                                            72.0       7e-14 
PYAP_18138                                                            71.2       9e-14 
PPTG_03148                                                            71.6       9e-14 
PPTG_01148                                                            71.6       9e-14 
PYVX_23997                                                            70.1       9e-14 
SPRG_07826                                                            72.0       9e-14 
PHYSO_255975                                                          69.7       1e-13 
PYVX_22512                                                            70.5       1e-13 
PYAR_15391                                                            69.3       1e-13 
PPTG_18176                                                            70.9       1e-13 
PPTG_10073                                                            69.3       1e-13 
PHYRA_77291                                                           70.5       1e-13 
PHYKE_7717                                                            72.0       1e-13 
PHYRA_86151                                                           68.9       1e-13 
PYU1_G001520                                                          71.6       2e-13 
PHYCA_122958                                                          70.5       2e-13 
PHYRA_78165                                                           71.2       2e-13 
PHYRA_87941                                                           68.6       2e-13 
PHYKE_7446                                                            71.6       2e-13 
PPTG_01153                                                            70.9       2e-13 
PYU1_G001525                                                          70.9       2e-13 
SDRG_00972                                                            70.9       2e-13 
PYIW_19601                                                            69.7       2e-13 
PHYCA_562062                                                          69.7       3e-13 
PHYSO_476077                                                          69.7       3e-13 
PHYSO_472009                                                          69.7       3e-13 
PHYCA_19606                                                           70.5       3e-13 
PYIR_22133                                                            70.9       3e-13 
SPRG_07825                                                            70.5       4e-13 
PYU1_G005867                                                          68.6       4e-13 
PYIW_16208                                                            69.3       4e-13 
PYAP_14265                                                            69.7       4e-13 
PYVX_22511                                                            69.7       4e-13 
PYAR_14261                                                            67.0       5e-13 
PPTG_01147                                                            68.9       6e-13 
PYVX_21297                                                            68.9       6e-13 
PHYSO_318693                                                          70.1       6e-13 
H257_11271                                                            69.7       7e-13 
PITG_11957                                                            69.3       7e-13 
PHYKE_2379                                                            68.9       9e-13 
PPTG_10186                                                            68.6       1e-12 
PHYRA_78162                                                           69.3       1e-12 
PHYCA_10470                                                           68.6       1e-12 
PHYSO_256017                                                          66.2       1e-12 
PYVX_24274                                                            67.8       1e-12 
PHYCA_123476                                                          68.6       1e-12 
PYAP_19707                                                            67.8       1e-12 
PITG_20631                                                            67.8       2e-12 
PPTG_04801                                                            67.8       2e-12 
PITG_20312                                                            67.8       2e-12 
PYIW_18065                                                            68.2       2e-12 
PPTG_01152                                                            67.4       2e-12 
PHYCA_14559                                                           67.4       2e-12 
PHYRA_84732                                                           67.4       2e-12 
PHALS_05110                                                           66.2       2e-12 
PPTG_03147                                                            67.4       3e-12 
PYAP_16337                                                            67.0       3e-12 
PYAP_23455                                                            67.8       3e-12 
PHYKE_6066                                                            67.0       4e-12 
PYVX_21438                                                            66.6       4e-12 
PYAP_23673                                                            67.0       4e-12 
PYAR_25093                                                            65.5       5e-12 
PYAP_16347                                                            65.1       5e-12 
PITG_11951                                                            64.7       5e-12 
PHYSO_525490                                                          67.0       6e-12 
HYAP_14170                                                            66.2       6e-12 
PYVX_21174                                                            62.8       6e-12 
PHALS_08575                                                           66.6       6e-12 
PPTG_09880                                                            65.1       6e-12 
PYVX_18175                                                            63.5       8e-12 
PYIR_20482                                                            63.9       8e-12 
PHYKE_2539                                                            65.5       9e-12 
PYAP_19712                                                            65.5       1e-11 
PYIR_17978                                                            65.1       1e-11 
PYAR_17163                                                            62.4       1e-11 
PHYKE_7443                                                            65.9       1e-11 
PYIW_18794                                                            65.1       1e-11 
PYAR_16493                                                            65.1       1e-11 
PYVX_21644                                                            64.3       2e-11 
PPTG_07511                                                            63.9       2e-11 
PYVX_21643                                                            64.7       2e-11 
PHALS_02041                                                           64.7       2e-11 
PYIW_21963                                                            65.1       2e-11 
PITG_01969                                                            64.7       2e-11 
SDRG_17448                                                            64.7       2e-11 
PYAP_16994                                                            64.3       2e-11 
PYAR_18165                                                            63.9       4e-11 
PHALS_02037                                                           64.3       4e-11 
PHYCA_19608                                                           63.5       7e-11 
HYAP_11925                                                            63.2       7e-11 
PYAR_17307                                                            62.4       9e-11 
PHYRA_79881                                                           62.8       9e-11 
PHYRA_77292                                                           61.6       1e-10 
PYVX_18179                                                            60.5       1e-10 
PYU1_G007242                                                          62.4       1e-10 
PYVX_16673                                                            63.5       1e-10 
PHYCA_558591                                                          59.7       1e-10 
PYAR_21940                                                            62.0       2e-10 
PPTG_06106                                                            62.0       2e-10 
PHYCA_19599                                                           62.8       2e-10 
PYIW_26655                                                            62.0       2e-10 
PYAR_13902                                                            60.1       2e-10 
PYIW_17867                                                            62.4       2e-10 
PITG_11943                                                            60.5       2e-10 
PYU1_G013346                                                          58.2       2e-10 
PYAR_17166                                                            58.9       3e-10 
H257_11258                                                            62.4       3e-10 
PYIR_25571                                                            61.6       3e-10 
PHYKE_9023                                                            61.6       3e-10 
PYAR_21271                                                            60.8       3e-10 
PHYCA_122138                                                          60.5       4e-10 
PHALS_01460                                                           61.2       4e-10 
PYU1_G003057                                                          60.5       4e-10 
PYIW_25642                                                            59.3       4e-10 
PYIR_22136                                                            61.2       4e-10 
CCI47989                                                              61.2       4e-10 
PHYCA_538650                                                          60.8       5e-10 
H310_05438                                                            61.2       5e-10 
PHYCA_97699                                                           60.1       7e-10 
PYAP_24338                                                            60.1       8e-10 
PYIR_26312                                                            57.8       1e-09 
H257_11306                                                            60.1       1e-09 
PITG_19818                                                            57.8       1e-09 
PHYKE_9024                                                            59.3       2e-09 
PYU1_G001518                                                          59.3       2e-09 
PYIR_20850                                                            58.2       2e-09 
PYAP_16351                                                            58.5       3e-09 
PYIR_20304                                                            57.8       3e-09 
PYU1_G006672                                                          53.9       4e-09 
PYIR_16375                                                            58.2       4e-09 
PYAP_20077                                                            57.8       4e-09 
PYU1_G007250                                                          56.6       6e-09 
PHYSO_339832                                                          57.4       6e-09 
PHYRA_78168                                                           57.8       6e-09 
PHYSO_246472                                                          57.4       6e-09 
PHYSO_257305                                                          56.2       8e-09 
HYAP_01683                                                            57.8       9e-09 
PPTG_00482                                                            55.8       9e-09 
PHYSO_342361                                                          55.1       1e-08 
PYAR_22058                                                            55.8       1e-08 
PHYCA_6388                                                            56.6       1e-08 
PYIW_15528                                                            57.0       1e-08 
PYU1_G005862                                                          55.5       2e-08 
PHYSO_525121                                                          55.8       2e-08 
PHYCA_15126                                                           56.6       2e-08 
PPTG_22744                                                            54.7       2e-08 
PITG_21039                                                            54.3       2e-08 
PYIR_23622                                                            56.2       2e-08 
PYU1_G001517                                                          56.2       2e-08 
PHYCA_559281                                                          54.3       2e-08 
PPTG_03144                                                            56.2       2e-08 
PITG_04404                                                            55.5       2e-08 
PHYKE_8104                                                            52.8       2e-08 
PYIR_24935                                                            55.8       2e-08 
PYU1_G007254                                                          55.1       2e-08 
PHYSO_454780                                                          54.7       3e-08 
PPTG_00483                                                            55.5       3e-08 
PYAP_20456                                                            55.8       3e-08 
PPTG_13879                                                            55.8       3e-08 
PHALS_05395                                                           54.3       3e-08 
PYAR_15784                                                            54.3       3e-08 
PITG_11941                                                            53.5       4e-08 
PYAR_22574                                                            52.4       4e-08 
PYAR_22572                                                            53.1       5e-08 
PPTG_06249                                                            55.1       5e-08 
PYAP_20161                                                            54.3       6e-08 
PYIR_26519                                                            54.3       7e-08 
PYIR_24867                                                            54.7       8e-08 
PHYRA_80631                                                           54.7       8e-08 
PYIR_22634                                                            54.3       9e-08 
PHYRA_80632                                                           54.3       1e-07 
PHYCA_15124                                                           53.9       1e-07 
PHYSO_341657                                                          53.9       1e-07 
PYAR_23252                                                            53.5       1e-07 
CCI46093                                                              53.9       1e-07 

>PYAR_24096
Length=227

 Score = 383 bits (984),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 227/227 (100%), Positives = 227/227 (100%), Gaps = 0/227 (0%)

Query  1    MSLHSvavlgavavaalaaptalveaHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTT  60
            MSLHSVAVLGAVAVAALAAPTALVEAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTT
Sbjct  1    MSLHSVAVLGAVAVAALAAPTALVEAHQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTT  60

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTH  120
            ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTH
Sbjct  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTH  120

Query  121  EGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQ  180
            EGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQ
Sbjct  121  EGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQ  180

Query  181  IYKACIPLSangggaaaapntttaapaVAEKPVAGEASSKGCRRLLD  227
            IYKACIPLSANGGGAAAAPNTTTAAPAVAEKPVAGEASSKGCRRLLD
Sbjct  181  IYKACIPLSANGGGAAAAPNTTTAAPAVAEKPVAGEASSKGCRRLLD  227

>PYAP_22273
Length=268

 Score = 298 bits (763),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 143/163 (88%), Gaps = 0/163 (0%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQRV+ P+VVYT+A+R TNWGPQAKLE QGYKTT DFNAYL AN YKTLR+FMDKPGAYK
Sbjct  26   HQRVYFPEVVYTLADRKTNWGPQAKLENQGYKTTKDFNAYLSANGYKTLRDFMDKPGAYK  85

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             N GAT ECG+TDP AP QPIP +G FRTSGYTHEGPCEIWIDDV VK G NCH+DISE 
Sbjct  86   ANKGATVECGYTDPNAPPQPIPTNGEFRTSGYTHEGPCEIWIDDVMVKSGKNCHYDISEK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            AFTDKIDYSACKG CMLKWYWLGIRP GK YSWQIYKACIPL+
Sbjct  146  AFTDKIDYSACKGKCMLKWYWLGIRPMGKKYSWQIYKACIPLA  188

>PYU1_G001742
Length=213

 Score = 194 bits (492),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 110/162 (68%), Gaps = 3/162 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +TV  R   + P A LE QGYKTT DFNAY KA  YKTLR FMD P AYK
Sbjct  28   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGYKTTVDFNAYYKAKGYKTLRAFMDDPKAYK  87

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              +GA F+CG+T      QPIP  G  R++GYTH+GPCE+W+D  RV  G+NCH +   T
Sbjct  88   VAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHSEFPGT  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             F  KIDYS+CKG+C L+WYW+GIR     YSWQ+YK C+P+
Sbjct  147  TF--KIDYSSCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PYIR_25089
Length=262

 Score = 195 bits (495),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 109/163 (67%), Gaps = 2/163 (1%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +TV  R   + P A LE QG+KTTADF+AY KA  YKTLR FMD   AYK
Sbjct  28   HQYVILPAPTFTVKTRAEQFNPLAFLENQGFKTTADFDAYYKAKGYKTLRAFMDDKSAYK  87

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA FECG+T      QPIP     R++GYTH+GPCE+W+D  RV  G NCH +   T
Sbjct  88   VADGADFECGWTKLAGTPQPIPSASTVRSTGYTHDGPCEVWLDKTRVLKGTNCHSEFPGT  147

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             F  KIDYS+CKG+C+L+WYW+GIR     YSWQ+YK C+P++
Sbjct  148  TF--KIDYSSCKGSCVLRWYWMGIRFLKGQYSWQVYKNCVPVT  188

>PHYSO_341599
Length=185

 Score = 191 bits (486),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 111/163 (68%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  ++ T + P A LE QG+KT  DF A+ K N YK+LR+FMD+   Y 
Sbjct  11   HQIVLLPEPQWTTNDKETKYNPLAFLENQGFKTQEDFTAWRKENGYKSLRDFMDR-AKYD  69

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP+    R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  70   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  129

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLG+R     YSWQ+YKACIPL+
Sbjct  130  DYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  170

>PPTG_10635
Length=199

 Score = 191 bits (485),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 113/163 (69%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+KT  DF ++   N YK+LR+FMD+   Y+
Sbjct  11   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFKSWRDENGYKSLRDFMDR-AKYE  69

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  70   VTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  129

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKG+C L+WYWLG+R    SYSWQ+YKACIPL+
Sbjct  130  DYT--VDYSSCKGSCTLRWYWLGVRFLKNSYSWQVYKACIPLT  170

>PHYCA_14369
Length=248

 Score = 192 bits (489),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 112/163 (69%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+KT  DF A+   N YK+LR+FMD+   Y 
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              +GA F CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  87   VTNGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLG+R    +YSWQ+YKACIPL+
Sbjct  147  DYT--VDYSSCKGTCTLRWYWLGVRFLKNAYSWQVYKACIPLA  187

>PYU1_G001740
Length=206

 Score = 191 bits (485),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 111/162 (69%), Gaps = 4/162 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +TV  ++  W P A LE QGYKTTADFNAY K+  YK+LR FMD   AYK
Sbjct  28   HQLVILPNPTFTVPTKDERWSPLAFLENQGYKTTADFNAYYKSKGYKSLRAFMDDKKAYK  87

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             NS A FECG+T+     QPIP +  FRT+GYTH+GPCE+W+D+ +V  G NCH D    
Sbjct  88   VNSNADFECGYTNKNGARQPIPAN--FRTTGYTHDGPCEVWLDNTKVLSGSNCHKDFPGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              T  + Y+ACKG+C L+WYW+GIR     +SWQ+YK C+PL
Sbjct  146  --THAMSYAACKGSCTLRWYWMGIRFLKGKHSWQVYKECVPL  185

>PPTG_10636
Length=246

 Score = 192 bits (488),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 112/163 (69%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+KT  DF ++   NNYK+LR+FMD    Y+
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQEDFLSWRNENNYKSLRDFMDN-AKYE  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD  V  G+NCH      
Sbjct  87   VTSGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLGIR     YSWQ+YKACIPLS
Sbjct  147  DYT--VDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  187

>PPTG_17122
Length=204

 Score = 191 bits (484),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 110/163 (67%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  N++T + P A LE QGY+T  DFN + + N YKTLR+FMD+   Y 
Sbjct  28   HQVVLLPAPTYTTDNKDTKYAPLAFLENQGYETVEDFNGWRRNNGYKTLRDFMDR-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFT+  A  QPIP DG  R++GYTH+GPCE+W+D  RV   DNCH  IS  
Sbjct  87   VTDGADYYCGFTNVNAAPQPIP-DGTMRSTGYTHDGPCEVWLDTKRVLQSDNCHETISGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYS+C GTC L+WYWLG+R    +YSWQIYKACIPLS
Sbjct  146  TY--NLDYSSCTGTCTLRWYWLGVRYLKNAYSWQIYKACIPLS  186

>PYIR_26546
Length=239

 Score = 191 bits (485),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 109/163 (67%), Gaps = 1/163 (1%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQ-GYKTTADFNAYLKANNYKTLREFMDKPGAY  85
            HQ V LP   +T+  +   W P A LE Q G+    DFN YL +  +KT+REFMD    Y
Sbjct  28   HQMVVLPKPTWTIEGKGQQWRPMAYLEGQPGFSPNPDFNGYLSSKGFKTMREFMDNDKLY  87

Query  86   KPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  145
            +P S A F+CG+T      QPIPK+   RT+GYTHEGPCEIW+DDV+V +G NCH+D++ 
Sbjct  88   RPVSDADFKCGYTKLDGEPQPIPKNDQIRTTGYTHEGPCEIWLDDVKVFYGKNCHYDVAS  147

Query  146  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
                 K+D+S+C G C + WYW+GIR +GKS SWQIYK CIPL
Sbjct  148  GMNFQKLDFSSCVGKCTMYWYWMGIRGSGKSVSWQIYKECIPL  190

>PHYSO_536424
Length=197

 Score = 189 bits (480),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 111/163 (68%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+ ++T  ++ T + P A LE +G+ T  DF A+ K N YK+LR+FMD+   Y 
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKYD  81

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP+    R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLG+R     YSWQ+YKACIPL+
Sbjct  142  DYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PHYSO_507031
Length=197

 Score = 189 bits (480),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 111/163 (68%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+ ++T  ++ T + P A LE +G+ T  DF A+ K N YK+LR+FMD+   Y 
Sbjct  23   HQIVLLPEPLWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFMDR-AKYD  81

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP+    R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  82   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  141

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLG+R     YSWQ+YKACIPL+
Sbjct  142  DYT--VDYSSCKGTCTLRWYWLGVRFLKNDYSWQVYKACIPLT  182

>PYU1_G001741
Length=199

 Score = 187 bits (476),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 108/162 (67%), Gaps = 3/162 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +TV  R   + P A LE QG++TTADFNAY KA  YKTLR FMD   AY 
Sbjct  27   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGFETTADFNAYYKAKGYKTLRAFMDDKKAYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA FECG+T      Q IP  G  R++GYTH+GPCE+W+D  RV  G+NCH + + T
Sbjct  87   VASGADFECGWTKLDGTRQSIPA-GTIRSTGYTHDGPCEVWLDSTRVMKGNNCHTEFTGT  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              T  IDYS+CKG+C L+WYW+GIR     YSWQ+YK C+P+
Sbjct  146  --THTIDYSSCKGSCTLRWYWMGIRFLKGEYSWQVYKNCVPI  185

>PYAP_22278
Length=289

 Score = 190 bits (482),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 113/166 (68%), Gaps = 4/166 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQRV +P   +T  +RN NW P A LE QG K   D   +L++   KTLR++MD    YK
Sbjct  25   HQRVTIPAPTFTNNDRNVNWNPLAFLENQGVKAGDDLTGFLRSKGIKTLRDYMDNKANYK  84

Query  87   PNS-GATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRV--KHGDNCHFDI  143
              + GA+FECG+T+P    QPIPK+G  R++GYTH+GPCE+W+D+ RV   +  NCH D+
Sbjct  85   IEARGASFECGYTNPNGARQPIPKNGMMRSTGYTHDGPCEVWLDNTRVLGSYTGNCHRDV  144

Query  144  SETAFTDKIDYSACKGTCMLKWYWLGIRPT-GKSYSWQIYKACIPL  188
               A + KID+S CKG CML+WYWLG R   GK +SWQIYKAC+PL
Sbjct  145  GNKAVSYKIDFSKCKGNCMLRWYWLGKRLIGGKKWSWQIYKACVPL  190

>PHYKE_3446
Length=199

 Score = 186 bits (472),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 111/163 (68%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +   ++   + P A LE QG+ T  D NA+ + N YKTLR FMD    Y+
Sbjct  28   HQIVLLPEPQWKTDSKEIKYNPLAFLENQGFATQEDANAWRRDNGYKTLRAFMDM-AKYQ  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CG+TDP   AQPIP+ GA R++GYTH+GPCE+WID+ RV    NCH  I+  
Sbjct  87   VTEGADYFCGWTDPNGTAQPIPEGGAMRSTGYTHDGPCEVWIDNTRVLESGNCHETITGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYSAC+GTCML+WYWLG+R    SYSWQ+YKACIPL+
Sbjct  147  DYT--IDYSACQGTCMLRWYWLGVRFLKNSYSWQVYKACIPLT  187

>PHYRA_84190
Length=206

 Score = 186 bits (472),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 111/163 (68%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE +G+ T  DF A+   N YK+LR+FMD    Y 
Sbjct  11   HQIVLLPEPQWTTDDKDTKYNPLAFLENEGFATQEDFTAWRTENGYKSLRDFMDN-AKYS  69

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              +GA F CGFTDPK   QPIP D A R++GYTH+GPCE+W+DD  V  G+NCH      
Sbjct  70   VTNGADFSCGFTDPKGTPQPIPADNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGK  129

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYW+G+R   ++YSWQ+YK CIPL+
Sbjct  130  DYT--VDYSSCKGTCTLRWYWMGVRFLKETYSWQVYKECIPLT  170

>PHYCA_129425
Length=204

 Score = 186 bits (471),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 108/163 (66%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  N++T + P A LE QG+KT  DFN + ++N YKTLR FMD    Y 
Sbjct  28   HQVVLLPAPTYTTDNKDTKYAPLAFLESQGFKTVEDFNGWRRSNGYKTLRAFMDG-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFT+ KA  QPIP DG  R++GYTH+GPCE+W+D  RV   DNCH      
Sbjct  87   VTDGADYYCGFTNAKAAPQPIP-DGTMRSTGYTHDGPCEVWLDSTRVLQSDNCHETFPGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYS+CKG+CML+WYWLG R     +SWQ+YKACIPLS
Sbjct  146  TY--NLDYSSCKGSCMLRWYWLGTRFLKNEHSWQVYKACIPLS  186

>PPTG_15264
Length=194

 Score = 184 bits (468),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 113/165 (68%), Gaps = 5/165 (3%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V  P+  +T  N++  + P A LE QG++T  DFNA+ + N YKTLR+FMD+   Y 
Sbjct  25   HQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CG+TDPK   QPIP  GA R++GYTH+GPCE+W+DDVRV  G NCH  I   
Sbjct  84   VTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGK  143

Query  147  AFTDKIDYSAC--KGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  KG C+L+WYWLG+R    SYSWQ+YK CIPL+
Sbjct  144  DYT--IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLT  186

>PPTG_17366
Length=194

 Score = 184 bits (468),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 113/165 (68%), Gaps = 5/165 (3%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V  P+  +T  N++  + P A LE QG++T  DFNA+ + N YKTLR+FMD+   Y 
Sbjct  25   HQIVLQPEPQWTTDNKDIKYNPLAFLEGQGFQTQEDFNAWRRDNGYKTLRDFMDR-AKYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CG+TDPK   QPIP  GA R++GYTH+GPCE+W+DDVRV  G NCH  I   
Sbjct  84   VTEGADYFCGWTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDVRVLEGGNCHESIPGK  143

Query  147  AFTDKIDYSAC--KGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  KG C+L+WYWLG+R    SYSWQ+YK CIPL+
Sbjct  144  DYT--IDYSSCEKKGGCVLRWYWLGVRFLKNSYSWQVYKECIPLT  186

>PHYSO_284086
Length=204

 Score = 184 bits (467),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 108/163 (66%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  ++ T + P A LE QGY+T  DFNA+ +   YKTLR FMD   +Y 
Sbjct  28   HQVVLLPAPTYTTDDKATKYAPLAFLENQGYETVEDFNAWRRDKGYKTLRAFMDG-ASYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFTD K  AQPIP DG  R++GYTH+GPCE+W+D  RV   DNCH   S  
Sbjct  87   VADGADYYCGFTDIKGVAQPIP-DGTMRSTGYTHDGPCEVWLDTTRVLQSDNCHETFSGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYS+CKG+C L+WYWLG+R     YSWQ+YKAC+PLS
Sbjct  146  TY--DLDYSSCKGSCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PHYKE_8389
Length=204

 Score = 184 bits (467),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 107/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  +++T + P A LE QG++T  DFNA+ + N YKTLR FMD    Y 
Sbjct  27   HQVVLLPAPTYTTDDKDTKYAPLAFLENQGFETVDDFNAWRRNNGYKTLRAFMDG-AKYT  85

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFT+  A  Q IP   A R++GYTH+GPCE+W+D  RV   DNCH  IS  
Sbjct  86   VTDGADYHCGFTNADAAPQAIPSGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C GTC L+WYWLG+R     YSWQ+YKAC+PLS
Sbjct  146  DYT--IDYSSCTGTCTLRWYWLGVRFLKNEYSWQVYKACVPLS  186

>PPTG_10634
Length=208

 Score = 184 bits (466),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 3/162 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  ++ T + P A LE +G+ T  DF A+ K N YK+LR+F+D    Y 
Sbjct  28   HQIVLLPEPQWTTNDKETKYNPLAFLENEGFTTQEDFTAWRKENGYKSLRDFLDN-AKYP  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F+CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  87   VTDGADFKCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             +T  +DYS+CKGTC L WYWLG+R     YSWQ+YKACIPL
Sbjct  147  DYT--VDYSSCKGTCTLYWYWLGVRFLKNDYSWQVYKACIPL  186

>PYVX_18173
Length=500

 Score = 192 bits (487),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 107/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YTV  ++  W P A LE Q + TT DF  YL AN + +LR FMD    Y 
Sbjct  235  HQLVILPAPTYTVEGKDNRWKPLAFLEGQNFSTTDDFVGYLDANGFDSLRAFMDDDSLYS  294

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             N+ A F CGFTDP A  QPIP DG  R++GYTH+GPCE+W+DD RV   DNCH  IS  
Sbjct  295  VNASADFRCGFTDPDAAPQPIP-DGIMRSTGYTHDGPCEVWLDDTRVLQHDNCHEVISGK  353

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYSAC G+C L WYWLG+R   + YSWQ+YKAC+P+S
Sbjct  354  TY--DLDYSACNGSCTLYWYWLGVRYLKQVYSWQVYKACVPIS  394

 Score = 146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 89/162 (55%), Gaps = 2/162 (1%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87
            Q V  P   + V   +    P A LE+QG  T  +   +L    Y TLR  MD  G Y  
Sbjct  38   QVVLYPPPFFVVDGMDYRGSPVAYLEQQGVHTAIEAQTWLAERGYATLRALMDDDGLYSV  97

Query  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147
                 F+CG T P    QPIP +G+F TSGYT +GPCEIWID+     G NCH +  E  
Sbjct  98   TEEGLFDCGLTFPNTETQPIPTNGSFITSGYTLDGPCEIWIDNTLALAGRNCHTEFPEGH  157

Query  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             T  IDYS C  +C + W+WLGI+  G+ YSWQ++K CI LS
Sbjct  158  HT--IDYSVCGESCRVSWFWLGIKYQGERYSWQVFKNCINLS  197

>PYU1_G001744
Length=213

 Score = 183 bits (465),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 109/162 (67%), Gaps = 3/162 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +TV  R   + P A LE QG+KTTADFNAY KA  YK+LR FMD   AYK
Sbjct  28   HQYVMLPAPTFTVKTRAEQFNPLAFLENQGFKTTADFNAYYKAKGYKSLRAFMDDKKAYK  87

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              +GA F+CG+T      QPIP  G  R++GYTH+GPCE+W+D+  V  G+NCH +   T
Sbjct  88   VAAGADFQCGWTKLDGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTLVMKGNNCHSEFPGT  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              T KI Y++CKG+C L+WYW+GIR     YSWQ+YK C+P+
Sbjct  147  --THKISYASCKGSCTLRWYWMGIRFLKGKYSWQVYKNCVPI  186

>PHYCA_102550
Length=268

 Score = 185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 105/163 (64%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +   NR+T   P A LE QG+KT  DF A+   N YK+LR+FMD+   Y 
Sbjct  28   HQVVLLPAPQWKTDNRDTQHDPLAFLESQGFKTQQDFTAWRNENGYKSLRDFMDR-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              +GA F+CG+TDP    QPIP   A R++GYTH+GPCE+WIDD  V  GDNCH      
Sbjct  87   VRNGADFKCGYTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS CKG C L WYWLG+R    SYSWQ+YK CIPL+
Sbjct  147  GYT--IDYSPCKGKCTLYWYWLGVRFLKNSYSWQVYKECIPLA  187

>PHYRA_85631
Length=228

 Score = 183 bits (464),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 107/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE +G+ T  DF ++   N YK+LR+FMD    Y 
Sbjct  28   HQVVLLPEPQWTTDDKDTKYNPLAFLENEGFTTQEDFASWRDENGYKSLRDFMDN-AKYN  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  87   VADGADFSCGFTDPKGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGDNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  +DYS+CKGTC L+WYWLGIR     YSWQ+YK CIPL+
Sbjct  147  DYT--VDYSSCKGTCTLRWYWLGIRFLKNDYSWQVYKECIPLT  187

>PHYCA_102852
Length=195

 Score = 182 bits (461),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 108/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE +G+ T  DF A+   N YK+LR+FMD+   Y 
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENEGFTTQEDFTAWRTENGYKSLRDFMDR-AKYP  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F+CGFTDP    QPIP   A R++GYTH+GPCE+W+DD  V  G+NCH      
Sbjct  87   VTEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWLDDTMVLDGENCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+CKGTC L W+WLG+R     YSWQ+YKACIPL+
Sbjct  147  GYT--IDYSSCKGTCTLYWFWLGVRFLKNDYSWQVYKACIPLT  187

>PYAP_22279
Length=223

 Score = 182 bits (462),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 106/165 (64%), Gaps = 4/165 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQR+ +P    T  +RNT   P A LE QG K T D   YL+    KTLR+FMD    YK
Sbjct  22   HQRITIPAPTLTT-DRNTATNPLAFLENQGVKATDDLTGYLRQKGVKTLRDFMDNKANYK  80

Query  87   PNS-GATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRV--KHGDNCHFDI  143
              + GATFECG+TDP    QPIP +G  R++GYTH+GPCE+W+D+ RV      +CH DI
Sbjct  81   VEAAGATFECGYTDPNGARQPIPSNGMMRSTGYTHDGPCEVWLDNTRVLGSTSGDCHKDI  140

Query  144  SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             +   + KID+S CKG CML+WYWL  R  G  +SWQ+YK C+PL
Sbjct  141  GQGMISYKIDFSKCKGNCMLRWYWLAKRKIGSKWSWQVYKQCVPL  185

>PITG_18450
Length=203

 Score = 181 bits (460),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 108/163 (66%), Gaps = 7/163 (4%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  +++T + P   LE QGY+T  DFN + + N YKTLR+FM+    Y 
Sbjct  28   HQVVLLPSPTYTTDDKDTKYAPLTFLEGQGYETVEDFNGWRRNNGYKTLRDFME----YT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFT+  A  QP P DGA R++GYTH+GPCE+W+D  RV   DNCH  I   
Sbjct  84   VADGADYYCGFTNVNAAPQPNP-DGAMRSTGYTHDGPCEVWLDSTRVLQSDNCHETIIGK  142

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYS+CKGTC L+WYWLG+R    +YSWQIYKACIPLS
Sbjct  143  TY--NLDYSSCKGTCTLRWYWLGVRFLKNAYSWQIYKACIPLS  183

>PHYRA_81106
Length=202

 Score = 181 bits (459),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 108/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  +++T + P A LE QG++T  DFNA+ ++N YKTLR FMD    Y 
Sbjct  28   HQVVLLPAPTYTTDSKDTKYAPLAFLENQGFETVGDFNAWRRSNGYKTLRAFMDG-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CGFT+  A  Q IP   A R++GYTH+GPCE+W+D  RV   DNCH  IS  
Sbjct  87   VADGADYYCGFTNADATPQAIPDGNAMRSTGYTHDGPCEVWLDTTRVLTHDNCHEAISGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C GTC L WYW+G+R    +YSWQ+YKAC+PLS
Sbjct  147  DYT--IDYSSCTGTCTLHWYWMGVRYLKNAYSWQVYKACVPLS  187

>PYU1_G001739
Length=266

 Score = 182 bits (463),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 104/163 (64%), Gaps = 2/163 (1%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ +  P+  + V  ++  W P A LE QG  T+AD   ++K   Y  LR  MD    Y+
Sbjct  24   HQMMIFPEPFFLVDGKDAQWKPLAFLENQGVNTSADVAGFMKQKGYANLRALMDDEKLYE  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             N+ A FECG+TDP   +QPIP  G  R++GYTH+GPCE+W+DDV+V  GDNCH      
Sbjct  84   VNTDALFECGYTDPTYESQPIPTTGTIRSTGYTHDGPCEVWLDDVKVMSGDNCHDKFPGK  143

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             F   +DYS+CKG+C L+WYWLG+R   K YSWQIYK C+ LS
Sbjct  144  TF--PLDYSSCKGSCTLRWYWLGVRYLKKRYSWQIYKECVSLS  184

>PHYCA_102624
Length=195

 Score = 180 bits (457),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 103/163 (63%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +   NR+T   P   LE  G+KT ADF A+ K N YK+LR+FMD    Y 
Sbjct  28   HQVVLLPKPQWKTDNRDTQHKPLTFLEGVGFKTQADFTAWRKENGYKSLRDFMDN-AKYP  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             + GA F+CGFTDP    QPIP   A R++GYTH+GPCE+WIDD  V  GDNCH      
Sbjct  87   VSEGADFKCGFTDPNGTPQPIPAGNAMRSTGYTHDGPCEVWIDDTMVMEGDNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS CKG C L WYWLG+R     YSWQ+YK CIPL+
Sbjct  147  DYT--IDYSPCKGKCTLYWYWLGVRFLKNRYSWQVYKECIPLT  187

>PYIR_26626
Length=212

 Score = 181 bits (459),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 110/163 (67%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +T  ++N  W P A LE QGYKTTADFN Y+K+  YKTLR FMD   AYK
Sbjct  28   HQSVILPAPTFTNPDKNVYWNPLAFLENQGYKTTADFNGYIKSKGYKTLRAFMDDKKAYK  87

Query  87   PN-SGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  145
             + +GA FECG+T+     QPIP  G  R++GYTH+GPCE+W+D+ +V  G NC+ D   
Sbjct  88   VDAAGANFECGYTNINGKRQPIPA-GTIRSTGYTHDGPCEVWLDNTKVMSGTNCNKDFPG  146

Query  146  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
               T  I Y++CKG+C L+WYW+G+R     +SWQ+YK C+P+
Sbjct  147  K--THSISYASCKGSCTLRWYWMGLRFLKNKWSWQVYKECVPI  187

>PPTG_10643
Length=250

 Score = 182 bits (461),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 110/165 (67%), Gaps = 9/165 (5%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+K   DF A+ K N YK+LR+FMD+   Y+
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKPQEDFAAWSKENGYKSLRDFMDR-AKYE  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CGFT+PK   QPIP  G  R++GYTH+GPCE+++DD  V  GDNCH      
Sbjct  87   VTPGADFSCGFTNPKGTPQPIPAQGIMRSTGYTHDGPCEVYLDDTLVLQGDNCH-----E  141

Query  147  AFTDK---IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             F  K   IDYS+CKGTC L+WYWLGIR    +YSWQ+YK CIPL
Sbjct  142  KFPGKDCPIDYSSCKGTCTLRWYWLGIRFLKNAYSWQVYKECIPL  186

>PHYRA_82864
Length=193

 Score = 179 bits (455),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 109/163 (67%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  N++T + P A LE QG+ T  DFNA+ + N YKTLR+FMD+   Y 
Sbjct  28   HQVVLLPEPQWTTDNKDTKYNPLAFLEGQGFATQGDFNAWRRDNGYKTLRDFMDR-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA + CG+TDP    QPIP  G  R++GYTH+GPCE+W+D+ RV  GDNCH    + 
Sbjct  87   VTEGADYFCGWTDPNGTPQPIPA-GNMRSTGYTHDGPCEVWLDNTRVLQGDNCHEQFPDK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   IDYS+CKGTC L WYW+G+R    SYSWQ+YK CI L+
Sbjct  146  DY--PIDYSSCKGTCTLHWYWIGVRFLKNSYSWQVYKECISLT  186

>PYIW_18791
Length=194

 Score = 179 bits (453),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 105/164 (64%), Gaps = 4/164 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V +P   +TVA + T W P + LEK G KT+   + ++K   Y TLR  MD    YK
Sbjct  22   HQAVEVPKPNWTVAKKATYWAPLSFLEKNGVKTSESVDGFMKDKGYSTLRALMDDSKLYK  81

Query  87   PNSGA-TFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE  145
             NS A  F CG+TDP   +Q IPKD   RT+GYTH GPCE+WIDD RV  GDNCH  +S 
Sbjct  82   TNSNADNFLCGYTDPSKGSQVIPKDSTMRTTGYTHVGPCEVWIDDERVIAGDNCHEQVSN  141

Query  146  TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            T    K+DYS CKG C ++WYWLG+R   K +SWQ+YK CI L+
Sbjct  142  TT---KVDYSNCKGECTMRWYWLGLRYLKKKWSWQVYKNCIALT  182

>PHYKE_7718
Length=220

 Score = 180 bits (456),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 106/163 (65%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE +G+    DF A+   N YK+LR+FMD    Y 
Sbjct  32   HQIVLLPEPTWTTDDKDTKYNPLAFLEGEGFTPQEDFTAWRIENGYKSLRDFMDN-AKYS  90

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA   CGFTDP    QPIP+  A R++GYTH+GPCE+WIDD      DNCH      
Sbjct  91   VTSGADSACGFTDPNGTPQPIPEGNAMRSTGYTHDGPCEVWIDDTLAMGNDNCHEAFPGK  150

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYSACKGTC L+WYWLG+R    SYSWQ+YKACIPL+
Sbjct  151  DYT--IDYSACKGTCTLRWYWLGVRFLKNSYSWQVYKACIPLT  191

>PHYKE_8388
Length=205

 Score = 178 bits (451),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 103/163 (63%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  ++ T + P A LE QG+ T  DF A+   N Y +LR F D   +Y 
Sbjct  28   HQVVLLPSPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWRSDNGYASLRAFNDD-ASYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             + GA F CGFTD    AQPIP D A R++GYTH+GPCE+W+DD  V   +NCH  IS  
Sbjct  87   VSDGADFTCGFTDINGAAQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYNNCHDSISGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  TC L W+W+G+R     YSWQ+YKAC+PLS
Sbjct  147  DYT--IDYSSCTSTCTLYWFWMGVRYLKNEYSWQVYKACVPLS  187

>PHALS_00498
Length=199

 Score = 177 bits (450),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 107/163 (66%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +   +++T + P A LE Q +KTT D  AY K N++KTLR+FMD    Y 
Sbjct  28   HQIVLLPEPQWKTNDKDTRYNPLAFLENQNFKTTGDAQAYFKQNHFKTLRDFMDN-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA   CGFTDP    QPIP + A R++GYTH+GPCE+W+++ RV    NCH      
Sbjct  87   VVKGADPACGFTDPNGTPQPIPANNAMRSTGYTHDGPCEVWLNNTRVLSASNCHEKFPGK  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+CK  C+L+WYWLG+R   + YSWQ+YKACIPLS
Sbjct  147  DYT--IDYSSCKDNCLLRWYWLGVRFLKEKYSWQVYKACIPLS  187

>PHYSO_477820
Length=202

 Score = 176 bits (445),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/163 (51%), Positives = 101/163 (62%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  ++ T + P A LE QG+ T  DF A+   N Y +LR F D   +Y 
Sbjct  25   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRTDNGYDSLRAFNDG-ASYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CGFT+     QPIP D A R++GYTH+GPCE+W+DD  V   DNCH  IS  
Sbjct  84   VADGADFTCGFTNTNGEVQPIPDDNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHESISGK  143

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  TC L W+WLG+R     YSWQIYKAC+PLS
Sbjct  144  DYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  184

>PPTG_10048
Length=190

 Score = 173 bits (438),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 102/163 (63%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V  P   +   NR+T   P A LE QG+KT  DF ++   N YKTLR+FM+    Y 
Sbjct  25   HQVVLHPAPQWITDNRDTQHNPLAFLESQGFKTQEDFKSWRIQNGYKTLRDFMEH-AKYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CG+T+PK   QPIP  G  R++GYTHEGPCE+W+ D +V   DNCH  +   
Sbjct  84   VTEGADFSCGWTNPKGTPQPIPAGGIMRSTGYTHEGPCEMWVADTQVYQADNCHVSLPGK  143

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   IDYS CKG C+L WYWLG+R    SYSWQ+YK CIPL+
Sbjct  144  EY--PIDYSPCKGNCVLYWYWLGVRFLKNSYSWQVYKECIPLT  184

>PHYRA_81107
Length=202

 Score = 173 bits (438),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 102/163 (63%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  ++ T + P A LE QG+ T  DF A+ + N Y +LR F D   +Y 
Sbjct  25   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFSTQEDFTAWREENGYDSLRAF-DDGASYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             + GA F CGFTD     Q IP   A R++GYTH+GPCE+W+DD  V   DNCH  IS  
Sbjct  84   VSDGADFTCGFTDINGDVQAIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEVISGK  143

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  TC L W+W+G+R    +YSWQ+YKAC+PLS
Sbjct  144  DYT--IDYSSCTSTCTLYWFWMGVRYLNNAYSWQVYKACVPLS  184

>PPTG_17121
Length=202

 Score = 171 bits (434),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 101/163 (62%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V L    YT  +++T + P A LE QG+ T  DF A+ K N Y +LR F D   +Y 
Sbjct  25   HQVVLLSAPTYTTDDKDTKYAPLAFLEDQGFATQEDFTAWRKDNGYDSLRAFNDG-ASYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             + GA   CGFT+     QPIP   A R++GYTH+GPCE+W+DD  V   DNCH  IS  
Sbjct  84   VSDGADLTCGFTNINGDVQPIPDGNAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGK  143

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  TC L W+WLG+R     YSWQIYKAC+PLS
Sbjct  144  YYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  184

>PHYCA_511409
Length=204

 Score = 170 bits (430),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/163 (50%), Positives = 101/163 (62%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   YT  ++ T + P A LE QG+ T  DF A+ + N Y +LR F D   +Y 
Sbjct  27   HQVVLLPAPTYTTDDKATKYAPLAFLEDQGFATQEDFTAWRQDNGYDSLRAFNDG-ASYT  85

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             + GA F CGFT+     Q IP   A R++GYTH+GPCE+W+DD  V   DNCH  IS  
Sbjct  86   VSDGADFTCGFTNKNGDVQAIPDANAMRSTGYTHDGPCEVWLDDTMVMQYDNCHEAISGK  145

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +T  IDYS+C  TC L W+WLG+R     YSWQIYKAC+PLS
Sbjct  146  DYT--IDYSSCTSTCTLYWFWLGVRYLKNEYSWQIYKACVPLS  186

>PHYKE_9185
Length=281

 Score = 168 bits (426),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 105/167 (63%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T  N     R   W P + LEK+G KT  +F  Y   NNY +LR+FMDK
Sbjct  25   HQVVYIPSPTWTRPNSTSKERRELWNPLSFLEKEGIKTQENFTQYQVDNNYASLRDFMDK  84

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               YK + GA   CG+TDPK   Q IP+DG  RTSGYTH+GPCEI++ D       NCH 
Sbjct  85   -AKYKVSDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  143

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I++  F  K+DYSAC  +C+L WYWLG+R    SYSWQIYK CIPL
Sbjct  144  SITDQTF--KLDYSACGDSCILYWYWLGVRKLKGSYSWQIYKECIPL  188

>PPTG_14255
Length=268

 Score = 168 bits (425),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 103/167 (62%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T AN     R   W P + LEK+GY T  +F  Y   N YK+LR+FMD 
Sbjct  22   HQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKSLRDFMDN  81

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               Y    GA   CG+TDPK   Q IP+DG  RTSGYTH+GPCEI++ D       NCH 
Sbjct  82   -AKYSVTDGADQACGWTDPKGVPQQIPEDGTMRTSGYTHDGPCEIYMGDTLALSYLNCHE  140

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I++  F  K+DYSAC  +C+L WYWLG+R   K YSWQ+YK CIPL
Sbjct  141  SITDQTF--KLDYSACGDSCVLYWYWLGVRYLKKKYSWQVYKECIPL  185

>PYVX_18174
Length=204

 Score = 166 bits (419),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 108/166 (65%), Gaps = 10/166 (6%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +R+  + P A LE QG++T  DFNA+ ++N YKTLR FMD+  +Y 
Sbjct  28   HQYVILPEPTWTTTDRDVWYAPLAFLEDQGFETVEDFNAWRRSNGYKTLRAFMDQ-ASYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDIS--  144
               GA   CGFT+     QPIP +  FR++GYTH+GPCEIW+D  RV   DNCH  IS  
Sbjct  87   VTDGADQTCGFTEIDGTPQPIPAN--FRSTGYTHDGPCEIWLDSTRVYANDNCHEAISGK  144

Query  145  ETAFTDKIDYS-ACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            +TA    IDYS    GTC L WYW+G+R    +YSWQ+YK C+PLS
Sbjct  145  DTA----IDYSXXXXGTCTLYWYWMGVRYLNNAYSWQVYKNCVPLS  186

>PHYCA_510817
Length=188

 Score = 165 bits (417),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 102/167 (61%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T  N     R   W P + LEK+G+KT  +F  Y   N YK+LR+FM+K
Sbjct  23   HQVVYVPSPTWTRPNSTSKERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMEK  82

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               YK + GA   CG++DPK   Q IP DG  RTSGYTH+GPCEIW+ D       NCH 
Sbjct  83   -AKYKVSDGADQACGWSDPKGIPQQIPSDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHE  141

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I E  F  K+DYS C  +C+L WYWLG+R     YSWQ+YK CIPL
Sbjct  142  SIPEQTF--KLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPL  186

>PHALS_03284
Length=188

 Score = 164 bits (415),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 101/163 (62%), Gaps = 3/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ + LP+  +   +++T + P A LE Q + T+ADF  YLK NNY +LR+F+ K   Y 
Sbjct  14   HQIILLPEPQWKTNDKDTKYNPLAFLENQNFPTSADFGGYLKKNNYNSLRDFL-KRANYT  72

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA  +CGFTDP    QPIP     R +GYTH+G CE+W+DD +V  G NCH D    
Sbjct  73   VTEGADRDCGFTDPNGTPQPIPAGNNMRFTGYTHDGLCEMWLDDTKVLSGSNCHNDFPGK  132

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
                 +DYS+CK  C++ WYWL +R     YSWQ+YKACIPL+
Sbjct  133  DC--PVDYSSCKDNCVMYWYWLAVRLLKNEYSWQVYKACIPLT  173

>PHYSO_417649
Length=185

 Score = 162 bits (411),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 104/167 (62%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T AN     R   W P + LEK+G+KT  +F  Y   N YK+LR+FM++
Sbjct  21   HQVVYVPSPTWTRANSTASERRELWNPLSFLEKEGFKTQENFTQYQVDNGYKSLRDFMER  80

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               YK   GA   CG+TDPK   Q IP+DG  RTSGYTH+GPCEI++ D       NCH 
Sbjct  81   -AKYKLTDGADQACGWTDPKGIPQQIPEDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  139

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I++  F  K+DYS C  +C+L WYWLG+R     +SWQ+YK CIPL
Sbjct  140  SITDQTF--KLDYSGCGDSCILYWYWLGVRKLKGKFSWQVYKECIPL  184

>PYU1_G001738
Length=226

 Score = 163 bits (412),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 98/162 (60%), Gaps = 2/162 (1%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
              +V  P+  Y V        P A LE+QG KT+AD + ++K   Y  LR  +D    Y 
Sbjct  22   QHKVLYPEPFYLVDGDEAQSAPVAHLEEQGIKTSADVSDFMKQKGYANLRAMLDDQKLYN  81

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             N  A  ECG+TDP   +QPIP   AF ++GY   GPCE+W+DD++V    NCH     T
Sbjct  82   VNPDALDECGYTDPTVESQPIPVTNAFISTGYVLNGPCEVWLDDLKVMSDMNCHTKYPGT  141

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             F   +DYS+CKG+CML+WYWLGI+P  ++YSWQ+YK C+ L
Sbjct  142  NFM--LDYSSCKGSCMLRWYWLGIQPVNETYSWQVYKVCVSL  181

>PHYSO_499978
Length=174

 Score = 159 bits (403),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 3/141 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V  P+  +T  ++ T + P A LE QG+ T  DF  +   N YKTLR+FMD  G Y 
Sbjct  28   HQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CG+TDPK   QPIP   A R++GYTH+GPCE+WID+ RV  GDNCH  I++ 
Sbjct  87   VTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADK  146

Query  147  AFTDKIDYSACKGTCMLKWYW  167
             +T  IDYSACKGTC L+WYW
Sbjct  147  GYT--IDYSACKGTCTLRWYW  165

>PHYSO_501575
Length=174

 Score = 159 bits (403),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 3/141 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V  P+  +T  ++ T + P A LE QG+ T  DF  +   N YKTLR+FMD  G Y 
Sbjct  28   HQIVLQPEPQWTTNDKETKYNPLAFLENQGFATQQDFREWRTKNGYKTLRDFMDH-GKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CG+TDPK   QPIP   A R++GYTH+GPCE+WID+ RV  GDNCH  I++ 
Sbjct  87   VTKGADFSCGWTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADK  146

Query  147  AFTDKIDYSACKGTCMLKWYW  167
             +T  IDYSACKGTC L+WYW
Sbjct  147  GYT--IDYSACKGTCTLRWYW  165

>PPTG_14254
Length=188

 Score = 158 bits (399),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 102/167 (61%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V +P   +T AN     R   W P + LEK+G+KT  +F  +   N YK+LR+FMD+
Sbjct  23   HQVVNVPAPTWTRANSTSKERRELWNPLSFLEKEGFKTQENFTQFQVDNGYKSLRDFMDR  82

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               YK   GA   CG+TDPK   Q IP+DG  RT+GYTH+GPCEI++ +       NCH 
Sbjct  83   -AKYKVTEGADQACGWTDPKGIPQKIPEDGTMRTTGYTHDGPCEIYMGEKLALSYLNCHE  141

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I E  F  K+DYS C  +C+L WYWLG+R     YSWQ+YK CIP+
Sbjct  142  SIPEQTF--KLDYSGCGDSCILYWYWLGVRKLKGKYSWQVYKECIPI  186

>PYVX_18176
Length=201

 Score = 156 bits (394),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 97/163 (60%), Gaps = 4/163 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +   +++  + P A LE QG+ T  DF A+   N Y +LR FMD   +Y 
Sbjct  25   HQYVILPAPTWNTDDKDVMYAPLAFLEDQGFSTQEDFTAWRSDNGYDSLRAFMDG-ASYT  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA   CG+T+    AQ +P DG  R++GYTH GPCE+W+DD  V   DNCH  IS  
Sbjct  84   VTDGADQTCGWTNKDGTAQALP-DGVMRSTGYTHVGPCEVWLDDTMVLQYDNCHDSISGK  142

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             +   +DYS+C  TC L W+W+G+R     YSWQ+YK C+PLS
Sbjct  143  TY--DLDYSSCTSTCTLYWFWMGVRYLNNEYSWQVYKNCVPLS  183

>PHYSO_343376
Length=172

 Score = 154 bits (389),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 89/131 (68%), Gaps = 3/131 (2%)

Query  37   YTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECG  96
            +T  ++ T + P A LE QG+ T  DF A+   N YKTLR+FMD  G Y    GA F CG
Sbjct  36   WTTNDKETKYNPLAFLENQGFATQQDFRAWRTKNGYKTLRDFMDH-GKYTVTKGADFSCG  94

Query  97   FTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSA  156
            +TDPK   QPIP   A R++GYTH+GPCE+WID+ RV  GDNCH  I++  +T  IDYSA
Sbjct  95   WTDPKGTPQPIPDGDAMRSTGYTHDGPCEVWIDNTRVLQGDNCHEKIADKGYT--IDYSA  152

Query  157  CKGTCMLKWYW  167
            CKGTC L+WYW
Sbjct  153  CKGTCTLRWYW  163

>PHYCA_536934
Length=983

 Score = 164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 100/167 (60%), Gaps = 8/167 (5%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T AN     R   W P + LEK+GY T  +F  Y   N YK LR+FMD 
Sbjct  39   HQVVYVPSPTWTRANSTSTERRVLWNPLSFLEKEGYTTQENFTQYQVDNGYKNLRDFMDN  98

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               Y    GA   CG++DP    Q IP+DG  RTSGYTH+GPCEIW+ D       NCH 
Sbjct  99   -AKYAVTDGADQACGWSDPNGIPQQIPEDGTMRTSGYTHDGPCEIWMGDKLALSYLNCHE  157

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I++  F  K+DYS C  +C+L WYWLG+R   K YSWQ+YK CIPL
Sbjct  158  SITDQTF--KLDYSGCGDSCILYWYWLGVRYLKKKYSWQVYKECIPL  202

>PPTG_08820
Length=250

 Score = 152 bits (385),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (62%), Gaps = 7/168 (4%)

Query  27   HQRVFLPDVVYT--VANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPG-  83
            HQ +  P+ ++   + +R+T W P A LE QG+   ADFN +   + YK LR+FMD+   
Sbjct  28   HQLILEPEPIWKPGINDRDTRWRPLAFLESQGFPCQADFNGWRAQSGYKNLRDFMDRAKY  87

Query  84   AYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDI  143
                  GA   CG T+ K P +PIPKDG  +++GYTH+GPC +++DD  V   DNCH  +
Sbjct  88   TTSVTPGADQTCGLTELKGPPRPIPKDGMMKSTGYTHDGPCAVYLDDELVLEYDNCHEKL  147

Query  144  SETAFTDKIDYSAC--KGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
               ++  KIDYS+C  KG C L W+WLGIR     +SWQ+YK C+PL+
Sbjct  148  PGKSY--KIDYSSCEKKGGCTLYWFWLGIRFVKSRWSWQVYKECVPLT  193

>PHYSO_353401
Length=146

 Score = 143 bits (361),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 88/140 (63%), Gaps = 2/140 (1%)

Query  50   AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  109
            A L++QG  T+ +  ++++ + Y +LR  +D    YK    A F+CG T PK   QPIP 
Sbjct  4    AYLQEQGVNTSIEAQSWMQEHGYASLRAMLDDESLYKVTEEALFDCGLTSPKTETQPIPS  63

Query  110  DGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169
            + +F+TSGYT +GPCE+W+DD +V  G NCH          +IDYSAC  +C L WYWLG
Sbjct  64   NSSFQTSGYTLDGPCEVWLDDTKVAAGRNCHTQFPHGQH--EIDYSACGDSCTLWWYWLG  121

Query  170  IRPTGKSYSWQIYKACIPLS  189
            I+    +YSWQ+YK C+ LS
Sbjct  122  IKYVEGAYSWQVYKNCVALS  141

>PHYSO_254168
Length=170

 Score = 144 bits (363),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 98/153 (64%), Gaps = 20/153 (13%)

Query  39   VANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFT  98
            V +++T + P A LE QG+ T   F+A  + N YKTLR+FMD+ G Y    GA + CG+T
Sbjct  28   VEDKDTKYNPLAFLEGQGFATQEGFDARRRDNGYKTLRDFMDR-GKYTVTQGADYFCGWT  86

Query  99   DPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSAC-  157
            +PK   QPIP     R++GYTH+GPCEIW+DDVRV        + S T     IDYS+C 
Sbjct  87   NPKGTPQPIP-----RSTGYTHDGPCEIWLDDVRV-------LERSPT-----IDYSSCE  129

Query  158  -KGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             KG C + WYWLG+R    SYSWQ+YK CIPL+
Sbjct  130  KKGGCTMHWYWLGVRFLKNSYSWQVYKECIPLT  162

>PITG_10499
Length=323

 Score = 148 bits (374),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 95/154 (62%), Gaps = 5/154 (3%)

Query  39   VANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPG-AYKPNSGATFECGF  97
            + +R+T W P A LE QG+    DFN +   N YK LR+FMD+         GA   CG 
Sbjct  12   INDRDTRWRPLAFLESQGFPCQEDFNGWRAKNGYKDLRDFMDRAKYVTSVTPGADQTCGL  71

Query  98   TDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSAC  157
            T+ K P +PIPKDGA R++GYTH+GPC I++DD  V   DNCH  I    +  KID+S+C
Sbjct  72   TELKGPPRPIPKDGAMRSTGYTHDGPCAIYLDDELVMEYDNCHESIPGRTY--KIDFSSC  129

Query  158  --KGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
              KG C L W+WLGIR     +SWQ+YK CI L+
Sbjct  130  QKKGGCTLYWFWLGIRFVKSRWSWQVYKECISLT  163

>PITG_13520
Length=171

 Score = 142 bits (359),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 87/132 (66%), Gaps = 3/132 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+KT  DF A+   N YK+LR+FMD+   Y 
Sbjct  28   HQIVLLPEPQWTTQDKDTKYNPLAFLENQGFKTQQDFKAWRDENGYKSLRDFMDR-AKYD  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP  GA R++GYTH+GPCE+W+DD  V  GDNCH      
Sbjct  87   VTSGADFSCGFTDPKGTPQPIPAGGAMRSTGYTHDGPCEVWLDDKMVLDGDNCHEKFPGK  146

Query  147  AFTDKIDYSACK  158
             +T  +DYS+CK
Sbjct  147  DYT--VDYSSCK  156

>PHYSO_262732
Length=188

 Score = 143 bits (360),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 93/167 (56%), Gaps = 22/167 (13%)

Query  27   HQRVFLPDVVYTVAN-----RNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V++P   +T AN     R   W P A LE QG++T               LR+FMD 
Sbjct  22   HQVVYIPSPTWTRANSTAAERRELWNPLAFLENQGFQTH--------------LRDFMDN  67

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
               Y    GA   CG+TDPK  AQ IP DG  RTSGYTH+GPCEI++ D       NCH 
Sbjct  68   -AKYTVTEGADQACGWTDPKGIAQQIPSDGTMRTSGYTHDGPCEIYMGDKLALSYLNCHE  126

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             I++  F  K+DYS C  +C L WYWLG+R     YSWQ+YK CIP+
Sbjct  127  SITDQTF--KLDYSGCGDSCTLYWYWLGVRFLNNKYSWQVYKECIPI  171

>PPTG_17123
Length=201

 Score = 143 bits (360),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 93/162 (57%), Gaps = 2/162 (1%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87
            Q V  P   + V   +      A L++QG  T+ +  ++++ + Y +LR  +D    YK 
Sbjct  37   QVVLHPPPFFVVDGLDFQGMALAYLQEQGVNTSIEAQSWMQQHGYTSLRAMLDDESLYKV  96

Query  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147
               A FECG T P+   QPIP + +F+TSGYT +GPCE+W+DD +V  G NCH +     
Sbjct  97   TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEVWLDDTKVSSGRNCHTEFPHGQ  156

Query  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
               ++DYS+C   C L WYWLGI+     YSWQ+YK C+ LS
Sbjct  157  --HEVDYSSCGKACTLSWYWLGIKYIEGIYSWQVYKNCVGLS  196

>PYIW_18788
Length=244

 Score = 144 bits (364),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 97/164 (59%), Gaps = 3/164 (2%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            + +V  P+  + +     +    A+LE Q   T+AD   +LK   Y +LR  +D    Y 
Sbjct  27   NMKVTYPEPFFLLDGDYESAASVARLEDQNVTTSADVAGFLKQKGYASLRAMLDDETLYD  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
             N  + FECG+TDP   +QPIP +G  R +GY  +GPCEIWIDD+++    NC  D   T
Sbjct  87   VNIDSIFECGYTDPTYESQPIPTNGKLRFTGYMKDGPCEIWIDDLKLLSSANCKKDFPGT  146

Query  147  AFTDKIDYSACKGTCMLKWYWLGI-RPTGKSYSWQIYKACIPLS  189
            +   K+DYS+CKG C L+WY L + + TG SYSW++YK C+ LS
Sbjct  147  S--TKLDYSSCKGECTLRWYALSVSKTTGGSYSWEVYKNCVALS  188

>PHYRA_81105
Length=201

 Score = 141 bits (356),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 92/161 (57%), Gaps = 2/161 (1%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87
            Q V  P   + V   +      A L++QG  T+ +   +++ + Y +LR  +D    Y+ 
Sbjct  37   QIVLHPPPFFIVDGLDFQGMALAYLQEQGVNTSIEAQGWMQQHGYASLRSMLDDESLYQV  96

Query  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147
               A F+CG T PK   Q IP + +F++SGYT +GPCE+W+DD +   G NCH +     
Sbjct  97   TEEAIFDCGLTSPKTETQLIPTNSSFQSSGYTLDGPCEVWLDDTKAAAGRNCHTEFPHG-  155

Query  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
               +IDYSAC   CML+WYWLGI+    +YSWQ+YK CI L
Sbjct  156  -QHQIDYSACGAACMLRWYWLGIKYVEGAYSWQVYKNCIAL  195

>PHYCA_537323
Length=200

 Score = 141 bits (356),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 88/139 (63%), Gaps = 2/139 (1%)

Query  50   AKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  109
            A L++QG  T+ +  ++++ + Y +LR  +D    Y+    A FECG T PK   QPIP 
Sbjct  58   AYLQEQGVNTSIEAQSWMEQHGYTSLRAMLDDESLYQVTEEAIFECGLTSPKTETQPIPT  117

Query  110  DGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169
            + +F+TSGYT +GPCE+W+DD +V  G NCH +  +     ++DYS+C  +C L WYWLG
Sbjct  118  NNSFQTSGYTLDGPCEVWLDDTKVSAGRNCHTEFPQGQ--HQVDYSSCGESCTLSWYWLG  175

Query  170  IRPTGKSYSWQIYKACIPL  188
            I+     YSWQ+YK C+ L
Sbjct  176  IKYVEGIYSWQVYKNCVGL  194

>PITG_18452
Length=856

 Score = 147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 94/162 (58%), Gaps = 2/162 (1%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87
            Q V  P   + V   +      A L++QG  T+ +  ++++   Y +LR  +D    YK 
Sbjct  692  QIVLHPPPFFVVDGLDFQGMALAYLQEQGINTSIEAQSWMQQQGYSSLRAMLDDESLYKV  751

Query  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETA  147
               A FECG T P+   QPIP + +F+TSGYT +GPCEIW+DD +V  G NCH +     
Sbjct  752  TEEAIFECGLTSPRTETQPIPTNNSFQTSGYTLDGPCEIWLDDTKVASGRNCHTEFPHG-  810

Query  148  FTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
               ++DYS+C G+C L WYWLGI+     YSWQ+YK C+ LS
Sbjct  811  -QHQVDYSSCGGSCHLSWYWLGIKYVEGIYSWQVYKNCVGLS  851

>PHYSO_527908
Length=174

 Score = 134 bits (336),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query  27   HQRVFLPDVVYTVANRNTN-----WGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            HQ V +P   +T AN  +      W P A LE QG+ T A+F  ++  N YK+LR+FMD 
Sbjct  22   HQVVHVPTPTWTRANSTSAECQELWKPLAFLEGQGFTTQANFTQFMVDNGYKSLRDFMDN  81

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
             G Y    GA   CG+TDP    Q IP+DG  RTSG+TH+ PCEI++ D       NCH 
Sbjct  82   -GNYSVTKGADQACGWTDPNGIPQQIPEDGTMRTSGFTHDDPCEIYMGDKLSLSYPNCHE  140

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIR  171
             I+   F  K+DYSAC  +C+L WYWLG+R
Sbjct  141  SITSQPF--KLDYSACGDSCVLYWYWLGVR  168

>PYAP_18131
Length=226

 Score = 132 bits (332),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 7/114 (6%)

Query  79   MDKPGAYKPNS-GATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRV---K  134
            MD    YK  + GATFECG TDP  P QPIPK+G  R++G+TH+G   +WID+ RV   K
Sbjct  1    MDDKANYKVEAAGATFECGNTDPNGPRQPIPKNGMMRSTGFTHDG--HVWIDNTRVLGSK  58

Query  135  HGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             G NCH  I +   + KID+S CKG CM++WYWLG+R  GK +SWQ+YKACIP+
Sbjct  59   LG-NCHKSIGQGMISYKIDFSKCKGDCMIRWYWLGMRLLGKKWSWQVYKACIPI  111

>HYAP_07096
Length=251

 Score = 125 bits (313),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 88/162 (54%), Gaps = 3/162 (2%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKP  87
            Q V  P   + V +        A L++QG  T+ +  ++ + + Y +LR  +D    Y  
Sbjct  86   QVVLYPSPHFIVDDPTIQGKALAYLQEQGIDTSIEAQSWKQEHGYVSLRAMLDDQSLYHV  145

Query  88   NSGATFECGFTD-PKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
            +  A F+CGFT  P    Q IP +G   +SGYT +GPCE+W DD +V  G NC  +    
Sbjct  146  SKDAIFDCGFTSLPSETWQDIPTNGTLESSGYTLDGPCEVWFDDTQVTSGRNCRTEFPHG  205

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
                ++DYS+C  +C L+WYWLGI+     YSWQ+YK CI L
Sbjct  206  Q--HQVDYSSCGDSCTLRWYWLGIQYMDGIYSWQVYKNCIGL  245

>PHYSO_341596
Length=231

 Score = 123 bits (309),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 74/114 (65%), Gaps = 9/114 (8%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V L        +++T + P A LE QG++T  DF ++   N YK+LR+FMDK   Y 
Sbjct  28   HQIVLL--------DKDTKYNPLAFLENQGFETQEDFASWRDKNGYKSLRDFMDK-AKYT  78

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCH  140
              SGA F CGFTDPK   QPIP   A R++GYTH+GPCE+W+DD +V  GDNCH
Sbjct  79   VTSGADFSCGFTDPKGTPQPIPAGDAMRSTGYTHDGPCEVWLDDTKVLEGDNCH  132

>PHYCA_14368
Length=219

 Score = 119 bits (299),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 82/163 (50%), Gaps = 48/163 (29%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  +++T + P A LE QG+KT  DF ++   NNYK+LR+FMD    Y 
Sbjct  28   HQIVLLPEPQWTTNDKDTKYNPLAFLENQGFKTQQDFASWRTENNYKSLRDFMDN-AKYT  86

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
               GA F CGFTDPK                YT                           
Sbjct  87   VTDGADFSCGFTDPK---------------DYT---------------------------  104

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
                 +DYS+CKGTC L+WYWLGIR     YSWQ+YKACIPLS
Sbjct  105  -----VDYSSCKGTCTLRWYWLGIRFLKNQYSWQVYKACIPLS  142

>PHYSO_340369
Length=200

 Score = 117 bits (293),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 87/167 (52%), Gaps = 22/167 (13%)

Query  27   HQRVFLPDVVYTVANRNTN-----WGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDK  81
            +Q V +P   +T AN  T+     W P A  E QG+ T+++F  +   N +KTLR+FMD 
Sbjct  25   NQVVHIPAPTWTAANSTTDEQRKLWMPLAYQEDQGFNTSSNFTQWQLTNGFKTLRDFMDN  84

Query  82   PGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF  141
             G Y   S               Q IP D   RT GYT +GPCEIW+D+       +C  
Sbjct  85   -GNYSVTS--------------PQQIPDDNIMRTYGYTRDGPCEIWLDNTLAYSSVDCLV  129

Query  142  DISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             +    +T  +DYS C  +C++ WY LG+    + YSW++YK CIPL
Sbjct  130  SLPNMTYT--LDYSGCGASCVMYWYTLGVAKPDRVYSWEVYKECIPL  174

>PHYSO_342364
Length=194

 Score = 113 bits (282),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 77/138 (56%), Gaps = 13/138 (9%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   FN+   ++NYK LR  +D    Y PN      CG+T+P    QPIP +G A  + 
Sbjct  61   KSVQVFNSLKTSHNYKDLRTLLDNTAVYGPN------CGYTNPNGTPQPIPTNGKAIFSR  114

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSACK--GTCMLKWYWLGI  170
            G  H GPCEIW+DD +V   D+C+     +    K    +DYS CK  G CM+++YWLG 
Sbjct  115  GLIHTGPCEIWLDDKKVMAADDCYSKYGHSNVNVKTEFPVDYSYCKAKGGCMMRFYWLGF  174

Query  171  RPTGKSYSWQIYKACIPL  188
            +  GK   WQ YK CIPL
Sbjct  175  QALGKKTVWQTYKNCIPL  192

>PYU1_G007476
Length=195

 Score = 110 bits (275),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 84/170 (49%), Gaps = 19/170 (11%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKT----TADFNAYLKANNYKTLREFMDKP  82
            H  +  P V +      +NW  + K    G+ +      DF    K   YKTLR F++  
Sbjct  26   HGYIRQPLVAFKGGRTTSNWIKEDKPAWAGFSSWNNYMNDFARISKQKGYKTLRSFLENK  85

Query  83   GAYKPNSGATFECGFTDPKAPAQPIPKDG----AFRTSGYTHEGPCEIWIDDVRVKHGDN  138
            GA          CG+T+P    + IP+DG    A    G+ H GPCE+W+D+  + H DN
Sbjct  86   GA---------SCGYTEPNTTPRAIPRDGKVIFAHSNVGFVHPGPCELWLDNKMILHKDN  136

Query  139  CHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            C            +D+S+CKGTCML+ YWLG +  G+   WQ YK C+P+
Sbjct  137  CQKAFPGVKAVMPVDFSSCKGTCMLRMYWLGFQDQGQ--RWQTYKYCVPV  184

>PYU1_G005323
Length=251

 Score = 110 bits (276),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 79/135 (59%), Gaps = 15/135 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A + A      YK L+ F++  G           CG + P A A+PIP DG  +  
Sbjct  54   FRTGAQYAAVAPGKGYKDLKSFLEDKGPV---------CGNSLPDAKAKPIPSDGVIKLA  104

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCE+W DDVR  H D+C     S T+F  K+D+SACKG+CML++YWLG++  G
Sbjct  105  STIEHAGPCEVWFDDVRAFHDDDCEKTFGSATSF--KVDFSACKGSCMLRFYWLGLQDGG  162

Query  175  KSYSWQIYKACIPLS  189
            K   WQ YK CIPL+
Sbjct  163  K--RWQSYKNCIPLT  175

>PHYSO_246676
Length=187

 Score = 107 bits (267),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 80/163 (49%), Gaps = 41/163 (25%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP+  +T  ++ T + P A LE QG+KT  DF A+ K N Y+TLR+FMDK   Y 
Sbjct  11   HQIVLLPEPQWTTNDKVTKYNPLAFLENQGFKTQEDFAAWRKENGYQTLRDFMDK-AKYD  69

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISET  146
              SGA F CGFTDPK   QPIP+    R++GYTH+G                        
Sbjct  70   VTSGADFSCGFTDPKGTPQPIPEGNKMRSTGYTHDG------------------------  105

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
                            L    L +     SYSW++YKACIPLS
Sbjct  106  ----------------LVHASLVLDGMKNSYSWKVYKACIPLS  132

>PYIW_27477
Length=180

 Score = 106 bits (265),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 73/127 (57%), Gaps = 12/127 (9%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K  A+F    K   ++TLR +++  GA         +CG TDP A A+ IP D   + S
Sbjct  35   WKDPANFAKVSKEKGFETLRSYIEDKGA---------KCGKTDPNAKAKAIPSDNVVKFS  85

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
                H GPCE+WIDD RV   DNC         T KID+SACKG CML+W+WLG++ +GK
Sbjct  86   RAIVHPGPCELWIDDTRVMQDDNCEKTFGSKIPTWKIDFSACKGKCMLRWFWLGLQDSGK  145

Query  176  SYSWQIY  182
               WQ+Y
Sbjct  146  --RWQVY  150

>PYIR_16435
Length=304

 Score = 108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 73/129 (57%), Gaps = 12/129 (9%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS-GYT  119
            A+F    K   Y TLR +++  G           CG T+P A  + IP D   + S    
Sbjct  65   ANFATVSKEKGYSTLRSYIEDKGTL---------CGRTNPDATPKAIPSDNTVKFSRAIV  115

Query  120  HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSW  179
            H GPCE+W+DD RV   DNC         T KID+S+CKG+CML+W+WLG++ +G+   W
Sbjct  116  HPGPCELWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGE--RW  173

Query  180  QIYKACIPL  188
            Q+YK C+PL
Sbjct  174  QVYKNCVPL  182

>PYU1_G005324
Length=191

 Score = 104 bits (260),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A + A      YK L+ F+D  G           CG T   A A+ IPKDG  +  
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCEIW+ + R  H D+C     S T+F  KID+SACKG CML++YWLG++  G
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSF--KIDFSACKGNCMLRFYWLGLQDGG  163

Query  175  KSYSWQIYKACIPL  188
            K   WQ YK C+PL
Sbjct  164  K--RWQSYKNCVPL  175

>PYU1_G005326
Length=191

 Score = 104 bits (260),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A + A      YK L+ F+D  G           CG T   A A+ IPKDG  +  
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCEIW+ + R  H D+C     S T+F  KID+SACKG CML++YWLG++  G
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSF--KIDFSACKGNCMLRFYWLGLQDGG  163

Query  175  KSYSWQIYKACIPL  188
            K   WQ YK C+PL
Sbjct  164  K--RWQSYKNCVPL  175

>PYU1_G005328
Length=191

 Score = 104 bits (260),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A + A      YK L+ F+D  G           CG T   A A+ IPKDG  +  
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCEIW+ + R  H D+C     S T+F  KID+SACKG CML++YWLG++  G
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSF--KIDFSACKGNCMLRFYWLGLQDGG  163

Query  175  KSYSWQIYKACIPL  188
            K   WQ YK C+PL
Sbjct  164  K--RWQSYKNCVPL  175

>PYU1_G005325
Length=207

 Score = 105 bits (261),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 75/134 (56%), Gaps = 15/134 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A + A      YK L+ F+D  G           CG T   A A+ IPKDG  +  
Sbjct  55   FRTGAQYAAVAPKKGYKDLKSFLDSKGP---------TCGNTLSNAKAKAIPKDGMLKFA  105

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCEIW+ + R  H D+C     S T+F  KID+SACKG CML++YWLG++  G
Sbjct  106  SSMEHPGPCEIWLGNTRAFHNDDCEKTFGSATSF--KIDFSACKGNCMLRFYWLGLQDGG  163

Query  175  KSYSWQIYKACIPL  188
            K   WQ YK CIPL
Sbjct  164  K--RWQSYKNCIPL  175

>PYAP_18709
Length=235

 Score = 105 bits (261),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 89/168 (53%), Gaps = 18/168 (11%)

Query  27   HQRVFL--PDVVYTVANRNTNWGPQAKLEKQG-YKTTADFNAYLKANNYKTLREFMDKPG  83
            H  V+L  P   +      ++W  + +    G +KT A + A      +K LR F++  G
Sbjct  21   HAHVYLTQPLAEFKAGASKSSWVAEFQPPWSGEFKTGAQYAAVAPGKGFKDLRSFLEDKG  80

Query  84   AYKPNSGATFECGFTDPKAPAQPIPKDGAFR-TSGYTHEGPCEIWIDDVRVKHGDNCHFD  142
                       CG + P A  +PIP DG  +  S   H GPCE+W+D+ R  H D+C   
Sbjct  81   P---------TCGNSLPNASPKPIPSDGTIKLASTIEHAGPCEVWLDNTRAFHNDDCEKA  131

Query  143  I-SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
              S T+F  K+D+ ACKG+CML++YWLG++  GK   WQ YK CIPL+
Sbjct  132  FGSATSF--KMDFLACKGSCMLRFYWLGLQDGGK--RWQSYKNCIPLN  175

>PYIW_18792
Length=125

 Score = 101 bits (251),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYK  86
            HQ V LP   +TV  R   + P A LE QGYK TADF AY K+  YK LR FMD   AYK
Sbjct  24   HQYVSLPAPTWTVKTRAEQFNPLAFLEGQGYKCTADFTAYYKSKGYKNLRGFMDDKKAYK  83

Query  87   PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEI  126
             + G  FECG++  K   QPIP  GA R++GYTH+GP  I
Sbjct  84   VD-GGNFECGWSSLKGTPQPIPAGGALRSTGYTHDGPFGI  122

>PYIW_19151
Length=248

 Score = 104 bits (259),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (57%), Gaps = 22/139 (16%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K   +F A  K   + TLR +++  GA          CGFTDPK   + IP D   R S
Sbjct  55   WKDPKNFAAAAKEKGFSTLRSYLEDKGAV---------CGFTDPKVSPRAIPADRTIRFS  105

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKI-----DYSACKGTCMLKWYWLGI  170
                H GPCE++IDD RV   D+C     E+AFT  I     D+S CKG CM+++YWLG+
Sbjct  106  RDIPHPGPCELYIDDTRVYQNDDC-----ESAFTGVIPSWDVDWSLCKGECMIRFYWLGL  160

Query  171  RPTGKSYSWQIYKACIPLS  189
            + +G    WQ+YK+C+P+S
Sbjct  161  QASGT--RWQVYKSCVPVS  177

>PYIR_16444
Length=182

 Score = 102 bits (254),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 12/133 (9%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K   +F    K   + TLR +++  GA          CG T+ KA  +PIP DG    S
Sbjct  58   WKDPKNFAKVAKQKGFPTLRSYIENKGAI---------CGKTNAKATPKPIPSDGKVHFS  108

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
                H GPCE+W+D+ RV   DNC           KID+S+CKG CML+++WLG++  GK
Sbjct  109  RAIVHPGPCELWLDNKRVYQNDNCEGVFGSKIPVWKIDWSSCKGNCMLRFFWLGLQDQGK  168

Query  176  SYSWQIYKACIPL  188
               WQ+YK C+P+
Sbjct  169  --RWQVYKNCVPV  179

>PYAP_24689
Length=252

 Score = 102 bits (254),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 77/133 (58%), Gaps = 15/133 (11%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-TS  116
            +T A ++A  K +  KTLR F++  G           CG T+P A  +PIP+DG  +  S
Sbjct  59   RTGAQYDAVRKKHGVKTLRAFLESKGPV---------CGSTNPNAKRKPIPRDGLIKFGS  109

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
               H GPCEIW D+ RV    +C+    S T F  KIDYS C+G C+L++YWLG++  GK
Sbjct  110  SMEHPGPCEIWFDNTRVFVDADCNKRFGSATQF--KIDYSKCRGKCLLRFYWLGLQDGGK  167

Query  176  SYSWQIYKACIPL  188
               WQ YK C+PL
Sbjct  168  --RWQSYKNCVPL  178

>PYIR_16443
Length=275

 Score = 102 bits (254),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 74/131 (56%), Gaps = 13/131 (10%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K   +F    K   ++TLR +++  GA          CG T+P A  + IP D   + S
Sbjct  58   WKDPKNFATVSKQKGFETLRSYIEDKGAL---------CGRTNPNASPKAIPSDSVVKFS  108

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
                H GPCEIW+DD RV   DNC         T KID+S+CKG+CML+W+WLG++ +GK
Sbjct  109  RAIVHPGPCEIWLDDKRVMQDDNCEGTFGSKIPTWKIDFSSCKGSCMLRWFWLGLQDSGK  168

Query  176  SYSWQIY-KAC  185
               WQ+Y K+C
Sbjct  169  --RWQVYSKSC  177

>PHYSO_533903
Length=208

 Score = 100 bits (249),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 77/139 (55%), Gaps = 14/139 (10%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   F +   ANN+K L+  +D    Y P      +CGFTDP    QPIP DG A  + 
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSR  115

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSACK-GTC-MLKWYWLGI  170
            G  H GPCE W+DD +V + D+C+ +   +    K    IDYS+C+ G C M+++YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  171  RPT-GKSYSWQIYKACIPL  188
            +    K   WQ YK CIPL
Sbjct  176  QALDDKKTVWQTYKDCIPL  194

>PYAP_18711
Length=210

 Score = 100 bits (248),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 15/134 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            ++T A ++A  K    K LR F++  G          ECG T+P A  +PIP DG  +  
Sbjct  55   FRTGAQYDAERKKRGIKNLRAFLESKGP---------ECGRTNPNAKRKPIPSDGLIKFG  105

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            S   H GPCE+W D+  V    +C     S T F  KIDYS CKG CML++YWLG++  G
Sbjct  106  SSMEHPGPCEVWFDNTLVFSEVDCEKRFGSATQF--KIDYSKCKGNCMLRFYWLGLQDGG  163

Query  175  KSYSWQIYKACIPL  188
            K   WQ YK C+P+
Sbjct  164  K--RWQSYKNCVPI  175

>PYAR_14260
Length=212

 Score = 99.0 bits (245),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 73/133 (55%), Gaps = 13/133 (10%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR-T  115
            +KT A + A      +K LR F++  G           CG +   A  +PIP DG  +  
Sbjct  31   FKTGAQYAAVAPGKGFKNLRSFLESKGPT---------CGNSLSSAKPKPIPSDGMVKFA  81

Query  116  SGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
            S   H GPCEIW+D+    H D+C      +  + K+++SACKG+CML++YWLG++ +G 
Sbjct  82   STLEHPGPCEIWLDETMAFHSDDCEKQFGSST-SVKVNFSACKGSCMLRFYWLGLQDSGT  140

Query  176  SYSWQIYKACIPL  188
               WQ YK C+PL
Sbjct  141  --RWQSYKNCVPL  151

>PHYCA_12942
Length=353

 Score = 101 bits (251),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 61/101 (60%), Gaps = 10/101 (10%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAF  148
            +CG+T   AP QPIP DG  +       G+TH+GPCEI+IDD  V HGDNC  +      
Sbjct  83   KCGYTVADAPPQPIPSDGMVKWAGNGGGGFTHQGPCEIYIDDKMVLHGDNCEEEFKGGDT  142

Query  149  TD-KIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +D KIDYS+C G CML  YWLG +    +  WQ Y  C+PL
Sbjct  143  SDMKIDYSSCNGNCMLTIYWLGFQ----NAQWQAYVNCVPL  179

>PYU1_G014690
Length=295

 Score = 99.0 bits (245),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 12/133 (9%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K  A+F    K   + TLR +++  GA          CG TDP A  + IP D     S
Sbjct  57   WKDPANFAKVSKEKGFDTLRSYIEDKGAL---------CGKTDPNATPKAIPSDNKVHFS  107

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
                H GPCEIW+DD RV   D+C     +      ID+S+CK  CML+++WLG++ +G 
Sbjct  108  RPIVHPGPCEIWLDDKRVMQDDDCEATFGDEIPVWNIDFSSCKSNCMLRFFWLGLQDSG-  166

Query  176  SYSWQIYKACIPL  188
               WQ+YK C+PL
Sbjct  167  -TRWQVYKNCVPL  178

>PYAR_14256
Length=199

 Score = 95.5 bits (236),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 14/133 (11%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            ++T A + A      +K LR F++  G           CG T P A  +P         S
Sbjct  51   FRTGAQYAAVAPDKGFKNLRAFLEDKGP---------TCGNTLPNAKPKPXXXXLIKLAS  101

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDI-SETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
               H GPCEIW+DD    H D+C     S T+F  K+D+SACKG+CML++YWLG++ +GK
Sbjct  102  TIEHPGPCEIWLDDSLAFHDDDCEKKFGSATSF--KVDFSACKGSCMLRFYWLGLQNSGK  159

Query  176  SYSWQIYKACIPL  188
               WQ YK CIPL
Sbjct  160  --RWQSYKNCIPL  170

>PITG_11936
Length=333

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 82/177 (46%), Gaps = 20/177 (11%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  +  P V +T    NT +       K G+           TA+FN    A+ YK+L+E
Sbjct  24   HGYMTAPKVEFTFNGDNTQYMATIDASKSGFSGIFGGSPTDNTANFNKGFAASKYKSLKE  83

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD------GAFRTSGYTHEGPCEIWIDDV  131
            FM+       N   T ECG+T+P A  QP+PK       GA      +HEGPCE++ D+ 
Sbjct  84   FMND-NMVLVNEDFTKECGYTNPDATPQPLPKTYVEWSHGAGEGFTLSHEGPCEVYCDET  142

Query  132  RVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            RV   DNC  +          D+ AC G+  L  YW+ +     S SWQ+Y  C PL
Sbjct  143  RVFQDDNCPKNFPAAPAKLPFDHDACLGSSQLSIYWIALH----SPSWQVYINCAPL  195

>PYIR_23585
Length=240

 Score = 95.5 bits (236),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 78/164 (48%), Gaps = 13/164 (8%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK-TTADFNAYLKANNYKTLREFMDKPGAY  85
            H  +  P   +      ++W  +      G K + ADF        + T R F++  G  
Sbjct  25   HGYIATPKSEFKSGASQSSWVAEFSSPWGGSKWSAADFAKTAPGKGFATTRAFLESRGP-  83

Query  86   KPNSGATFECGFTDPKAPAQPIPKDGAFRTS-GYTHEGPCEIWIDDVRVKHGDNCHFDIS  144
                     CG T   A  +PIP D   + S    H GPCE+WID+ RV H D+C     
Sbjct  84   --------TCGNTLANASPKPIPSDNTVKFSRAIVHPGPCELWIDNTRVYHNDDCEAAFG  135

Query  145  ETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             +  T KID+SACKG+CML++YWLG++  G  +  Q Y  C+ L
Sbjct  136  SSIPTWKIDFSACKGSCMLRFYWLGLQDGGARF--QSYSKCLAL  177

>PHYCA_130365
Length=266

 Score = 95.9 bits (237),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 70/136 (51%), Gaps = 13/136 (10%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYT  119
            A F     +NNYK +R  MD    Y        +CGFTDP       P DG A  + G  
Sbjct  64   ATFKELAASNNYKDVRSMMDGNSVYGE------DCGFTDPNGTPVDPPTDGTATFSRGIV  117

Query  120  HEGPCEIWIDDVRVKHGDNCHF---DISETAFT--DKIDYSAC-KGTCMLKWYWLGIRPT  173
            H GPCEIW+DD  V   D+C     D ++   +    +DYS+C  G CML++YWLG++  
Sbjct  118  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQDTISVFKPVDYSSCASGGCMLRFYWLGLQRL  177

Query  174  GKSYSWQIYKACIPLS  189
                 WQ YK CIPL+
Sbjct  178  DGKTVWQAYKNCIPLT  193

>PYAP_18713
Length=184

 Score = 93.6 bits (231),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 68/131 (52%), Gaps = 12/131 (9%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +KT A +    K   +K LR F++  G           CG T+P A  + +P D     S
Sbjct  57   FKTGAQYAVVAKDKGFKDLRSFLEDKGP---------ACGKTNPNAKPRNVPSDSKVVFS  107

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
                H GPCE+WIDD  V H D+C  +  +      +D+S+CKG CML++YWLG++ +GK
Sbjct  108  RPMVHRGPCELWIDDTMVYHNDDCELEFGKKVPVFPVDFSSCKGKCMLRFYWLGLQDSGK  167

Query  176  SYSWQIYKACI  186
               WQ Y   I
Sbjct  168  --RWQSYSTYI  176

>PHYSO_483955
Length=320

 Score = 96.7 bits (239),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 69/136 (51%), Gaps = 13/136 (10%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYT  119
            A F     ANNYK +R  MD    Y        +CGFTDPK      P DG A  + G  
Sbjct  65   ATFKELSAANNYKDVRSLMDGNPVYG------EDCGFTDPKGKPVAPPTDGTATFSRGIV  118

Query  120  HEGPCEIWIDDVRVKHGDNCHF----DISET-AFTDKIDYSAC-KGTCMLKWYWLGIRPT  173
            H GPCEIW+DD  V   D+C         ET A    +DYS+C  G CML++YWL ++  
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  174  GKSYSWQIYKACIPLS  189
                 WQ YK CIPL+
Sbjct  179  DGKTVWQAYKNCIPLT  194

>PHYRA_78176
Length=312

 Score = 95.1 bits (235),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 83/177 (47%), Gaps = 20/177 (11%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  +  P V +   N  T +    +    G+           TA F    ++++Y +L+E
Sbjct  25   HGYLSDPAVTFLTTNDPTQFIATIEATASGFSGTFNGAPADNTAAFTTAFESSSYSSLKE  84

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWIDDV  131
            F+D        + AT  CG  DP   AQP+P+         + G+T  HEGPCE+W DDV
Sbjct  85   FIDDKATITV-TDATLTCGACDPDETAQPLPETYVEWAHSDSEGFTASHEGPCEVWCDDV  143

Query  132  RVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            RV   D+C  D +        D+ AC G+ +L +YWL +     S +WQ+Y  C PL
Sbjct  144  RVFQDDDCAADFTTAPAQLPYDHDACLGSSVLTFYWLALH----SSTWQVYVNCAPL  196

>PHYCA_127270
Length=279

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 75/136 (55%), Gaps = 19/136 (14%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F +   ANN+K L+  MD    Y    GA  +CGFTDP    QPIP DG A  +    H 
Sbjct  66   FKSLKAANNFKDLKTLMDDTSVY----GA--DCGFTDPNGTPQPIPTDGKATFSRALVHV  119

Query  122  GPCEIWIDDVRVKHGDNC-------HFDISETAFTDKIDYSAC-KGTC-MLKWYWLGIRP  172
            GPCEIW+DD +V + D+C       + DI ++ F   +DYS+C  G C  +++YWL  + 
Sbjct  120  GPCEIWLDDKKVLYEDDCFSKYGNKNQDI-KSVF--PVDYSSCDNGGCKQMRFYWLAFQG  176

Query  173  TGKSYSWQIYKACIPL  188
              K   WQ YK CIPL
Sbjct  177  LSKKTVWQSYKDCIPL  192

>PITG_05271
Length=278

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 75/136 (55%), Gaps = 19/136 (14%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F A   AN +K L+  MD    Y    GA  +CGFTDP   AQPIPKDG A  +    H 
Sbjct  66   FKALKTANKFKDLKTLMDDTSVY----GA--DCGFTDPNGKAQPIPKDGKATFSRALVHV  119

Query  122  GPCEIWIDDVRVKHGDNC-------HFDISETAFTDKIDYSAC-KGTCM-LKWYWLGIRP  172
            GPCEIW+DD +V + D+C       + DI ++ F   +DYS+C  G C  +++YWL  + 
Sbjct  120  GPCEIWLDDTKVLYEDDCFSKYGNENQDI-KSVF--PVDYSSCDNGGCKEMRFYWLAFQG  176

Query  173  TGKSYSWQIYKACIPL  188
                  WQ YK CIPL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PPTG_04618
Length=326

 Score = 94.0 bits (232),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 69/136 (51%), Gaps = 13/136 (10%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYT  119
            A F      NNYK +R  MD    Y        +CGFTDPK      P DG A  + G  
Sbjct  65   ATFKELAPKNNYKDVRSLMDGNPVYG------EDCGFTDPKGTPSEPPSDGTATFSRGIV  118

Query  120  HEGPCEIWIDDVRVKHGDNCHF---DISETAFT--DKIDYSAC-KGTCMLKWYWLGIRPT  173
            H GPCEIW+DD  V   D+C     D ++   +    +DYS+C  G CML++YWL ++  
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQKTISVFKPVDYSSCASGGCMLRFYWLALQRL  178

Query  174  GKSYSWQIYKACIPLS  189
                 WQ YK CIPL+
Sbjct  179  DGKTVWQAYKNCIPLT  194

>PITG_04949
Length=337

 Score = 93.6 bits (231),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 67/136 (49%), Gaps = 13/136 (10%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYT  119
            A F      NN+K +R  MD       N     ECGFTDPK      P DG A  + G  
Sbjct  65   ATFKELAPKNNFKDVRSLMDG------NPVFGEECGFTDPKGKPSEPPSDGTATFSRGIV  118

Query  120  HEGPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACK-GTCMLKWYWLGIRPT  173
            H GPCEIW+DD  V   D+C     +      A    +DYS+C  G CML++YWL ++  
Sbjct  119  HAGPCEIWLDDKMVLQNDDCQSAYGDGTQQTIAVFKPVDYSSCAAGGCMLRFYWLALQRL  178

Query  174  GKSYSWQIYKACIPLS  189
                 WQ YK CIPL+
Sbjct  179  KGKTVWQAYKNCIPLT  194

>PHYKE_6001
Length=289

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 70/138 (51%), Gaps = 13/138 (9%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            ++   FNA  KANNY  L+  MD    Y    GA  +CGFTDP    QPIP DG A  + 
Sbjct  61   QSVTAFNALKKANNYVDLKTLMDDTSVY----GA--DCGFTDPNGTPQPIPSDGKATYSR  114

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSACKGTCM--LKWYWLGI  170
               H GPCEIW+DD  V   ++C+          K    +DYS+C G     +++YWL  
Sbjct  115  AIQHVGPCEIWLDDKMVFSDEDCYAKYGNENVDVKSVFPVDYSSCDGGGCKEMRFYWLAF  174

Query  171  RPTGKSYSWQIYKACIPL  188
            +       WQ YK CIPL
Sbjct  175  QGVDGKTVWQSYKNCIPL  192

>PHYKE_6077
Length=322

 Score = 93.2 bits (230),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 81/177 (46%), Gaps = 20/177 (11%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  +  P V +T+    T +         G+           TA+FN  + A+ Y +L+E
Sbjct  24   HGYMSAPPVEFTLVGDTTQYMGSIDAATSGFSGEFGGAPKDNTANFNKGMAASKYTSLKE  83

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD------GAFRTSGYTHEGPCEIWIDDV  131
            FM    A   +   T ECG+T+PK  AQP+P+       G+      +HEGPCE+W DD 
Sbjct  84   FMAA-KAKVTSPEFTLECGYTNPKGAAQPLPETYVEWSHGSGEGFTSSHEGPCEVWCDDT  142

Query  132  RVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            RV   DNC  +          D  AC G+ +L  YW+ +     S SWQ+Y  C  L
Sbjct  143  RVFQDDNCPANFPTAPAKLPYDREACLGSSVLTLYWIALH----SPSWQVYINCAAL  195

>PHYCA_534296
Length=309

 Score = 92.8 bits (229),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 71/133 (53%), Gaps = 13/133 (10%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F +   ANN+K L+  MD    Y    GA  +CGFT+P   AQPIP DG A  +    H 
Sbjct  40   FKSLKSANNFKDLKTLMDDTSVY----GA--DCGFTNPSGTAQPIPTDGKATFSRALVHV  93

Query  122  GPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSAC-KGTCM-LKWYWLGIRPTGK  175
            GPCEIW+DD +V + D+C+          K    +DYS+C  G C  +++YWL  +    
Sbjct  94   GPCEIWLDDTKVLYEDDCYSKYGNENQDIKSIFPVDYSSCDNGGCKEMRFYWLAFQGVDG  153

Query  176  SYSWQIYKACIPL  188
               WQ YK CIPL
Sbjct  154  KTVWQSYKDCIPL  166

>PPTG_03138
Length=294

 Score = 92.4 bits (228),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    +++++ +L+E +++       S AT  CG  DP   AQP+P          +
Sbjct  66   TAAFTKAFESSSFSSLKELINEKATLTV-SDATLTCGSCDPDETAQPLPDTYVEWAHSDS  124

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCEIW DDVRV  GD+C  D +        D+ AC G+ +L +YWL +   
Sbjct  125  EGFTASHEGPCEIWCDDVRVFQGDDCAADYTTAPAKLPYDHDACLGSSVLTFYWLALH--  182

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PHYSO_533747
Length=206

 Score = 90.5 bits (223),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 73/137 (53%), Gaps = 14/137 (10%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   F +   ANN+K L+  +D    Y P      +CGFTDP    QPIP DG A  + 
Sbjct  62   KSVEVFKSLKVANNFKDLKTMLDDTSLYGP------DCGFTDPNGTPQPIPTDGKAVFSR  115

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSACK-GTC-MLKWYWLGI  170
            G  H GPCE W+DD +V + D+C+ +   +    K    IDYS+C+ G C M+++YWLG 
Sbjct  116  GLIHTGPCEFWLDDKKVLYADDCYSEYGHSNVNVKTEFPIDYSSCENGGCKMMRFYWLGF  175

Query  171  RPT-GKSYSWQIYKACI  186
            +    K   WQ Y   +
Sbjct  176  QALDDKKTVWQTYSTLL  192

>PHALS_03176
Length=207

 Score = 90.5 bits (223),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 70/138 (51%), Gaps = 14/138 (10%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   F     AN +K L+  MD        S    +CGF+DPK   QPIPKDG A  + 
Sbjct  61   KSVKTFQKLKAANKFKDLKTLMD-------TSAFGAKCGFSDPKGKPQPIPKDGKATFSR  113

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSAC-KGTCM-LKWYWLGI  170
               H GPCEIW+D+ +V + D+C+          K    +DYS+C  G C  +++YWL  
Sbjct  114  AIVHTGPCEIWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKEMRFYWLAF  173

Query  171  RPTGKSYSWQIYKACIPL  188
            +       WQ YK CIPL
Sbjct  174  QGVNGKTVWQSYKNCIPL  191

>CCI47381
Length=211

 Score = 90.5 bits (223),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 75/149 (50%), Gaps = 21/149 (14%)

Query  49   QAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIP  108
              K +      TA F     ++ ++TLR+F+   G Y         CG T+P A  +PIP
Sbjct  49   SGKFDGSPKDNTATFLTAFASSPFRTLRDFLKDKGPY---------CGSTNPNASPKPIP  99

Query  109  KDGAF------RTSGY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGT  160
             D A          G+  +H GPCE+W+ + RV + DNC    + +     I++S+C G 
Sbjct  100  ADNAIVWENPDTREGFVASHMGPCEVWLGETRVFYDDNCAGHFTSSPARIPINFSSCSGG  159

Query  161  CMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            C+L+++WL +        WQ+YK CIP++
Sbjct  160  CLLQFFWLALH----EPQWQVYKNCIPIA  184

>PYAR_20617
Length=254

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 82/167 (49%), Gaps = 18/167 (11%)

Query  27   HQRVFL--PDVVYTVANRNTNWGPQAKLEKQG-YKTTADFNAYLKANNYKTLREFMDKPG  83
            H  V+L  P   +      ++W  + K   +G +KT A + A  KA     LR F++  G
Sbjct  22   HAHVYLTEPLAEFPKGASKSSWVAEFKPAWEGTFKTGAQYAAKAKAEGIPDLRTFLEDKG  81

Query  84   AYKPNSGATFECGFTDPKAPAQPIPKDGAFR-TSGYTHEGPCEIWIDDVRVKHGDNCHFD  142
                       CG +   A  + IP  G     S   H GPCE+W DDV   H D+C   
Sbjct  82   PV---------CGNSLKDATPKAIPASGKISLASTIEHAGPCEVWFDDVLAFHDDDCEKT  132

Query  143  I-SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              S T+F   +D+S C G+C+L++YWLG++  GK   WQ YK C+PL
Sbjct  133  FGSATSFA--VDFSKCSGSCLLRFYWLGLQDGGK--RWQSYKNCVPL  175

>PYIR_19612
Length=260

 Score = 91.3 bits (225),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 73/140 (52%), Gaps = 18/140 (13%)

Query  57   YKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS  116
            +K   +F    K   + TLR +++  GA          CGFTDP    + IP D   R S
Sbjct  57   WKDPKNFATAAKEKGFATLRSYLEDKGA---------TCGFTDPNVAPRAIPADRKVRFS  107

Query  117  -GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
               +H GPCE+WIDD RV   D+C    +    +  +D++ C G CM+++YWL ++ +G 
Sbjct  108  RDISHPGPCELWIDDKRVYQNDDCESAFTGVVPSWDVDWALCSGKCMIRFYWLSLQASGT  167

Query  176  SYSWQIYKA------CIPLS  189
               WQ+Y++      C+P+S
Sbjct  168  --RWQVYRSELTRDLCVPVS  185

>PHYKE_10578
Length=239

 Score = 90.9 bits (224),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 59/107 (55%), Gaps = 15/107 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAF-----RTSGYTHEGPCEIWIDDVRVKHGDNCHF------D  142
            +CGFT   A  QP+P DG         +G+TH GPCE++IDD  V HGDNC        D
Sbjct  85   KCGFTRADADPQPVPSDGKLVWRGSGNNGFTHTGPCEVYIDDKLVLHGDNCEDEYPGGPD  144

Query  143  ISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             S       IDYS+C G CML +YWLG +    +  WQ Y  C+PL+
Sbjct  145  ESGKLSEMTIDYSSCNGDCMLSFYWLGFQ----NEQWQSYVNCVPLT  187

>PYU1_G001519
Length=265

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 70/138 (51%), Gaps = 11/138 (8%)

Query  56   GYKTTADFNAYLKA----NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG  111
            G    ++ NAYLKA      YK+L++      A K  SGAT ECGF+D     QP+P   
Sbjct  60   GTDPLSNTNAYLKAFKAQTKYKSLKDLA-MSDAQKVESGATKECGFSDVNGTPQPLPDTV  118

Query  112  AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIR  171
             +     +H GPCE+W DDV V   DNC  +I E     K D + C G  ML  +W+ + 
Sbjct  119  QWDRFDNSHMGPCEVWCDDVMVFQDDNCSVNIPEVPAVLKYDKAKCVGKKMLTSFWIALH  178

Query  172  -PTGKSYSWQIYKACIPL  188
             PT     WQIY  C P+
Sbjct  179  VPT-----WQIYTNCAPI  191

>PHYSO_340332
Length=295

 Score = 91.7 bits (226),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 19/136 (14%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F A   ANN+K L+  MD    Y    GA  +CGFTDP    QPIP DG A  +    H 
Sbjct  66   FKALKTANNFKDLKTLMDDTSVY----GA--DCGFTDPNGTPQPIPTDGKATFSRAIVHV  119

Query  122  GPCEIWIDDVRVKHGDNC-------HFDISETAFTDKIDYSAC-KGTCM-LKWYWLGIRP  172
            GPCEIW+DD +V + D+C       + DI ++ F   +DYS+C  G C  +++YWL  + 
Sbjct  120  GPCEIWLDDKKVLYEDDCFSKYGNENQDI-KSVF--PVDYSSCDNGGCKEMRFYWLAFQG  176

Query  173  TGKSYSWQIYKACIPL  188
                  WQ YK CIPL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PYIR_22134
Length=300

 Score = 92.0 bits (227),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 84/180 (47%), Gaps = 24/180 (13%)

Query  27   HQRVFLPDVVYTVANRNTNW-----GPQAKLEKQGYKTTAD-------FNAYLKANNYKT  74
            H  + +P   +T++   T +     GP       G   T D       F A LKA+ Y +
Sbjct  29   HGYMSIPKPTFTISGDTTQFSGTIDGPSTLTAPTGMSFTTDPESNTNAFTAALKASTYDS  88

Query  75   LREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWI  128
            +R  ++  G +   SGAT ECG T     AQP+P          + G+T  H+GPCE+W 
Sbjct  89   VRALVEAKGVFI--SGATKECGITSATGTAQPLPAKYVEWSHSSSEGFTPSHQGPCEVWC  146

Query  129  DDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            D+ +V   +NC  +         ID++ C GT +LK  WL +     S +WQIY  C PL
Sbjct  147  DNNKVFSDENCAKNYPAAPAELPIDHAQCVGTSLLKIVWLALH----SSTWQIYINCAPL  202

>PHALS_03177
Length=259

 Score = 91.3 bits (225),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 14/138 (10%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   F +   ANN+K L+  MD P   +       +CG++DP    QPIPKDG A  + 
Sbjct  61   KSVKAFQSLKAANNFKDLKTLMDNPVLGR-------DCGYSDPNGKPQPIPKDGKATFSR  113

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSAC-KGTC-MLKWYWLGI  170
               H GPCE+W+D+ +V + D+C+          K    +DYS+C  G C  +++YWL  
Sbjct  114  AMVHTGPCEMWLDNKKVLYEDDCYSKYGNVDVNIKSVFPVDYSSCANGGCKQMRFYWLAF  173

Query  171  RPTGKSYSWQIYKACIPL  188
            +       WQ YK CIPL
Sbjct  174  QGINGKTFWQSYKMCIPL  191

>PHYSO_340333
Length=284

 Score = 91.3 bits (225),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 74/136 (54%), Gaps = 19/136 (14%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F A   ANN+K L+  MD    Y    GA  +CGFTDP    QPIP DG A  +    H 
Sbjct  66   FKALKTANNFKDLKTLMDDTSVY----GA--DCGFTDPNGTPQPIPTDGKATFSRAIVHV  119

Query  122  GPCEIWIDDVRVKHGDNC-------HFDISETAFTDKIDYSAC-KGTCM-LKWYWLGIRP  172
            GPCEIW+DD +V + D+C       + DI ++ F   +DYS+C  G C  +++YWL  + 
Sbjct  120  GPCEIWLDDKKVLYEDDCFSKYGNENQDI-KSVF--PVDYSSCDNGGCKEMRFYWLAFQG  176

Query  173  TGKSYSWQIYKACIPL  188
                  WQ YK CIPL
Sbjct  177  VDGKTVWQSYKDCIPL  192

>PHYRA_78689
Length=296

 Score = 91.7 bits (226),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 74/136 (54%), Gaps = 19/136 (14%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F +   ANN+K L+  MD    Y    GA  +CGFTDP    QPIP DG A  +    H 
Sbjct  66   FKSLKTANNFKDLKTLMDDTSVY----GA--DCGFTDPDGTPQPIPTDGKATFSRALVHV  119

Query  122  GPCEIWIDDVRVKHGDNC-------HFDISETAFTDKIDYSACK-GTC-MLKWYWLGIRP  172
            GPCEIW+DD +V + D+C       + DI ++ F   +DYS+C  G C  +++YWL  + 
Sbjct  120  GPCEIWLDDTKVLYEDDCFSKYGNENQDI-KSVF--PVDYSSCNSGGCKQMRFYWLAFQG  176

Query  173  TGKSYSWQIYKACIPL  188
                  WQ YK CIPL
Sbjct  177  LDSKTVWQSYKDCIPL  192

>PHYSO_438103
Length=238

 Score = 90.1 bits (222),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 86/179 (48%), Gaps = 27/179 (15%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQA-------KLEKQGYKTTADFNAYLKANNYKTLREFM  79
            H  + +P+  +T    N+ W  Q        K +     +   F +   ANN+K L+  M
Sbjct  23   HGYMLIPESQFT-GGANSAWVVQIDPVWASDKWDGNNAGSVEVFKSLKSANNFKDLKTLM  81

Query  80   DKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDN  138
            D    Y        +CGFTDP    QPIP DG A  +    H GPCEIW+D+ +V + D+
Sbjct  82   DDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRALVHVGPCEIWLDNTKVLYEDD  135

Query  139  C-------HFDISETAFTDKIDYSACK-GTCM-LKWYWLGIRPTGKSYSWQIYKACIPL  188
            C       + DI ++ F   +DYS+C  G C  +++YWL  +       WQ YK CIPL
Sbjct  136  CFSKYGNENQDI-KSVF--PVDYSSCNHGGCKEMRFYWLAFQGLDSKTVWQSYKDCIPL  191

>PHYRA_73607
Length=343

 Score = 91.7 bits (226),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 14/138 (10%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGY  118
            T  +++   +N Y  +R  +D   +     GA  +CGFT+P A A+  P  G A  + G 
Sbjct  66   TTLYSSLKSSNGYSDIRTLLDSDTSLY---GA--DCGFTNPDATAKDPPTTGDATFSRGM  120

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISE------TAFTDKIDYSACKGT-CMLKWYWLGIR  171
             H GPCEIW+DD +V   DNC     +      + FT  +DYS+C  + CML++YWL  +
Sbjct  121  VHVGPCEIWLDDTKVLSNDNCLAAYGDGTQDTASVFT-PVDYSSCSTSGCMLRFYWLAFQ  179

Query  172  PTGKSYSWQIYKACIPLS  189
                S  WQ+YK C+PL+
Sbjct  180  GVDSSMVWQVYKNCVPLT  197

>PYVX_22508
Length=298

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    +A++Y +L+E +   G     SG T  CG TDP   AQ +P          T
Sbjct  51   TASFTTAFEASDYTSLKEMVTDLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSST  110

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCEIW DD RV   D+C    +        D  AC G   L +YWL +   
Sbjct  111  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAQLPYDRDACLGASQLTFYWLALH--  168

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C  L
Sbjct  169  --SSTWQVYINCAAL  181

>PHYKE_2809
Length=291

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 67/128 (52%), Gaps = 12/128 (9%)

Query  69   ANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS-GYTHEGPCEIW  127
            ANN K +R  +D             +CGFTDPKA  +  P DGA   S G  H GPCEIW
Sbjct  60   ANNVKDIRTMLDSDTKLYGQ-----DCGFTDPKATPKDPPTDGAATFSRGIVHAGPCEIW  114

Query  128  IDDVRVKHGDNCHF----DISETAFTDK-IDYSACK-GTCMLKWYWLGIRPTGKSYSWQI  181
            +DD  V   D+C         ET    K +DYS+C  G CM ++YWL ++       WQ+
Sbjct  115  LDDKMVLQNDDCQSAYGDGTKETISVFKPVDYSSCAAGGCMFRFYWLALQSLDGKKFWQV  174

Query  182  YKACIPLS  189
            YK C+PLS
Sbjct  175  YKNCVPLS  182

>CCA17179
Length=185

 Score = 87.4 bits (215),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 72/149 (48%), Gaps = 21/149 (14%)

Query  49   QAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIP  108
              K +      TA F     ++ ++ LR+F+   G Y         CG T+P A  +PIP
Sbjct  23   SGKFDGAPIDNTATFLNAFASSPFQNLRDFLKDKGPY---------CGSTNPNAQPKPIP  73

Query  109  KDGAF------RTSGY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGT  160
             D A          G+  +H GPCE+W+++ RV H DNC      +     ID+S C   
Sbjct  74   ADHAIVWENPDTKEGFVASHMGPCEVWLNENRVFHDDNCAEHFRSSPARIPIDFSTCTNG  133

Query  161  CMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            C+L+++WL +        WQ+YK CIP++
Sbjct  134  CLLQFFWLALH----EPQWQVYKNCIPIA  158

>PHYRA_73582
Length=326

 Score = 90.1 bits (222),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 66/134 (49%), Gaps = 14/134 (10%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F      NNYK L+  MD P   +       +CGFTDP       P DG A  + G  H 
Sbjct  67   FKELSATNNYKDLKTLMDGPEFGE-------DCGFTDPNGTPSDPPTDGTATFSRGIVHA  119

Query  122  GPCEIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSAC-KGTCMLKWYWLGIRPTGK  175
            GPCEIW+DD  V   D+C         ET    K +DYS C  G C+L++YWL ++    
Sbjct  120  GPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSGCAAGGCLLRFYWLALQRLDG  179

Query  176  SYSWQIYKACIPLS  189
               WQ YK CIPL+
Sbjct  180  KAVWQSYKNCIPLT  193

>PHYCA_98479
Length=276

 Score = 89.4 bits (220),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 60/110 (55%), Gaps = 15/110 (14%)

Query  90   GATFECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCH----  140
            G+  ECG T      QP+P DG  +       G+TH GPCEI+IDD  V HGDNC     
Sbjct  81   GSGKECGHTLADGSRQPVPTDGLAKWLGNGGGGFTHVGPCEIYIDDTMVLHGDNCEDEYP  140

Query  141  -FDISETAFTDK-IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              D+  T  +D  +DYS+CKG C L  YWLG     ++  WQ Y  C+PL
Sbjct  141  GGDVGSTVTSDMPVDYSSCKGDCTLTIYWLGF----QNAQWQAYINCVPL  186

>PHYRA_78175
Length=319

 Score = 90.1 bits (222),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 81/180 (45%), Gaps = 26/180 (14%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  + +P V +T     T +         G+           TA+FN    A+ Y +L+E
Sbjct  24   HGSMSVPKVEFTFVGDTTQYMGTIDSSTSGFTGTFGGSPTDNTANFNKGFAASKYSSLKE  83

Query  78   FM-DKPGAYKPNSGATFECGFTDPKAPAQPIPK--------DGAFRTSGYTHEGPCEIWI  128
            FM DK      N   T ECG+T+P   AQP+PK        DG   T+  +HEGPCE+W 
Sbjct  84   FMADK--LVLVNKEFTKECGYTNPDEAAQPVPKTYVEWSHGDGEGFTA--SHEGPCEVWC  139

Query  129  DDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            DD RV   DNC  +          D  AC G+  L  YW+ +     S SWQ+Y  C  L
Sbjct  140  DDTRVFQDDNCPKNFPTAPAKLPYDRDACLGSSGLSIYWIALH----SASWQVYINCAAL  195

>PITG_04948
Length=232

 Score = 88.2 bits (217),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 75/132 (57%), Gaps = 15/132 (11%)

Query  67   LKA-NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPC  124
            LKA NN K +R  +D   +     GA  +CG+T+P    +  P DG A  + G  H GPC
Sbjct  70   LKASNNAKDIRTLLDSDTSLY---GA--DCGYTNPDVSPKDPPTDGTATFSRGIVHAGPC  124

Query  125  EIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSAC-KGTCMLKWYWLGI-RPTGKSY  177
            EIW+DD  V   D+C         ET    K +DYS+C  G CML++YWL + R  GK+Y
Sbjct  125  EIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMLRFYWLALQRLDGKTY  184

Query  178  SWQIYKACIPLS  189
             WQ+YK CIPLS
Sbjct  185  -WQVYKNCIPLS  195

>PPTG_14221
Length=275

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 70/138 (51%), Gaps = 13/138 (9%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            K+   F +   ANN+K L+  MD    Y    GA  +CGFT+P    QPIP DG A  + 
Sbjct  61   KSVDTFKSLKAANNFKDLKTLMDDTSVY----GA--DCGFTNPNGTPQPIPTDGKATFSR  114

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSACK-GTC-MLKWYWLGI  170
               H GPC IW+DD  V + D+C           K    +DYS+C  G C  +++YWL  
Sbjct  115  ALVHHGPCGIWLDDKMVLYEDDCFAKYGNENQDIKSIFPVDYSSCNNGGCKQMRFYWLAF  174

Query  171  RPTGKSYSWQIYKACIPL  188
            +   K   WQ YK CIPL
Sbjct  175  QGLNKKTVWQSYKDCIPL  192

>PHYRA_79140
Length=424

 Score = 90.9 bits (224),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 57/106 (54%), Gaps = 15/106 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCH-----FDIS  144
            CG TD  A  QPIP DG  +       G+TH GPCEI++DD  V H DNC       D+ 
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGNGGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  ETAFTD-KIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             T  +D  +DYS+C G C L  YWL  +    +  WQ Y  C+PLS
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQ----NAQWQAYVNCVPLS  187

>PHYSO_533682
Length=278

 Score = 89.0 bits (219),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 68/133 (51%), Gaps = 13/133 (10%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F ++   NN+K L+  MD    Y        +CGFTDP    QPIP DG A  + G  H 
Sbjct  66   FTSFKSVNNFKDLKTLMDDTSVYGQ------DCGFTDPNGTPQPIPTDGKATFSRGLIHV  119

Query  122  GPCEIWIDDVRVKHGDNCHFDI----SETAFTDKIDYSAC-KGTCM-LKWYWLGIRPTGK  175
            GPCEIW+DD +V   D+C+        +   T  +DYS+C  G C  ++ Y LG +    
Sbjct  120  GPCEIWLDDNKVLSEDDCYSKYGNPNQDVITTFPVDYSSCNNGGCKEMRCYCLGFQGLVD  179

Query  176  SYSWQIYKACIPL  188
               WQ YK CIPL
Sbjct  180  KTVWQSYKNCIPL  192

>PHYSO_459106
Length=223

 Score = 87.4 bits (215),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 65/129 (50%), Gaps = 12/129 (9%)

Query  68   KANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEI  126
            KANN K +R  +D             +CGFTDPK   Q  P  G A  + G  H GPCEI
Sbjct  72   KANNVKDIRTMIDSDTKLYGE-----DCGFTDPKGKPQDPPTTGDATFSRGIVHAGPCEI  126

Query  127  WIDDVRVKHGDNCHFDISE-----TAFTDKIDYSAC-KGTCMLKWYWLGIRPTGKSYSWQ  180
            W+DD  V   D+C     +      +    +DYS+C  G CM ++YWL ++       WQ
Sbjct  127  WLDDKMVLQNDDCQSAYGDGTKATLSVFKPVDYSSCASGGCMFRFYWLALQRRDSKTYWQ  186

Query  181  IYKACIPLS  189
            +YK CIPL+
Sbjct  187  VYKNCIPLT  195

>PHYCA_19611
Length=531

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 81/181 (45%), Gaps = 28/181 (15%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  + +P V +T     T +         G+           TA+FN  + A+ Y +L+E
Sbjct  231  HGYMSVPKVEFTFVGDTTQYMATIDSSTSGFSGQFGGSPADNTANFNKGMAASKYTSLKE  290

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPK--------DGAFRTSGYT--HEGPCEIW  127
            FM+       N   T ECG+T+PK   QP+PK        DG     G+T  HEGPCE+W
Sbjct  291  FMNDKMVLV-NKEFTKECGYTNPKEAPQPVPKTYVEWSHGDG----EGFTQSHEGPCEVW  345

Query  128  IDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIP  187
             DD RV   DNC  +          D  AC G+  L  YW+ +     S SWQ+Y  C  
Sbjct  346  CDDTRVFQDDNCPKNFPMIPAKMPYDRDACLGSSQLTIYWIALH----SPSWQVYINCAA  401

Query  188  L  188
            L
Sbjct  402  L  402

 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 45/129 (35%), Gaps = 28/129 (22%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYT  119
            TA F    +A+ YK+L+E ++  G  K  +                        R    T
Sbjct  40   TAAFTKGFEASKYKSLKEVINDLGKTKLRN------------------------RFQRRT  75

Query  120  HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSW  179
              GP  +      +   DNC  +          D  AC G   L +YWL +     S +W
Sbjct  76   SNGPTVVAKALPPLTKDDNCAANYPTAPAKVPYDRDACLGASRLTFYWLALH----SSTW  131

Query  180  QIYKACIPL  188
            Q+Y  C  L
Sbjct  132  QVYTNCAAL  140

>PHYCA_69583
Length=224

 Score = 87.0 bits (214),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 60/104 (58%), Gaps = 9/104 (9%)

Query  95   CGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNC--HFDI----SETA  147
            CGF++P A A+  P DG A    G  H GPCEIW+DD  V H D+C   F +    S  +
Sbjct  96   CGFSNPDAKAKDPPSDGTATFERGLAHHGPCEIWLDDAMVLHNDDCAKAFSVPDYMSIKS  155

Query  148  FTDKIDYSACKGT-CMLKWYWLGIR-PTGKSYSWQIYKACIPLS  189
                IDYS+C  + CM ++YWL  +  T   Y WQIYK CIPL+
Sbjct  156  VFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYKDCIPLT  199

>PHYRA_74651
Length=344

 Score = 89.4 bits (220),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 12/134 (9%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSGYTHE  121
            + +  ++N Y  +R  +D   +     GA  +CGFTDP A P  P     A  + G  H 
Sbjct  69   YTSLKESNGYSDIRTLLDSDTSLY---GA--DCGFTDPNATPKDPPSTGDATFSRGMVHA  123

Query  122  GPCEIWIDDVRVKHGDNC---HFDISE--TAFTDKIDYSAC-KGTCMLKWYWLGIRPTGK  175
            GPCEIW+DD +V   DNC   + D ++   +    +DYS+C  G C L++YWL  +    
Sbjct  124  GPCEIWLDDTKVLSNDNCMPAYGDGTQEKASVFSPVDYSSCPSGGCTLRFYWLAFQGLDS  183

Query  176  SYSWQIYKACIPLS  189
            S  WQ+YK C+PL+
Sbjct  184  STVWQVYKNCVPLT  197

>PHALS_05392
Length=367

 Score = 89.4 bits (220),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 64/134 (48%), Gaps = 13/134 (10%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSGYTHE  121
            F     ANN+K +R  MD    Y        +CG+TDP   P  P     A  + G  H 
Sbjct  150  FKELATANNFKDVRSLMDGNPVYGE------DCGYTDPNGTPVAPPSNGEATFSRGIVHA  203

Query  122  GPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACKGT-CMLKWYWLGIRPTGK  175
            GPCEIW+DD  V   D+C     +      A    +DYS+C    CML++YWL ++    
Sbjct  204  GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAIFKPVDYSSCAADGCMLRFYWLALQRLDG  263

Query  176  SYSWQIYKACIPLS  189
               WQ YK CIPL+
Sbjct  264  KTVWQAYKNCIPLN  277

>PYVX_14662
Length=540

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 74/155 (48%), Gaps = 22/155 (14%)

Query  50   AKLEKQGYKTTADFNAYLKANNYKTL---------REFMDKPGAYKPNSGATFECGFTDP  100
             ++E Q    + D N     + YK+L         R  +D    Y  +      CGFTDP
Sbjct  45   VQIEPQWASDSWDGNNQGSVDTYKSLAAEKGVTEIRSLLDDTSIYGQD------CGFTDP  98

Query  101  KAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHF----DISETAFTDKIDYS  155
               AQ IP DG A  + G  H GPCEIW+DD  V H D+C+     D  +      +DYS
Sbjct  99   DGTAQDIPTDGKATFSRGMVHVGPCEIWLDDTMVLHDDDCYSTYGGDDQDVKSVFPVDYS  158

Query  156  ACK-GTCM-LKWYWLGIRPTGKSYSWQIYKACIPL  188
            +C  G C  +++YWL  +       WQ+YK CIPL
Sbjct  159  SCNSGGCKEMRFYWLAFQGVDGDTVWQVYKNCIPL  193

>PHYRA_73584
Length=287

 Score = 88.2 bits (217),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 72/139 (52%), Gaps = 16/139 (12%)

Query  60   TADFNAYLKANNYKTLREFMDKPGA-YKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSG  117
            T  +++  K+N Y  +R  +D     Y  N      CGFT+P A A+  P  G A  + G
Sbjct  63   TTLYSSLKKSNGYSDIRTLLDSDTTLYGAN------CGFTNPDATAKDPPTTGDATFSRG  116

Query  118  YTHEGPCEIWIDDVRVKHGDNCHFDISE------TAFTDKIDYSACKGT-CMLKWYWLGI  170
              H GPCEIW+DD  V   D+C     +      + FT  +DYS+C  + CML++YWL  
Sbjct  117  MVHAGPCEIWLDDTLVLSNDDCQTAYGDGSQEKASVFT-PVDYSSCSSSGCMLRFYWLAF  175

Query  171  RPTGKSYSWQIYKACIPLS  189
            +       WQ+YK C+PL+
Sbjct  176  QGVDSKTVWQVYKDCVPLT  194

>PPTG_04622
Length=273

 Score = 87.8 bits (216),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 70/143 (49%), Gaps = 24/143 (17%)

Query  60   TADFNAYLKANNYKTLREFMDK-PGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSG  117
            T  + +  ++N Y  +R  +D     Y  N      CGFTDP A P  P     A  + G
Sbjct  66   TTLYTSLKESNGYSDIRALLDSDTDLYGAN------CGFTDPDATPKDPPTTGDATFSRG  119

Query  118  YTHEGPCEIWIDDVRVKHGDNCHFDISETAFTD----------KIDYSACK-GTCMLKWY  166
              H GPCEIW+DD  V   D+C     +TA+ D           +DYS+C  G CML++Y
Sbjct  120  MVHAGPCEIWLDDTMVLSNDDC-----QTAYGDGTQDKASVFTPVDYSSCSTGGCMLRFY  174

Query  167  WLGIRPTGKSYSWQIYKACIPLS  189
            WL  +       WQ+YK C+PL+
Sbjct  175  WLAFQGVDSKMVWQVYKDCVPLT  197

>PHYKE_6076
Length=272

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 88/207 (43%), Gaps = 20/207 (10%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  + +P V +T     T +    +    G+           TA F    +++ Y +L+E
Sbjct  24   HGYMSVPKVEFTFVGDTTQFMATIEASATGWSGSFGGSPADNTAAFTTAFESSKYSSLKE  83

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWIDDV  131
             +   G     S  T ECG+T+P   AQP+P          + G+T  HEGPCE+W DDV
Sbjct  84   LVTDLGKLTSTSYTT-ECGYTNPDETAQPLPDTYVEWAHSDSEGFTPSHEGPCEVWCDDV  142

Query  132  RVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLSan  191
            RV   D+C    +        D+ AC G+  L  YWL +     S +WQ+Y  C  L + 
Sbjct  143  RVFQDDDCAAHYTTAPAKLPYDHDACLGSSRLTLYWLALH----SSTWQVYTNCAALEST  198

Query  192  gggaaaapntttaapaVAEKPVAGEAS  218
                A +      + +  E    GE +
Sbjct  199  TSTGATSKYAVGGSKSTTENSATGETT  225

>PHYSO_524101
Length=308

 Score = 88.2 bits (217),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    ++++Y +L+E ++        + AT  CG  DP   AQP+P          +
Sbjct  66   TAAFTTAFESSSYSSLKELINDKATITV-TDATLTCGMCDPDETAQPLPDTYVEWAHSDS  124

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV   D+C  D +        D  AC G+  L +YWL +   
Sbjct  125  EGFTASHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGSSTLTFYWLALH--  182

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PHYRA_78174
Length=279

 Score = 87.8 bits (216),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD------GAF  113
            TA F    +A+ Y +L+E +   G    ++  T ECG+T+P   AQP+PK       G+ 
Sbjct  65   TAAFAKGFEASKYTSLKEMVSDLGKVT-SADFTMECGYTNPDETAQPLPKTYVEWAHGSG  123

Query  114  RTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
                 +HEGPCE+W DDVRV   D+C    S        D+ AC G   L +YWL +   
Sbjct  124  EGFTSSHEGPCEVWCDDVRVFQDDDCAAHYSTAPAKVPYDHDACLGASRLTFYWLALH--  181

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C  L
Sbjct  182  --SSTWQVYTNCAAL  194

>PYIW_21964
Length=265

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 79/180 (44%), Gaps = 24/180 (13%)

Query  27   HQRVFLPDVVYTVANRNTNW-----GPQAKLEKQGYKTTAD-------FNAYLKANNYKT  74
            H  + +P   + V++  T +     GP       G   T D       F A LKA+ YK+
Sbjct  25   HGYMSVPKTTFAVSDDPTQFAATMDGPSTLTAPSGMSFTGDPASNTKAFTAALKASTYKS  84

Query  75   LREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWI  128
            +R  +D    +     A  ECG T P    QP+P          + G+T  H+GPCE+W 
Sbjct  85   MRALVDDKAVFIKE--ANKECGVTSPTGAKQPLPDKYVEWSHSSSEGFTPSHQGPCEVWC  142

Query  129  DDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            DD      +NC  D +       ID++ C G  +LK  WL +     S +WQIY  C PL
Sbjct  143  DDKLAFTDENCAADYTSAPAELPIDHAKCVGASLLKIVWLALH----SSTWQIYINCAPL  198

>H310_06362
Length=197

 Score = 85.5 bits (210),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 67/129 (52%), Gaps = 22/129 (17%)

Query  69   ANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAF------RTSGY--TH  120
            A  +KTLR  +D  G          +CG+T    PA+PIP DG           G+  +H
Sbjct  49   ATGFKTLRAMLDPHGP---------DCGYTKLNVPAKPIPTDGKVVWQNPDTGEGFVPSH  99

Query  121  EGPCEIWIDDVRVKHGDNCHFDISE-TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSW  179
             GPCEIW+D+ RV   +NC  +  E  A    +D+S+C G+C +++YWL +        W
Sbjct  100  TGPCEIWLDNTRVFQNENCAANFPEKPAAQLPVDFSSCIGSCTIRFYWLALH----EDLW  155

Query  180  QIYKACIPL  188
            Q+YK C PL
Sbjct  156  QVYKNCAPL  164

>PHYRA_78177
Length=324

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F     +++Y +L++ +    A    + AT  CG  DP   AQ +P +        T
Sbjct  67   TAAFTTAFASSSYTSLKDLITGL-ATVTVTDATLTCGSCDPDETAQALPAEYVEWSHSST  125

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV H D+C  D +        D  AC GT  L +YWL +   
Sbjct  126  EGFTSSHEGPCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  183

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  184  --SSTWQVYVNCAPL  196

>PHYRA_83494
Length=224

 Score = 86.3 bits (212),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 56/106 (53%), Gaps = 15/106 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCH-----FDIS  144
            CG TD  A  Q +P DG  +       G+TH GPCEI+IDD  V HGDNC       D+ 
Sbjct  23   CGETDDSAAPQAVPTDGKAKWLGNGGGGFTHAGPCEIYIDDKMVLHGDNCEDDYPGGDVG  82

Query  145  ETAFTDK-IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             T  +D  +DYS+C G C    YWL  +    +  WQ Y  C+PL+
Sbjct  83   STVTSDMPVDYSSCNGDCTFTIYWLAFQ----NAQWQAYVNCVPLT  124

>PHYCA_19612
Length=610

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 70/135 (52%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    ++++Y +L+E ++        + AT  CG  DP   AQ +P          +
Sbjct  371  TAAFTTAFESSSYSSLKELINDKATITV-TDATLTCGACDPDETAQALPATYVEWAHSDS  429

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV  GD+C  D +        D+ AC G+ +L +YWL +   
Sbjct  430  EGFTASHEGPCEVWCDDVRVFQGDDCAADYTTAPALLPYDHDACLGSSVLTFYWLALH--  487

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  488  --SSTWQVYVNCAPL  500

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F     +++Y +L++ +         + AT  CG  +P   AQP+P          T
Sbjct  69   TAAFTKAFASSSYTSLKDLITSLATVTV-TDATLTCGSCNPDETAQPLPDKYVEWSHSST  127

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV   D+C  D +        D  AC GT  L +YWL +   
Sbjct  128  EGFTSSHEGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  185

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  186  --SSTWQVYVNCAPL  198

>PHYRA_83500
Length=394

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 56/106 (53%), Gaps = 15/106 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCH-----FDIS  144
            CG TD  A  QPIP DG  +       G+TH GPCEI++DD  V H DNC       D+ 
Sbjct  86   CGNTDDSASPQPIPSDGKAKWLGSAGGGFTHVGPCEIYLDDTMVLHSDNCQDDYPGGDVG  145

Query  145  ETAFTD-KIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
             T  +D  +DYS+C G C L  YWL  +    +  WQ Y  C PLS
Sbjct  146  STQTSDMPVDYSSCNGKCTLTIYWLAFQ----NAQWQAYVNCAPLS  187

>PHYSO_485524
Length=278

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 79/155 (51%), Gaps = 20/155 (13%)

Query  48   PQAKLEKQGYKTTADFNAYLK----ANNYKTLREFMDK-PGAYKPNSGATFECGFTDPKA  102
            PQ K +  G K      A  K    +NN K +R  +D     Y  N      CG+T+P A
Sbjct  48   PQWKGDWDGAKGDEGLVALYKELKDSNNAKDIRTLLDSDTKLYGAN------CGYTNPDA  101

Query  103  PAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSA  156
              +  P DG A  + G  H GPCEIW+DD  V   D+C         ET    K +DYS+
Sbjct  102  TPEDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSS  161

Query  157  C-KGTCMLKWYWLGI-RPTGKSYSWQIYKACIPLS  189
            C  G CM ++YWL + R  GK+Y WQ+YK CIPLS
Sbjct  162  CASGGCMFRFYWLALQRLDGKTY-WQVYKNCIPLS  195

>PPTG_04619
Length=276

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 74/132 (56%), Gaps = 15/132 (11%)

Query  67   LKA-NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPC  124
            LKA NN K +R  +D   +     GA  +CG+T+P    +  P DG A  + G  H GPC
Sbjct  70   LKASNNAKDIRTLLDSDTSLY---GA--DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPC  124

Query  125  EIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSAC-KGTCMLKWYWLGI-RPTGKSY  177
            EIW+DD  V   D+C         ET    K +DYS+C  G CM ++YWL + R  GK+Y
Sbjct  125  EIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKTY  184

Query  178  SWQIYKACIPLS  189
             WQ+YK CIPLS
Sbjct  185  -WQVYKNCIPLS  195

>PHYSO_246481
Length=318

 Score = 87.0 bits (214),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 67/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    +A++Y +L+E ++        + AT  CG  DP   AQP+P          T
Sbjct  67   TAAFTKAFEASSYTSLKELINDKATITV-TDATLTCGSCDPDETAQPLPDTYVEWSHSST  125

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G++  H GPCE+W DDVRV   D+C  D +        D  AC GT  L +YWL +   
Sbjct  126  EGFSSSHAGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  183

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  184  --SSTWQVYINCAPL  196

>PHYKE_6079
Length=302

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F     ++ Y +L+E ++   A    + AT  CG  DP   AQP+P+         +
Sbjct  67   TAAFTTAFDSSKYTSLKELINDL-ATITVTDATLTCGSCDPDETAQPLPETYVEWSHSSS  125

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV    +C  D +        D+ AC GT  L +YWL +   
Sbjct  126  EGFTSSHEGPCEVWCDDVRVFQDKDCAADYTSAPAELPYDHDACLGTSTLTFYWLALH--  183

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  184  --SSTWQVYVNCAPL  196

>PHYRA_78161
Length=373

 Score = 87.4 bits (215),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 11/135 (8%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTS  116
            A F     ++ Y +L+EF++   A    +GAT  CG  DPK  AQP+PK         + 
Sbjct  65   AAFTKAFGSSKYSSLKEFINDK-ATVTVTGATLTCGSCDPKEEAQPMPKSTMEWSHSDSE  123

Query  117  GYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            G+T  HEGPCE+W DDVR    D+C  +          D  AC G+  L +YW+ +    
Sbjct  124  GFTASHEGPCEVWCDDVRTFQDDDCPANYPMVPAQLPFDRDACMGSSTLTFYWMAMH---  180

Query  175  KSYSWQIYKACIPLS  189
             S +WQ+Y  C PL+
Sbjct  181  -SSTWQVYVNCAPLA  194

>PHYRA_78169
Length=390

 Score = 87.4 bits (215),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F     +++Y +L++ +    A    + AT  CG  DP   AQ +P +        T
Sbjct  67   TAAFTTAFASSSYTSLKDLITGL-ATVTVTDATLTCGSCDPDETAQALPAEYVEWSHSST  125

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVRV H D+C  D +        D  AC GT  L +YWL +   
Sbjct  126  EGFTSSHEGPCEVWCDDVRVFHDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  183

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  184  --SSTWQVYVNCAPL  196

>PYU1_G001527
Length=278

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 71/155 (46%), Gaps = 12/155 (8%)

Query  70   NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGP  123
            + YK++R  +D  G ++P  G   ECG T P    QP+P          + G+T  H GP
Sbjct  81   STYKSVRALVDAKGVFQP--GMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGP  138

Query  124  CEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYK  183
            CE+W D+V     DNC  +          D S C G  MLK+YWL +     S +WQ Y 
Sbjct  139  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  194

Query  184  ACIPLSangggaaaapntttaapaVAEKPVAGEAS  218
            AC PL+    G A +P           KP A  +S
Sbjct  195  ACAPLAGGSSGGATSPTVAPTTKPTTAKPAAATSS  229

>PYU1_G001523
Length=278

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 71/155 (46%), Gaps = 12/155 (8%)

Query  70   NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGP  123
            + YK++R  +D  G ++P  G   ECG T P    QP+P          + G+T  H GP
Sbjct  81   STYKSVRALVDAKGVFQP--GMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGP  138

Query  124  CEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYK  183
            CE+W D+V     DNC  +          D S C G  MLK+YWL +     S +WQ Y 
Sbjct  139  CEVWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYI  194

Query  184  ACIPLSangggaaaapntttaapaVAEKPVAGEAS  218
            AC PL+    G A +P           KP A  +S
Sbjct  195  ACAPLAGGSSGGATSPTVAPTTKPTTAKPAAATSS  229

>PYU1_G005868
Length=267

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 66/134 (49%), Gaps = 21/134 (16%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR------TS  116
            F     +++YK+LRE +D          A  +CGFT        +    + +        
Sbjct  66   FTTAFASSSYKSLREMLD---------SAVPDCGFTLTDGTPVDVSSLKSMKWQNDQEQK  116

Query  117  GY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            G+  +H GPCE+WIDD ++ H D+C  D +       +DYS CKG C L +YWL +    
Sbjct  117  GFIDSHHGPCELWIDDTKIMHSDDCRADYTAYPAEIPVDYSVCKGKCQLTFYWLALH---  173

Query  175  KSYSWQIYKACIPL  188
               +WQIYK C+P+
Sbjct  174  -EPNWQIYKQCVPI  186

>PHYKE_2937
Length=366

 Score = 87.0 bits (214),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 73/138 (53%), Gaps = 14/138 (10%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGY  118
            T  + +   +N Y  +R  +D   +     GA  +CG+T+P A A+  P  G A  + G 
Sbjct  70   TTLYTSLKSSNGYSDIRTLLDSDTSLY---GA--DCGYTNPDATAKDPPTTGDATFSRGM  124

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISE------TAFTDKIDYSACKGT-CMLKWYWLGIR  171
             H GPCEIW+DD  V   D+C     +      + FT  +DYS+C  + CML++YWL  +
Sbjct  125  VHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFT-PVDYSSCSSSGCMLRFYWLAFQ  183

Query  172  PTGKSYSWQIYKACIPLS  189
                S  WQ+YK C+PL+
Sbjct  184  GVDSSMVWQVYKDCVPLT  201

>PHYKE_3913
Length=321

 Score = 86.7 bits (213),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 83/167 (50%), Gaps = 24/167 (14%)

Query  40   ANRNTNW----GPQAKLEKQGYKTTADFNAYLK----ANNYKTLREFMDKPGA-YKPNSG  90
             + N++W     PQ K +  G K      A  K    ANN K +R   D   + Y  N  
Sbjct  63   GSENSDWVVQIDPQWKGDWAGAKGDEALVALYKELKVANNAKDIRTLFDSDTSLYGEN--  120

Query  91   ATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISE----  145
                CGFT+P A  +  P DG A  + G  H GPCEIW+DD  V   D+C     +    
Sbjct  121  ----CGFTNPDATPKDPPTDGTATFSRGIVHAGPCEIWLDDKMVLQNDDCQSAYGDGTQE  176

Query  146  -TAFTDKIDYSACK-GTCMLKWYWLGI-RPTGKSYSWQIYKACIPLS  189
              +    +DYS+C  G CM ++YW+ + R  GK+Y WQ+YK C+PL+
Sbjct  177  TISIFKPVDYSSCAAGGCMFRFYWMALQRLDGKTY-WQVYKNCVPLT  222

>SDRG_07565
Length=278

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 80/170 (47%), Gaps = 26/170 (15%)

Query  31   FLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANN-YKTLREFMDKPGAYKPNS  89
            F P+V+ T            K +    +  A F    KA + +KTLR+ ++  G      
Sbjct  91   FSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTTAFKAQSQFKTLRDMLEPQGP-----  145

Query  90   GATFECGFTDPKAPAQPIPKDGAFR------TSGY--THEGPCEIWIDDVRVKHGDNC--  139
                 CG + P A  + IP DG           G+  +H GPCE+W+DD RV   D+C  
Sbjct  146  ----ACGNSLPNASKKTIPSDGTMTWLNPDTGEGFISSHTGPCEVWLDDKRVFQDDDCPT  201

Query  140  HFDISETAFTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            HF     A    +DYS+C G+ CML++YWL +        WQ+YK C+PL
Sbjct  202  HFPQKPAAHL-PVDYSSCGGSGCMLRFYWLALH----QPQWQVYKNCVPL  246

>H257_13550
Length=266

 Score = 85.5 bits (210),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 82/172 (48%), Gaps = 29/172 (17%)

Query  31   FLPDVVYT--VANRNTNWGPQAKLEKQGYKTTADFNAYLK---ANNYKTLREFMDKPGAY  85
            F P V+ T  VA    N+    K      K  A FN   +   A  +KTLR  +D  G  
Sbjct  63   FDPTVMRTTYVATIQANF--PGKFNDSPDKNVAAFNKAFRDQQATGFKTLRAMLDPQGP-  119

Query  86   KPNSGATFECGFTDPKAPAQPIPKDGAF------RTSGY--THEGPCEIWIDDVRVKHGD  137
                    +CG++    PA+PIP DG           G+  +H GPCEIW+D+ RV   D
Sbjct  120  --------DCGYSKLDVPAKPIPSDGNVVWQNPDSGEGFVPSHTGPCEIWLDNTRVFQND  171

Query  138  NCHFDISE-TAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +C  +  E  A    +D+++C G+C +++YW+ +        WQ+YK C PL
Sbjct  172  DCATNFPEKPAAHLPVDFASCVGSCTIRFYWIALH----QDLWQVYKNCAPL  219

>PHALS_05394
Length=288

 Score = 85.9 bits (211),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/163 (36%), Positives = 78/163 (48%), Gaps = 21/163 (13%)

Query  41   NRNTNWGPQAKLEKQGY--KTTAD------FNAYLKANNYKTLREFMDKPGAYKPNSGAT  92
            N N  W  Q + + +G   K T+D      F     ANN+K+ R  MD    Y    GA 
Sbjct  39   NENQEWVVQIEPQWKGDWDKATSDQGLLDTFKELGAANNFKSARSLMDGNPVY----GA-  93

Query  93   FECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDK  151
             +CG+TDP       P DG A  +    H G CEIWI+   V   D+C     + A   K
Sbjct  94   -DCGYTDPNGTPVDPPSDGTATFSRPMKHAGLCEIWINKKMVLQNDDCQSAYGDKAMKKK  152

Query  152  -----IDYSACKG-TCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
                 IDYS+CKG  C+L++YWL ++  G    WQ YK CI +
Sbjct  153  SVLKPIDYSSCKGDKCLLRFYWLALQRIGDKTVWQAYKNCISI  195

>PHALS_03179
Length=372

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 71/133 (53%), Gaps = 14/133 (11%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            + +   ANN+K L+  M+   A  P      ECGF+DPK   QPIPKDG A  +    H 
Sbjct  107  YQSLKAANNFKDLKTLMET-HALGP------ECGFSDPKGKPQPIPKDGKATLSRAIVHR  159

Query  122  GPCEIWIDDVRVKHGDNCHFDISETAFTDK----IDYSAC-KGTCM-LKWYWLGIRPTGK  175
            GPCE+W+D+ +V + D+C+          K    +DYS+C  G C  +++YWL  +    
Sbjct  160  GPCEMWLDNKKVLYEDDCYAKYGNEDAKIKSVLPVDYSSCANGGCKEMRFYWLAFQGIKG  219

Query  176  SYSWQIYKACIPL  188
               WQ YK CIPL
Sbjct  220  ITFWQSYKNCIPL  232

>PPTG_03139
Length=320

 Score = 86.3 bits (212),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 80/178 (45%), Gaps = 22/178 (12%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  + +P V +T     T +    +    G+           TA+FN    A+ Y +L+E
Sbjct  24   HGYMSVPKVEFTFNGDTTQYMATIEASSSGFSGNFGQSPTDNTANFNKGFAASKYSSLKE  83

Query  78   FM-DKPGAYKPNSGATFECGFTDPKAPAQPIPKD------GAFRTSGYTHEGPCEIWIDD  130
            FM DK      +   T ECG+T+P    QP+P+       G+      +HEGPCE+W DD
Sbjct  84   FMTDK--MVLVSKDFTKECGYTNPDETPQPVPETYVEWSHGSGEGFTASHEGPCEVWCDD  141

Query  131  VRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             RV   DNC  +          D+ AC G+  L  YW+ +     S SWQ+Y  C  L
Sbjct  142  TRVFQDDNCPKNFPTAPAKLPYDHDACLGSSRLSIYWIALH----SPSWQVYINCAAL  195

>SDRG_08129
Length=218

 Score = 84.3 bits (207),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 80/169 (47%), Gaps = 24/169 (14%)

Query  31   FLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANN-YKTLREFMDKPGAYKPNS  89
            F P+V+ T            K +    +  A F +  K  + +KTLR+ ++  G      
Sbjct  29   FSPNVMRTTYVATIQANLPGKFDGSPQENVAAFTSAFKVQSQFKTLRDMLEPQGP-----  83

Query  90   GATFECGFTDPKAPAQPIPKDGAFR------TSGY--THEGPCEIWIDDVRVKHGDNCHF  141
                 CG + P A  + IP DGA          G+  +H GPCE+W+DD RV   D+C  
Sbjct  84   ----ACGNSLPNASKKTIPSDGAMTWRNPDTGEGFISSHTGPCEVWLDDKRVFQNDDCPT  139

Query  142  DISE-TAFTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +  +  A    +DYS+C G  CML++YWL +        WQ+YK C+PL
Sbjct  140  NFPQKPAAHLPVDYSSCAGDGCMLRFYWLALH----QPQWQVYKNCVPL  184

>PPTG_04620
Length=342

 Score = 86.3 bits (212),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 67/136 (49%), Gaps = 12/136 (9%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSGYT  119
            A +    K+NN K +R  +D             +CG TDPKA P  P     A  + G  
Sbjct  67   ALYKELKKSNNVKDIRTMIDGDAKLYGE-----DCGNTDPKATPKDPPSTGDATFSRGIV  121

Query  120  HEGPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACK-GTCMLKWYWLGIRPT  173
            H GPCEIW+DD  V   D+C     +      +    +DYS+CK G CM ++YWL ++  
Sbjct  122  HAGPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRR  181

Query  174  GKSYSWQIYKACIPLS  189
                 WQ+YK CIPLS
Sbjct  182  DSKTLWQVYKNCIPLS  197

>PYIW_25573
Length=279

 Score = 85.1 bits (209),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 78/174 (45%), Gaps = 18/174 (10%)

Query  27   HQRVFLPDVVY-----TVANRNTNWGPQAKLEKQGYKTTAD-------FNAYLKANNYKT  74
            H ++ LP   +     T +   T  GP A     G   + D       F A LKA++Y +
Sbjct  25   HSKMSLPKPTWDNGYGTNSPSGTIDGPSALKAPSGMSFSTDPTSNTKAFTAALKASSYGS  84

Query  75   LREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVK  134
            L+         K  SGA+ ECGF+     AQP+P    +     +HEGPCE+W D+    
Sbjct  85   LKALAF--ATQKTESGASKECGFSKTTGAAQPLPDIVQWDQLTSSHEGPCEVWCDNTMAF  142

Query  135  HGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            HGDNC    + +      D S C G  ML   WL +     + +WQ+Y  C P+
Sbjct  143  HGDNCAKTYTSSPAKLPYDKSKCSGAKMLMSIWLALH----TPTWQVYTNCAPI  192

>PPTG_04803
Length=268

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query  47   GPQAKLEKQGYKTTADFNAYLKA-------NNYKTLREFMDKPGAYKPNSGATFECGFTD  99
            GP   ++K     +A +  Y +A       NN  +L+EF+   G          ECG T+
Sbjct  43   GPAGTIDKPEIIGSASYGDYYQAVDDWFTKNNVASLKEFITTYGT------DISECGNTE  96

Query  100  PKAPAQPIPKDGAFR--TSGYTHEGPCEIWIDDVRVKHGDNCHFDIS-ETAFTDKIDYSA  156
             K  AQP+P DG  +  T G +H GPCEIW DD RV H  NC    S ++     ID S 
Sbjct  97   KKGTAQPVPSDGYAQHDTLGNSHPGPCEIWCDDTRVFHDTNCVVTFSGQSPAKIPIDVST  156

Query  157  CKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            CK +    +YWL +     +  WQ+Y  C+ L
Sbjct  157  CKSSSEFVFYWLALH----AQPWQVYINCVAL  184

>PPTG_03160
Length=379

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 13/136 (10%)

Query  61   ADFNAYLKANNYKTLREFM-DKPGAYKPNSGATFECGFTDPKAPAQPIPKDGA----FRT  115
            A F     ++ YK+L+E++ DK  A    SGAT  CG  DPK   QP+PK         +
Sbjct  65   AAFTKAFTSSKYKSLKEYVTDK--AKIIVSGATLTCGSCDPKQEPQPMPKSTVEWSHSDS  122

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVR    D+C    +        D  AC G   L +YW+ +   
Sbjct  123  EGFTPSHEGPCEVWCDDVRTFQDDDCAAHYTMVPAEMPFDRDACMGASTLTFYWMAMH--  180

Query  174  GKSYSWQIYKACIPLS  189
              S SWQ+Y  C PL+
Sbjct  181  --SSSWQVYVNCAPLA  194

>PPTG_04647
Length=327

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 12/137 (9%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGY  118
            T+ +     +N Y  +R  +D         GA  +CG+T+P A A+  P  G A  + G 
Sbjct  65   TSVYTTLKSSNGYSDIRTLLDSDTDLY---GA--DCGYTNPDATAKDPPTTGDATFSRGM  119

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISETAFTDK-----IDYSACKGT-CMLKWYWLGIRP  172
             H GPCEIW+DD  V   DNC     +     K     +DYS+C  + CML++YWL  + 
Sbjct  120  VHVGPCEIWLDDTMVLSNDNCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQG  179

Query  173  TGKSYSWQIYKACIPLS  189
                  WQ+YK C+PL+
Sbjct  180  VDSKMVWQVYKDCVPLT  196

>PHYRA_86016
Length=236

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 53/105 (50%), Gaps = 15/105 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHF------DI  143
            CG+T      QPIP DG  +       G+TH GPCEI+IDD  V HGD+C        D 
Sbjct  22   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  81

Query  144  SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            S       +DYS+C G C L  YWL  +    +  WQ Y  C+PL
Sbjct  82   SNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVPL  122

>PHYKE_6078
Length=317

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 67/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    ++++Y +L+EF++        + AT  CG  DP   AQ +P          +
Sbjct  66   TAAFTTAFESSSYSSLKEFINDKATITV-TDATLTCGSCDPDEAAQALPDTYVEWAHSDS  124

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DD RV   D+C  D +        D+ AC G+  +  YWL +   
Sbjct  125  EGFTASHEGPCEVWCDDTRVFQDDDCAADYTTAPAQLPFDHDACLGSSTVTLYWLALH--  182

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  183  --SSTWQVYVNCAPL  195

>PPTG_07507
Length=299

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFDI-----  143
            +CG+T      +PIP DG  +       G+TH GPCE++IDD  V HGDNC  D      
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  144  -SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             SE      +D+S+C G C L  YWLG +    +  WQ Y  C+PL
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPL  185

>PYAP_18221
Length=226

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 68/139 (49%), Gaps = 21/139 (15%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK--DGAFRT  115
            + T  F    K +  K+LRE MDK   Y P       CG T+P    + + K     ++ 
Sbjct  67   QNTQVFTDAFKQSGLKSLRELMDK---YVPG------CGNTNPNTTPRDVTKLKTMTYQN  117

Query  116  SGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169
            + Y      +H GPCE+WID+ RV   ++C  +         +DYS CKGTC L +YWL 
Sbjct  118  NEYKEGFLNSHHGPCEVWIDNTRVFQNNDCAANYKSYPAALPVDYSKCKGTCRLTFYWLA  177

Query  170  IRPTGKSYSWQIYKACIPL  188
            +     S  WQ YK C+P+
Sbjct  178  LH----SQKWQAYKQCVPI  192

>PPTG_07509
Length=299

 Score = 85.1 bits (209),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 56/106 (53%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFDI-----  143
            +CG+T      +PIP DG  +       G+TH GPCE++IDD  V HGDNC  D      
Sbjct  84   KCGYTRTDVDPKPIPADGKVKWWGNGGGGFTHVGPCELYIDDKMVLHGDNCEEDFPGGPD  143

Query  144  -SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             SE      +D+S+C G C L  YWLG +    +  WQ Y  C+PL
Sbjct  144  GSEKMSEMPVDFSSCNGKCTLTIYWLGFQ----NAQWQAYVNCVPL  185

>PHYRA_85794
Length=230

 Score = 83.6 bits (205),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 71/153 (46%), Gaps = 30/153 (20%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNS---------------GATFECGFTDPKAPAQPI  107
             N  ++ +NY  +    D+ G YK  +               GA  +CGFT      QP+
Sbjct  40   VNWVVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVVLDMVGADKKCGFTRTDVDPQPV  99

Query  108  PKDG-----AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDI----SETAFTDK--IDYSA  156
            P +G          GYTH GPCE++IDD  V H DNC  D     +++    +  +DYS+
Sbjct  100  PTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSS  159

Query  157  CKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            C G C    YWLG     ++  WQ Y  C+PLS
Sbjct  160  CNGDCTFSIYWLGF----QNAQWQAYINCVPLS  188

>PYVX_22510
Length=596

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 63/135 (47%), Gaps = 10/135 (7%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F     +++Y +L+E +   G     SG T  CG TDP   AQ +P          +
Sbjct  312  TASFTTAFASSSYSSLKEMVTSLGQLISTSGVTITCGLTDPDETAQALPDTYVEWAHSDS  371

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCEIW DD RV   D+C    +        D ++C G   L +YWL +   
Sbjct  372  EGFTASHEGPCEIWCDDTRVFQEDDCAATYTTAPAKLPYDSASCSGASRLTFYWLALH--  429

Query  174  GKSYSWQIYKACIPL  188
              S  WQ+Y  C  L
Sbjct  430  --SSQWQVYVNCAAL  442

>PHYRA_77971
Length=230

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 71/153 (46%), Gaps = 30/153 (20%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNS---------------GATFECGFTDPKAPAQPI  107
             N  ++ +NY  +    D+ G YK  +               GA  +CGFT      QP+
Sbjct  40   VNWVVQIDNYWDIGSGGDQVGKYKTMAAEKGVSVRDVVLDMVGADKKCGFTRTDVDPQPV  99

Query  108  PKDG-----AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDI----SETAFTDK--IDYSA  156
            P +G          GYTH GPCE++IDD  V H DNC  D     +++    +  +DYS+
Sbjct  100  PTNGKAVWLGNDGGGYTHVGPCELYIDDKMVLHSDNCQGDYPGGPNDSGIMSEMPVDYSS  159

Query  157  CKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            C G C    YWLG +    +  WQ Y  C+PLS
Sbjct  160  CNGDCTFSIYWLGFQ----NAQWQAYINCVPLS  188

>PYIR_24421
Length=213

 Score = 83.2 bits (204),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 69/133 (52%), Gaps = 12/133 (9%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGY  118
            F A LK+++YK++R+ ++   ++   SGA+ ECG +      QP+P          + G+
Sbjct  42   FTAALKSSSYKSVRDLVNAKASFI--SGASKECGISSSSGAKQPLPAQYVEWAHSSSEGF  99

Query  119  T--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKS  176
            T  HEGPCE+W D+      DNC  +          D S C G  ML++YW+ +     S
Sbjct  100  TPSHEGPCEVWCDNNLAFSNDNCPKNYPSAPAKLPYDKSKCSGASMLRFYWVALH----S  155

Query  177  YSWQIYKACIPLS  189
             +WQ+Y  C PLS
Sbjct  156  STWQVYINCAPLS  168

>SDRG_15426
Length=523

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 79/169 (47%), Gaps = 24/169 (14%)

Query  31   FLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFN-AYLKANNYKTLREFMDKPGAYKPNS  89
            F+PDV+ T            K +       A+FN A+   + YKTLR+ +D  G      
Sbjct  4    FIPDVMRTTYVATIQAFLPGKFDDSPATNVANFNKAFAAQSQYKTLRDLLDLSGP-----  58

Query  90   GATFECGFTDPKAPAQPIPKDGAFR------TSGY--THEGPCEIWIDDVRVKHGDNCHF  141
                +CG T      +PIP DG           G+  +H GPCEIW+D+ RV   DNC  
Sbjct  59   ----DCGNTRTNVAPKPIPSDGMMTWQNPDTGEGFIPSHTGPCEIWLDNNRVFQNDNCAT  114

Query  142  DI-SETAFTDKIDYSACK-GTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +  +  A    +DY+ C    CML++YWL +        WQ+YK C+PL
Sbjct  115  NFPTAPAARLPVDYTKCGPNGCMLRFYWLALHQP----QWQVYKNCVPL  159

>PITG_04947
Length=298

 Score = 84.7 bits (208),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (50%), Gaps = 12/133 (9%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSGYTHE  121
            +    K+NN K +R  +D             +CG TDPKA P  P     A  + G  H 
Sbjct  42   YKQLKKSNNIKDIRTMIDGDAKLYGE-----DCGNTDPKATPKDPPTTGDATFSRGIVHA  96

Query  122  GPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACK-GTCMLKWYWLGIRPTGK  175
            GPCEIW+DD  V   D+C     +      +    +DYS+CK G CM ++YWL ++   +
Sbjct  97   GPCEIWLDDEMVLQNDDCQSAYGDGTKKTISVFKPMDYSSCKSGGCMFRFYWLALQRRDQ  156

Query  176  SYSWQIYKACIPL  188
               WQ+YK CIPL
Sbjct  157  KTLWQVYKNCIPL  169

>PHYCA_534473
Length=1050

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 16/136 (12%)

Query  63   FNAYLKANNYKTLREFMDK-PGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTH  120
            + +  ++N Y  +R  +D     Y  N      CGFTDP   A+  P  G A  + G  H
Sbjct  841  YASLKESNGYSDIRTLLDSDTDLYGAN------CGFTDPDVTAKDPPTTGDATFSRGMVH  894

Query  121  EGPCEIWIDDVRVKHGDNCHFDISE------TAFTDKIDYSACKGT-CMLKWYWLGIRPT  173
             GPCEIW+DD +V   D+C     +      + FT  +DYS+C  + CML++YWL  +  
Sbjct  895  AGPCEIWLDDTKVLSNDDCQTAYGDGTQEKASVFT-PVDYSSCSTSGCMLRFYWLAFQGV  953

Query  174  GKSYSWQIYKACIPLS  189
                 WQ+YK C+PL+
Sbjct  954  DSKIVWQVYKDCVPLT  969

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 68/137 (50%), Gaps = 14/137 (10%)

Query  61   ADFNAYLKANNYKTLREFMD-KPGAYKPNSGATFECGFTDPKA-PAQPIPKDGAFRTSGY  118
            A +    K+NN K +R  +D  P  Y  +      CG TDPKA P  P     A  + G 
Sbjct  534  AMYKQLKKSNNVKDIRTMIDADPKLYGED------CGNTDPKAKPKDPPSTGDATFSRGI  587

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACK-GTCMLKWYWLGIRP  172
             H GPCEIW+DD  V   D+C     +      +    +DYS+C  G CM ++YWL ++ 
Sbjct  588  VHAGPCEIWLDDEMVLQNDDCQSAYGDGTKATISVFKPVDYSSCAAGGCMFRYYWLALQR  647

Query  173  TGKSYSWQIYKACIPLS  189
                  WQ+YK CIPL+
Sbjct  648  RDSKTLWQVYKNCIPLT  664

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 57/116 (49%), Gaps = 13/116 (11%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F      NNYK +R  MD    Y  +      CGFTDPK      P DG A  + G  H 
Sbjct  67   FKELAAKNNYKDVRTLMDGNPVYGED------CGFTDPKGTPVDPPTDGTATFSRGIVHA  120

Query  122  GPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSAC-KGTCMLKWYWLGIR  171
            GPCEIW+DD  V   D+C     +      A    +DYS+C  G CML++YWL ++
Sbjct  121  GPCEIWLDDKMVLQNDDCQAAYGDGTQETIAVFKPVDYSSCASGGCMLRFYWLALQ  176

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 59/113 (52%), Gaps = 13/113 (12%)

Query  67   LKA-NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPC  124
            LKA NN K +R  +D         GA  +CG+T+P    +  P DG A  + G  H GPC
Sbjct  276  LKASNNAKDIRTLLDSDTKLY---GA--DCGYTNPDVTPKDPPTDGTATFSRGIVHAGPC  330

Query  125  EIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSAC-KGTCMLKWYWLGIR  171
            EIW+DD  V   D+C         ET    K +DYS+C  G CM ++YWL ++
Sbjct  331  EIWLDDKMVLSNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQ  383

>PHYRA_73606
Length=366

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 14/138 (10%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGY  118
            T+ +     +N Y  +R  +D   +     GA  +CG+T+P A A+  P  G A  + G 
Sbjct  66   TSVYTGLKSSNGYSDIRTLLDSDTSLY---GA--DCGYTNPDATAKDPPTTGDATFSRGM  120

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISE------TAFTDKIDYSACKGT-CMLKWYWLGIR  171
             H GPCEIW+DD  V   D+C     +      + FT  +DYS+C  + CML++YWL  +
Sbjct  121  VHVGPCEIWLDDTMVLSNDDCMTAYGDGTQDTASVFT-PVDYSSCSTSGCMLRFYWLAFQ  179

Query  172  PTGKSYSWQIYKACIPLS  189
                   WQ+YK C+PL+
Sbjct  180  GVDSEIVWQVYKDCVPLT  197

>PYIR_24743
Length=357

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 72/135 (53%), Gaps = 26/135 (19%)

Query  65   AYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAF------RTSGY  118
            A+   + +KTLR+ +   GA         +CG + P A  + IP DG           G+
Sbjct  80   AFQGQSEFKTLRDLLKDHGA---------DCGDSKPDASRKAIPGDGKVVWQNPDTGEGF  130

Query  119  --THEGPCEIWIDDVRVKHGDNC--HFDISETAFTDKIDYSACKGTCMLKWYWLGI-RPT  173
              +H GPCEIW+DD RV   +NC  HF  S+      +D+S+CK  CML++YWL +  PT
Sbjct  131  VPSHTGPCEIWLDDKRVFSDENCAGHF-TSKPKAELPVDFSSCKENCMLRFYWLALHEPT  189

Query  174  GKSYSWQIYKACIPL  188
                 WQ+YK C+PL
Sbjct  190  -----WQVYKNCVPL  199

>PYVX_19277
Length=331

 Score = 84.7 bits (208),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 79/177 (45%), Gaps = 20/177 (11%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYK---------TTADFNAYLKANNYKTLRE  77
            H  +  P V +T+    T +    +    G+           TA F     A+ Y +LRE
Sbjct  24   HGYMSDPVVEFTITGDTTQFMATIESTASGFTGTFSSDPATNTASFTKAFDASTYTSLRE  83

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWIDDV  131
            F++  G     S  T  CG+T+P   AQ +P +        T G+T  HEGPCE+W D+ 
Sbjct  84   FVEDLGQV-VESDFTITCGYTNPNETAQALPDEYVEWAHTSTEGFTSSHEGPCEVWCDET  142

Query  132  RVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            RV   D+C  + +        D  AC G+  L +YWL +     S +WQ+Y  C  L
Sbjct  143  RVFQDDDCAANYTTAPAKLPYDRDACLGSSALTFYWLALH----SSTWQVYINCAAL  195

>PPTG_03143
Length=368

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 68/135 (50%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    + ++Y +L+E ++   A    + AT  CG  DP   AQP+P+         +
Sbjct  65   TAAFTTAFEVSSYTSLKELINAL-ATITVTDATLTCGSCDPDETAQPLPETYVEWSHSSS  123

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  HEGPCE+W DDVR    D+C    + T      D  AC GT  L +YWL +   
Sbjct  124  EGFTSSHEGPCEVWCDDVRAFQDDDCAAHYTSTPAELPYDRDACLGTSTLTFYWLALH--  181

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  182  --SSTWQVYINCAPL  194

>PHYCA_19598
Length=390

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 68/134 (51%), Gaps = 16/134 (12%)

Query  65   AYLKA---NNYKTLRE-FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTS  116
            AY KA   + YK+L++ F DK  A    SGAT  CG  DPK   QP+P+         + 
Sbjct  66   AYTKAFASSKYKSLKDLFTDK--AKITVSGATLTCGSCDPKEEPQPMPESIVEWSHSDSE  123

Query  117  GYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            G+T  HEGPCE+W DDVR    DNC  +          D  AC G   L +YW+ +    
Sbjct  124  GFTPSHEGPCEVWCDDVRTFQDDNCATNFPMVPAKMPFDREACMGASTLTFYWMAMH---  180

Query  175  KSYSWQIYKACIPL  188
             S +WQ+Y  C PL
Sbjct  181  -SDTWQVYVNCAPL  193

>SPRG_19916
Length=305

 Score = 84.3 bits (207),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 79/169 (47%), Gaps = 24/169 (14%)

Query  31   FLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKAN-NYKTLREFMDKPGAYKPNS  89
            F P+V+ T            K +       A+FN   KA   +KTLR+ +D  G      
Sbjct  31   FTPNVMRTTYVTRIQANFPGKFDDSPQTNVANFNKAFKAQTQFKTLRDMLDPQGP-----  85

Query  90   GATFECGFTDPKAPAQPIPKDGAFR------TSGY--THEGPCEIWIDDVRVKHGDNCHF  141
                +CG T      + IP +G           G+  +H GPCE+WIDD RV   D+C  
Sbjct  86   ----DCGNTLTNGAKKAIPTNGMMTWQNPDTGEGFVPSHTGPCEVWIDDKRVFQNDDCAT  141

Query  142  DI-SETAFTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +  ++ A    IDYS+C G  CML++YWL +        WQ+YK C+PL
Sbjct  142  NFPAKPAANLPIDYSSCSGDGCMLRFYWLALH----EPMWQVYKNCVPL  186

>PPTG_07521
Length=281

 Score = 84.0 bits (206),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 58/110 (53%), Gaps = 15/110 (14%)

Query  90   GATFECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCH----  140
            GA  ECG T      QPIP DG  +       G+TH GPCEI++DD  V HGDNC     
Sbjct  81   GAGKECGHTLADGTRQPIPSDGLAKWLGNGGGGFTHVGPCEIYLDDKMVLHGDNCEDEYP  140

Query  141  -FDISETAFTDK-IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
              D+  T  +D  +DYS+C   C L  YWL  +    + +WQ Y  C+PL
Sbjct  141  GGDVGSTVTSDMPVDYSSCTEDCTLTIYWLAFQ----NANWQAYINCVPL  186

>PHYRA_86752
Length=300

 Score = 84.0 bits (206),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 54/106 (51%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHF------D  142
            +CG+T      QPIP DG  +       G+TH GPCEI+IDD  V HGD+C        D
Sbjct  85   KCGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPD  144

Query  143  ISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             S       +DYS+C G C L  YWL  +    +  WQ Y  C+PL
Sbjct  145  GSNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVPL  186

>PYU1_G001526
Length=334

 Score = 84.3 bits (207),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 61/124 (49%), Gaps = 12/124 (10%)

Query  72   YKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCE  125
            YK++R  +D  G ++P  G   ECG T P    QP+P          + G+T  H GPCE
Sbjct  83   YKSVRALVDAKGVFQP--GMNKECGVTSPTGEKQPLPAQYVEWAHSNSEGFTPSHTGPCE  140

Query  126  IWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKAC  185
            +W D+V     DNC  +          D S C G  MLK+YWL +     S +WQ Y AC
Sbjct  141  VWCDNVLAFSNDNCATNYPTAPAKLPFDRSKCVGKSMLKFYWLALH----SSTWQAYIAC  196

Query  186  IPLS  189
             PL+
Sbjct  197  APLA  200

>PYIW_18790
Length=86

 Score = 78.6 bits (192),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query  30   VFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNS  89
            V LP+  +TV  R   + P A LE QG+KTTADF AY +   YKTLR+FMD   AYK + 
Sbjct  5    VLLPEPTWTVKTRAEQFNPLAFLENQGFKTTADFEAYYRDKGYKTLRDFMDDQTAYKVD-  63

Query  90   GATFECGFTDPKAPAQPIP  108
            G  FECG++  K   QPIP
Sbjct  64   GGDFECGWSTLKGTPQPIP  82

>PYU1_G007364
Length=316

 Score = 84.0 bits (206),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 67/133 (50%), Gaps = 21/133 (16%)

Query  65   AYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR------TSGY  118
            A+  +  Y +LR+ +   G          +CG T   A  +PIP DG           G+
Sbjct  82   AFQASGKYASLRDLLQGHGE---------DCGNTKLDATPKPIPSDGMVSWQNPDTNEGF  132

Query  119  --THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKS  176
              +H GPCEIW+DD  V   +NC           K+D+S+C G C++++YWL ++     
Sbjct  133  VPSHTGPCEIWLDDTPVLKEENCAGRFPGNPAQMKVDFSSCTGKCVMRFYWLTLQ----E  188

Query  177  YSWQIYKACIPLS  189
             +WQIYK CIPL+
Sbjct  189  PAWQIYKNCIPLA  201

>PHYCA_531163
Length=314

 Score = 83.6 bits (205),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 71/137 (52%), Gaps = 12/137 (9%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGY  118
            T+ + +   +N Y  +R  +D   +     GA  +CG+T+  A A+  P  G A  + G 
Sbjct  66   TSVYTSLKSSNGYSDIRTLLDSDTSLY---GA--DCGYTNADATAKDPPSTGDATFSRGM  120

Query  119  THEGPCEIWIDDVRVKHGDNCHFDISETAFTDK-----IDYSACKGT-CMLKWYWLGIRP  172
             H GPCEIW+DD  V   D+C     +     K     +DYS+C  + CML++YWL  + 
Sbjct  121  VHVGPCEIWLDDTMVLSNDDCLTAYGDGTVDTKSVFTPVDYSSCSTSGCMLRFYWLAFQG  180

Query  173  TGKSYSWQIYKACIPLS  189
               +  WQ+YK C+PL+
Sbjct  181  VDSAIVWQVYKDCVPLT  197

>PHALS_02044
Length=237

 Score = 82.0 bits (201),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 69/141 (49%), Gaps = 13/141 (9%)

Query  55   QGYKTTADFNAYLKA-------NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPI  107
            QG   T D  + +KA       + YKTL+EF       K   GA+ ECGF+      Q +
Sbjct  57   QGMSYTTDSASNVKAYWTAFNASKYKTLKEFAW--ATQKLEKGASNECGFSLVDGQPQEL  114

Query  108  PKDGAFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYW  167
            P+   +    Y+H GPCE+W DD RV    NC  D +ET      D ++C+G  +L  YW
Sbjct  115  PEMVEWDAFSYSHMGPCEVWCDDKRVFQNWNCGVDYTETPAKLPYDKASCEGAAVLSCYW  174

Query  168  LGIRPTGKSYSWQIYKACIPL  188
            + +     +  WQIY  C P+
Sbjct  175  IAVH----TVPWQIYTNCAPI  191

>SPRG_07797
Length=318

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 72/134 (54%), Gaps = 17/134 (13%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG--AFRTSG  117
            T +F  + KA+++KTL+ F+D      P+ G   +CG TD   PAQP+P     A    G
Sbjct  64   TDEFTKHFKASSFKTLKAFLDA----HPSGG---DCGITDANGPAQPLPSTVKWANGQEG  116

Query  118  Y--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
            +  +H+GPCE+W D++RV H +NC  +      +  ID S C G   L   WL +     
Sbjct  117  FISSHQGPCELWCDNMRVFHDNNCAANYPNGHMS--IDPSKCSGAKRLTMLWLALH----  170

Query  176  SYSWQIYKACIPLS  189
            S  WQ+YK C+ LS
Sbjct  171  SPQWQVYKNCVNLS  184

>SDRG_16534
Length=320

 Score = 83.2 bits (204),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 17/146 (12%)

Query  48   PQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPI  107
            P +  E+     T  F  + KA+++KTL+ F+D   AY P  G   +CG TD   PAQP+
Sbjct  52   PGSSYEQGPDWNTDQFTKHFKASSFKTLKAFLD---AY-PTGG---DCGITDSNGPAQPL  104

Query  108  PKDG--AFRTSGY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCML  163
            P     A    G+  +H+GPCE+W D+ RV   DNC  ++ +   +  ID S C G   L
Sbjct  105  PSTVKWANGQEGFISSHQGPCELWCDETRVFQDDNCAANVPDGFMS--IDTSKCSGAKRL  162

Query  164  KWYWLGIRPTGKSYSWQIYKACIPLS  189
               WL +     +  WQ+YK C+ LS
Sbjct  163  TMLWLALH----TPEWQVYKNCVNLS  184

>PHYSO_255056
Length=269

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 9/98 (9%)

Query  94   ECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKI  152
            +CGF++P A  +  P DG A    G  H GPCEIW+DD  V H D+C       AF+ + 
Sbjct  96   DCGFSNPDAKPKDPPTDGTATFERGLAHHGPCEIWLDDTMVLHNDDC-----AKAFSVE-  149

Query  153  DYSACKGTCMLKWYWLGIR-PTGKSYSWQIYKACIPLS  189
            DY +  G CM ++YWL  +  T   Y WQIYK CIPL+
Sbjct  150  DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKNCIPLT  186

>PHYRA_73583
Length=630

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 13/145 (9%)

Query  53   EKQGYKTTADFNAYLKA-NNYKTLREFMDKPGAYKPNSGATFECGFTDPKA-PAQPIPKD  110
            E +G +        LKA NN K +R  +D         GA  +CGFTDPKA P  P    
Sbjct  357  EAKGDEGLVALYKELKASNNIKDIRTMIDSDTKLY---GA--DCGFTDPKATPKDPPSTG  411

Query  111  GAFRTSGYTHEGPCEIWIDDVRVKHGDNCHF---DISETAFT--DKIDYSAC-KGTCMLK  164
             A  + G  H GPCE+W+DD  V   D+C     D ++   +    IDYS+C  G CM +
Sbjct  412  DATFSRGMVHAGPCEVWLDDEMVLQNDDCQSAYGDGTKATLSVFKPIDYSSCPAGGCMFR  471

Query  165  WYWLGIRPTGKSYSWQIYKACIPLS  189
            ++WL ++       WQ+YK C+PLS
Sbjct  472  FFWLALQRRDSKTWWQVYKNCVPLS  496

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 72/133 (54%), Gaps = 17/133 (13%)

Query  67   LKA-NNYKTLREFMDKPGA-YKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHEGP  123
            LKA NN K +R  +D     Y  N      CG+T+P A  +  P  G A  + G  H GP
Sbjct  70   LKASNNAKDIRTLLDSDTTLYGAN------CGYTNPDASPKDPPSTGDATFSRGIVHAGP  123

Query  124  CEIWIDDVRVKHGDNCHF----DISETAFTDK-IDYSAC-KGTCMLKWYWLGI-RPTGKS  176
            CEIW+DD  V   D+C         ET    K +DYS+C  G CM ++YWL + R  GK+
Sbjct  124  CEIWLDDKMVLQNDDCQSAYGDGTQETISVFKPVDYSSCASGGCMFRFYWLALQRLDGKT  183

Query  177  YSWQIYKACIPLS  189
            + WQ+YK CIPLS
Sbjct  184  W-WQVYKNCIPLS  195

>PPTG_03153
Length=314

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 65/134 (49%), Gaps = 12/134 (9%)

Query  61   ADFNAYLKANNYKTLREFMD-KPGAYKPNSGATFECGFTDPKAPAQPIPKDGAF---RTS  116
            A F    +++ YK+L+  +D K     P  GAT  CG  DPKA  QP+P    +    + 
Sbjct  64   AAFTKAFESSKYKSLKAVIDDKAKIIVP--GATLTCGIADPKATPQPLPAKVEWYHSESE  121

Query  117  GYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            G+T  HEGPCE+W D  RV H DNC    +        + S C G   L  YW+ +    
Sbjct  122  GFTATHEGPCEVWCDKERVFHDDNCAAHYTAAPAELPYEKSKCTGASFLTMYWVAMH---  178

Query  175  KSYSWQIYKACIPL  188
               SWQ+Y  C PL
Sbjct  179  -GPSWQVYVNCAPL  191

>PHYSO_488921
Length=296

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (49%), Gaps = 25/137 (18%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRT-------  115
            FN +  A  YK+LRE +D      P+ G + +         A P+   G           
Sbjct  67   FNDHWNATGYKSLREMLDP---IAPDYGHSLKT--------ATPVDVTGYTEMWWQNDEY  115

Query  116  -SGY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRP  172
              G+  +H GPCE WIDDV++ H DNC  +          DYS+CKG C+L +YWL +  
Sbjct  116  KEGFINSHSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALH-  174

Query  173  TGKSYSWQIYKACIPLS  189
                 +WQIYK C+P++
Sbjct  175  ---EPNWQIYKQCVPIT  188

>PHYRA_86241
Length=195

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 56/100 (56%), Gaps = 9/100 (9%)

Query  94   ECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNC--HFDISE----T  146
            +CGF+DP A A+  P DG A    G  H GPCEIW+DD  V H D+C   F + +     
Sbjct  95   DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDDTMVLHNDDCAKAFSVEDYMSIK  154

Query  147  AFTDKIDYSACKGT-CMLKWYWLGIR-PTGKSYSWQIYKA  184
            +    IDYS+C  + CM ++YWL  +  T   Y WQIY A
Sbjct  155  SVFKPIDYSSCSSSGCMFRFYWLAFQGSTSGKYVWQIYSA  194

>SPRG_07799
Length=345

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 77/136 (57%), Gaps = 21/136 (15%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFT--DPKAPAQPIPKDGAFR---  114
            TADF  + KA+ +KTL++ ++     +P+ G   ECG T  DP  P Q +P    +R   
Sbjct  66   TADFTKHFKASRFKTLKDLIES----QPSGG---ECGITKLDPSKP-QALPSVVRWRHGD  117

Query  115  TSGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRP  172
              G+T  HEGPCE+W D+ RV   +NC  +I++ +    ID + C G   L+++WL +  
Sbjct  118  NEGFTPSHEGPCELWCDNTRVYDNENCAKNIADGSMA--IDTTKCAGAKTLRFFWLALH-  174

Query  173  TGKSYSWQIYKACIPL  188
               S SWQ+YK C+ L
Sbjct  175  ---SSSWQVYKNCVAL  187

>PHYKE_6002
Length=197

 Score = 80.5 bits (197),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 65/129 (50%), Gaps = 14/129 (11%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTS  116
            ++   F++  KANN+  L+  MD    Y    GA  +CGFTDP    QPIP DG A  + 
Sbjct  61   QSVTTFDSLKKANNFVDLKTLMDDTSVY----GA--DCGFTDPSGTPQPIPSDGKATFSR  114

Query  117  GYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACK-GTCM-LKWYWLGIRPTG  174
               H GPCEIW+D  +    DNC         T  +DYS+C  G C  +++YWL  +   
Sbjct  115  AMQHVGPCEIWLDSTKAFSKDNC-----ADMETFPVDYSSCNSGGCKEMRYYWLAFQGLD  169

Query  175  KSYSWQIYK  183
                WQ Y+
Sbjct  170  SKTVWQSYR  178

>PYIW_15526
Length=256

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (49%), Gaps = 21/139 (15%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIP--KDGAFRT  115
            +  A+F A      Y +L+E +DK         +   CG+T+P A    +   K   ++ 
Sbjct  63   QNAAEFTAAWPKTGYTSLKEMLDK---------SVSGCGYTNPNAAPVDVSGLKSMKYQN  113

Query  116  SGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG  169
            + Y      +H GPCE WID+ ++ H D+C         T  +DYS CKGTC L +YWL 
Sbjct  114  NEYKEGFLGSHRGPCEAWIDNTKIFHTDDCVKTYPGFPATMPVDYSVCKGTCRLTFYWLA  173

Query  170  IRPTGKSYSWQIYKACIPL  188
            +     S  WQ+YK C+ +
Sbjct  174  VH----SPKWQVYKGCVAI  188

>PHALS_10635
Length=296

 Score = 82.0 bits (201),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS-GYT  119
            A F      NN+K LR   +    Y        ECG+TDPK P    P DGA   S G  
Sbjct  58   ALFKELGTKNNFKDLRSLFEGNPIYGE------ECGYTDPKGPPADRPNDGAATFSRGIL  111

Query  120  HEGPCEIWIDDVRVKHGDNCHFDISE-----TAFTDKIDYSACKGT-CMLKWYWLGIRPT  173
            H G CEIW DD  V   D+C     +      +    +DY  C    CML++YWL ++  
Sbjct  112  HAGTCEIWFDDKMVLQNDDCQSAYGDGTKKTISVLKPVDYGLCAPEGCMLRFYWLALQRI  171

Query  174  GKSYSWQIYKACIPL  188
             K+  WQ+Y+ CIPL
Sbjct  172  DKTV-WQVYRNCIPL  185

>PHYSO_329293
Length=310

 Score = 82.4 bits (202),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 67/137 (49%), Gaps = 25/137 (18%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRT-------  115
            FN +  A  YK+LRE +D      P+ G + +         A P+   G           
Sbjct  67   FNDHWNATGYKSLREMLDP---IAPDYGHSLKT--------ATPVDVTGYTEMWWQNDEY  115

Query  116  -SGY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRP  172
              G+  +H GPCE WIDDV++ H DNC  +          DYS+CKG C+L +YWL +  
Sbjct  116  KEGFINSHSGPCEAWIDDVKIFHHDNCAAEFKSYPAKVPADYSSCKGDCLLVFYWLALH-  174

Query  173  TGKSYSWQIYKACIPLS  189
                 +WQIYK C+P++
Sbjct  175  ---EPNWQIYKQCVPIT  188

>PYIR_25334
Length=272

 Score = 81.6 bits (200),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 68/139 (49%), Gaps = 11/139 (8%)

Query  56   GYKTTADFNAYLKA----NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG  111
            G    ++ NAYL        YK+L++      A K  +GA+ ECG++     AQP+P   
Sbjct  61   GTDPQSNTNAYLAGFKAQTKYKSLKDLATS-AAVKLEAGASKECGYSSVTGTAQPLPDTV  119

Query  112  AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIR  171
             +     +H GPCE+W DDV     DNC   ++ T    K D S C G  ML  +W+ + 
Sbjct  120  QWDRFDSSHMGPCEVWCDDVLAFEDDNCSVHMTTTPAVLKYDKSKCVGKKMLTSFWIALH  179

Query  172  -PTGKSYSWQIYKACIPLS  189
             PT     WQIY  C P++
Sbjct  180  VPT-----WQIYTNCAPIA  193

>SDRG_08137
Length=282

 Score = 81.6 bits (200),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 74/149 (50%), Gaps = 24/149 (16%)

Query  51   KLEKQGYKTTADFNAYLKANN-YKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK  109
            K +    +  A F +  KA + +KTLR+ ++  G           CG + P A  + IP 
Sbjct  113  KFDGSPQENVAAFTSAFKAQSQFKTLRDMLEPQGP---------ACGNSLPNASKKTIPS  163

Query  110  DGAFR------TSGY--THEGPCEIWIDDVRVKHGDNCHFDISET-AFTDKIDYSACKGT  160
            DG           G+  +H GPCE+W+DD RV   D+C  +  +  A    +DYS+C G 
Sbjct  164  DGTMTWRNPDTGEGFISSHTGPCEVWLDDKRVFQNDDCPTNFPQKPAAHLPVDYSSCAGD  223

Query  161  -CMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             CML++YWL +        WQ+YK C+PL
Sbjct  224  GCMLRFYWLALH----QPQWQVYKNCVPL  248

>PYAR_24113
Length=192

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 77/172 (45%), Gaps = 15/172 (9%)

Query  27   HQRVFLPDVVYTVANRNTNWGPQAKLEKQGYKT--------TADFNAYLKANNYKTLREF  78
            H ++  P   YT    N+  G    L+    KT         A FNA  K + YK+L+E 
Sbjct  22   HSKLIKPAPKYTTNASNSPTGLIQVLQAPAGKTFSLDPETNAASFNAAFKNSKYKSLKEL  81

Query  79   MDKPGAYKPNSGATFECGF-TDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRVKHGD  137
            + +    K ++GAT ECGF T   A  QP+P    +     +H GPCE+W D+      D
Sbjct  82   VLQ--NQKVSAGATAECGFATLSGATPQPLPDVVEWDEFTGSHTGPCEVWCDNNLAFQDD  139

Query  138  NCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            NC  +I            AC G  +L  YW+ +     +  WQ+Y  C PLS
Sbjct  140  NCSKNIKGNPAKLNYKKDACVGAKVLTSYWIALH----TAEWQVYTGCAPLS  187

>SPRG_07795
Length=335

 Score = 82.0 bits (201),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 73/146 (50%), Gaps = 17/146 (12%)

Query  48   PQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPI  107
            P +  E+     T  F  + KA+++KTL+ F+D      P  G   +CG TDP  PAQP+
Sbjct  52   PGSSYEQGPDWNTDQFTKHFKASSFKTLKAFLDA----HPTGG---DCGITDPNGPAQPL  104

Query  108  PKDGAFRTS--GY--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCML  163
            P    +     G+  +H+GPCE+W D+ RV   +NC  +  +      ID S C G   L
Sbjct  105  PSTVKWANGELGFISSHQGPCELWCDETRVFQDENCAANYPDGFMA--IDTSKCSGAKRL  162

Query  164  KWYWLGIRPTGKSYSWQIYKACIPLS  189
               WL +     +  WQ+YK C+ LS
Sbjct  163  TMLWLALH----TPEWQVYKNCVNLS  184

>PHYCA_12943
Length=287

 Score = 81.3 bits (199),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 55/106 (52%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHF------D  142
            +CG+T      QPIP DG  +       G+TH GPCEI+IDD  V HGD+C        D
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGPD  146

Query  143  ISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             S+      +D+S+C G C L  YWL  +    +  WQ Y  C+PL
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVPL  188

>PHYSO_525076
Length=366

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 66/135 (49%), Gaps = 11/135 (8%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            TA F    +A++Y +L+E ++        + AT  CG   P   AQP+P          T
Sbjct  67   TAAFTKAFEASSYTSLKELINDKATITV-TDATLTCGSCYPDETAQPLPDTYVEWSHSST  125

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G++  H GPCE+W DDVRV   D+C  D +        D  AC GT  L +YWL +   
Sbjct  126  EGFSSSHAGPCEVWCDDVRVFQDDDCAADYTSAPAELPYDRDACLGTSTLTFYWLALH--  183

Query  174  GKSYSWQIYKACIPL  188
              S +WQ+Y  C PL
Sbjct  184  --SSTWQVYINCAPL  196

>PHALS_04411
Length=262

 Score = 80.5 bits (197),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 65/134 (49%), Gaps = 13/134 (10%)

Query  63   FNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDG-AFRTSGYTHE  121
            F      NNYK +R  MD       N     +CGFTDPK      P DG A  + G  H 
Sbjct  67   FKELAAKNNYKNVRTLMDG------NPAFGEDCGFTDPKGKPVDPPSDGTATFSRGIVHA  120

Query  122  GPCEIWIDDVRVKHGDNC---HFDISETAFT--DKIDYSAC-KGTCMLKWYWLGIRPTGK  175
            GPCE+W +D  +   D+C   + D ++   T    + YS C  G  +L++YWL ++    
Sbjct  121  GPCELWCNDKMILQNDDCQSAYGDGTQQTITVFKPVKYSLCPSGGGLLRFYWLALQRLQG  180

Query  176  SYSWQIYKACIPLS  189
               WQ YK CIPL+
Sbjct  181  KVVWQAYKNCIPLT  194

>PHYCA_97965
Length=288

 Score = 80.9 bits (198),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 55/106 (52%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFDI-----  143
            +CG+T      QPIP DG  +       G+TH GPCEI+IDD  V HGD+C  +      
Sbjct  87   KCGYTRTDVDPQPIPSDGIVKWWGNGGGGFTHTGPCEIYIDDKMVLHGDDCEDEFPGGAK  146

Query  144  -SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             S+      +D+S+C G C L  YWL  +    +  WQ Y  C+PL
Sbjct  147  GSDKMSEMSVDFSSCNGKCTLTIYWLAFQ----NEQWQSYVNCVPL  188

>PYIR_26867
Length=163

 Score = 78.2 bits (191),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRT  115
            T  F A LKA+ YK++R  +D  G +   SGA  +CG T P    QP+P          T
Sbjct  43   TKAFTAALKASTYKSVRALVDAKGQFI--SGANKQCGVTSPTGDKQPLPAQYVEWAHSST  100

Query  116  SGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPT  173
             G+T  H+GPCE+W DD      +NC  +          D S C G  MLK YWL +   
Sbjct  101  EGFTPSHQGPCEVWCDDKMAFSDENCATNYPTAPAKLPYDKSKCTGASMLKIYWLALH--  158

Query  174  GKSYSWQ  180
              S +WQ
Sbjct  159  --SSTWQ  163

>PHYKE_2454
Length=374

 Score = 81.3 bits (199),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 66/133 (50%), Gaps = 10/133 (8%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTS---G  117
            A F    KA++YK+L+  +D   A    SGAT  CG  DP A AQP+P    +  S   G
Sbjct  65   ASFTKAFKASSYKSLKALIDDK-AKITVSGATLTCGSADPSAAAQPLPSTLEWSHSDSEG  123

Query  118  YT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
            +T  HEGPCE W DDVRV   +NC  +          + S+  G   L +YW+ +     
Sbjct  124  FTPSHEGPCEAWCDDVRVFQDENCSANFPAAPAEMPYESSSYSGASRLIFYWIAMH----  179

Query  176  SYSWQIYKACIPL  188
              SWQ+Y  C  L
Sbjct  180  GPSWQVYVNCAAL  192

>PYU1_G001514
Length=469

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 61/125 (49%), Gaps = 12/125 (10%)

Query  70   NNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGP  123
            + YK++R  +D  G ++P  G   +CG T      QP+P          + G+T  H+GP
Sbjct  81   STYKSMRALVDAKGVFQP--GMDKQCGVTSATGAKQPLPAKYVEWAHSSSEGFTPSHQGP  138

Query  124  CEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYK  183
            CE+W D+ RV   DNC  D +        D S C G  MLK YWL +     S +WQ Y 
Sbjct  139  CEVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKIYWLALH----SSTWQAYI  194

Query  184  ACIPL  188
             C PL
Sbjct  195  NCAPL  199

>PHYCA_123316
Length=316

 Score = 80.5 bits (197),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 65/134 (49%), Gaps = 10/134 (7%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR---TS  116
            T  F A   ++ Y ++++F+   G    N GAT ECG TDP    Q +P +  +    T 
Sbjct  66   TEAFWAAFNSSKYSSIKDFVTDKGQIVAN-GATIECGLTDPNETPQSLPAELEWTHSDTE  124

Query  117  GYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTG  174
            G+T  HEGPCE W DD +V    NC    +        D + C G+  L +YWL +    
Sbjct  125  GFTSSHEGPCEAWCDDTQVFQDTNCAAHFTTAPAKMPYDKAGCSGSSRLTFYWLALH---  181

Query  175  KSYSWQIYKACIPL  188
             S +WQIY  C  L
Sbjct  182  -SSTWQIYVNCAAL  194

>SPRG_22161
Length=300

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query  31   FLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYLKAN-NYKTLREFMDKPGAYKPNS  89
            F P+V+ T            K +       A+FN   KA   +KTLR+ +D  G      
Sbjct  31   FTPNVMRTTYVTRIQANFPGKFDDSPQTNVANFNKAFKAQTQFKTLRDMLDPQGP-----  85

Query  90   GATFECGFTDPKAPAQPIPKDGAFR------TSGY--THEGPCEIWIDDVRVKHGDNCHF  141
                +CG T      + IP +G           G+  +H GPCE+WID+ RV   D+C  
Sbjct  86   ----DCGNTLTNGAKKAIPTNGMMTWQNPDTGEGFIPSHTGPCEVWIDNKRVFQNDDCAT  141

Query  142  DI-SETAFTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            +  ++ A    +DYS+C    CML++YWL +        WQ+YK C+PL
Sbjct  142  NFPAKPAANLPVDYSSCGANGCMLRFYWLALH----EPMWQVYKNCVPL  186

>PHYSO_374025
Length=300

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 60/126 (48%), Gaps = 7/126 (6%)

Query  67   LKANNYKTLREFMDKP---GAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGP  123
              A+ Y +L++  DK     +  P   AT ECGF+     A+ +P    ++  GY+H+GP
Sbjct  72   FNASKYTSLKDLADKTMVLQSLSPFGKATAECGFSLANGTARDLPAQVEWKDFGYSHQGP  131

Query  124  CEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYK  183
            CE+W DD      DNC     E       D   C G  M++ YW+ +        WQ+Y 
Sbjct  132  CEVWCDDKLAFEDDNCALHYPEVPAKLPYDVDVCAGASMIQSYWIALH----GLPWQLYL  187

Query  184  ACIPLS  189
             C+PL+
Sbjct  188  NCVPLT  193

>PHYRA_77290
Length=309

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 80/177 (45%), Gaps = 30/177 (17%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNA-----YLKANNYKTLREFMDKP  82
            +  + P+ +YT  N+ T     +  +   Y  +   NA     +  A  YK+LR+ +D  
Sbjct  29   KATYEPNTIYTTYNKLTTASINSGFDGGHYNWSPTQNAQAFIDHWNATGYKSLRDMLDP-  87

Query  83   GAYKPNSGATFECGFTDPKAPAQPIPKDGA----FRTSGY------THEGPCEIWIDDVR  132
                P  G + E         A P+   G     ++   Y      +HEGPCE W+DDV+
Sbjct  88   --IAPGYGHSLET--------ADPVDVSGYKEMWWQNDEYKEGFIASHEGPCEAWVDDVQ  137

Query  133  VKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            + H DNC             D+S+CKG C+  +YWL +       +WQIYK C+P++
Sbjct  138  IFHHDNCAAQFKTYPAKVPADFSSCKGDCLFVFYWLALHEP----NWQIYKQCVPIT  190

>PHYRA_78167
Length=284

 Score = 80.1 bits (196),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 7/126 (6%)

Query  67   LKANNYKTLREFMDKPGAYK---PNSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGP  123
              A+ Y +L+   DK    +   P   AT ECGF+ P   A+ +P +  +   G +H+GP
Sbjct  65   FNASKYTSLKNLADKTMVLQSLNPFGKATAECGFSLPNGTARNLPAEVQWHDFGLSHQGP  124

Query  124  CEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYK  183
            CE+W DD       NC  +  E   +   D   C G  M++ YW+ +        WQ+Y 
Sbjct  125  CEVWCDDKLAFMDQNCALNYPEVPASLPYDVDVCAGASMMQSYWIALH----GLPWQLYL  180

Query  184  ACIPLS  189
             C+PL+
Sbjct  181  NCVPLT  186

>PPTG_04617
Length=496

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 60/104 (58%), Gaps = 8/104 (8%)

Query  94   ECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFD------ISET  146
            +C ++DPKA  +  P DG A  + G  H GPCEIW+DD  V H D+C         +++ 
Sbjct  66   DCEYSDPKADPKTSPSDGTATFSRGIAHHGPCEIWLDDKMVLHDDDCEKTFGTADYMTQK  125

Query  147  AFTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            +    IDYS+C  + CM ++YW+  + +   Y  QIY+ C+PL+
Sbjct  126  SVLKPIDYSSCSTSGCMYRFYWIAFQGSDNGYVRQIYRHCVPLT  169

>PHYCA_14560
Length=300

 Score = 80.1 bits (196),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 75/188 (40%), Gaps = 58/188 (31%)

Query  31   FLPDVVYTVANRNT-------------NWGPQAKLEKQGYKTTADFNAYLKANNYKTLRE  77
            + P+ +YT  N  T             NW P    +         F  +  A  YK+LRE
Sbjct  30   YEPNTIYTTYNALTSASINKGFDGGHYNWSPTQNAQA--------FTDHWNATGYKSLRE  81

Query  78   FMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYT----------------HE  121
             +D      P+ G + +         A P+        SGYT                HE
Sbjct  82   MLDP---IAPDYGHSLKT--------ATPV------DVSGYTEMWWQNDEYKEGFIASHE  124

Query  122  GPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQI  181
            GPCE WIDD R+ H DNC             DYS+CKG C+  +YWL +        WQI
Sbjct  125  GPCEAWIDDTRIFHYDNCAAQFKTYPAKVPADYSSCKGDCLFVFYWLALHEP----DWQI  180

Query  182  YKACIPLS  189
            YK C+P++
Sbjct  181  YKQCVPIT  188

>PYAP_22257
Length=247

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 63/132 (48%), Gaps = 20/132 (15%)

Query  65   AYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPK------DGAFRTSGY  118
            A+     +KTL++ ++K             CG +  K   Q +        +     +G+
Sbjct  64   AFKSQKTFKTLKDMVEKQ--------LKGSCGKSSGKGKPQSVEGLSDVHWENTEEKTGF  115

Query  119  --THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKS  176
              +H GPCEIWIDD RV H DNC            ++YS CKG CML++YWL +      
Sbjct  116  VSSHSGPCEIWIDDTRVMHEDNCVAKFKGYPAKMPVNYSVCKGECMLRFYWLALHEP---  172

Query  177  YSWQIYKACIPL  188
              WQ+YK C+P+
Sbjct  173  -EWQVYKNCVPI  183

>PYIR_20483
Length=287

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 72/157 (46%), Gaps = 29/157 (18%)

Query  40   ANRNTNWGPQAKLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTD  99
            A R  NW P+        + TA F        YK+L+E +D    Y P      +CG + 
Sbjct  59   AGRPFNWSPE--------QNTAQFTEAWPNTGYKSLKEMLD---TYVP------DCGLSL  101

Query  100  PKAPAQPIP--KDGAFRTSGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDK  151
            P      +   K+  F+ + Y      +H GPCE+W+ + +  H D+C         T  
Sbjct  102  PDVTPVDVSGMKEFKFQNNEYKEGFIASHHGPCELWVGNTKAWHYDDCSAKFPGYPATIP  161

Query  152  IDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             D+S CKGTC + +YWL +     S  WQIYK C+P+
Sbjct  162  TDFSVCKGTCRVTFYWLALH----SQKWQIYKQCVPV  194

>PYIW_16810
Length=216

 Score = 78.2 bits (191),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 66/138 (48%), Gaps = 15/138 (11%)

Query  59   TTADFNAYLKANNYKTLREFM---DKPGAY--KPNSGATFECGFTDPKAPAQPIPKDGAF  113
            T A F A  K N +K+LR F+     PG Y  KP SG T ECGFTDP    QP+P    +
Sbjct  61   TAATFAANYKKNGFKSLRAFIMDNQTPGKYDGKP-SGGTPECGFTDPNGTPQPLPDKLGW  119

Query  114  RTSGYTHEGPCEIWIDDVRV-KHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLG--I  170
                + HEGPCE W DDV V     +C             D + C G  ML +YWL   +
Sbjct  120  PGPTFQHEGPCEAWCDDVLVMPFTASCKSYEGGAKAQMPYDKAKCAGKKMLHFYWLATFV  179

Query  171  RPTGKSYSWQIYKACIPL  188
             P      +Q Y  C+P+
Sbjct  180  SP------FQAYTNCVPI  191

>PYU1_G001516
Length=304

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 79/180 (44%), Gaps = 24/180 (13%)

Query  27   HQRVFLPDVVYTVANRNTNW-----GPQAKLEKQGYKTTAD-------FNAYLKANNYKT  74
            H  + +P V ++++   T +     GP       G   T D       F   L  ++Y +
Sbjct  27   HGYMSVPKVTFSISGDTTQFCGTIDGPSTLTAPTGMSFTTDPASNTAAFTKALANSSYTS  86

Query  75   LREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD----GAFRTSGYT--HEGPCEIWI  128
            +RE ++  G +   +GAT  CG T+     QP+P          T G+T  H+GPCE+W 
Sbjct  87   VRELVEDKGVFI--TGATKTCGITEETEDPQPLPAKYVEWSHSSTEGFTASHQGPCEVWC  144

Query  129  DDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            DD      +NC  D +        D + C GT +LK  WL +     S +WQIY  C  L
Sbjct  145  DDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLKIVWLALH----SSTWQIYINCATL  200

>PHYRA_93650
Length=231

 Score = 78.6 bits (192),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 9/93 (10%)

Query  94   ECGFTDPKAPAQPIPKDG-AFRTSGYTHEGPCEIWIDDVRVKHGDNCHFDISETAFTDKI  152
            +CGF+DP A A+  P DG A    G  H GPCEIW+DD  V H D+C       AF+ + 
Sbjct  95   DCGFSDPNAKAKDPPSDGTATFERGLAHHGPCEIWLDDTMVLHNDDC-----AKAFSVE-  148

Query  153  DYSACKGTCMLKWYWLGIR-PTGKSYSWQIYKA  184
            DY +  G CM ++YWL  +  T   Y WQIYKA
Sbjct  149  DYMSING-CMFRFYWLAFQGSTSGKYVWQIYKA  180

>SDRG_00948
Length=352

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 21/136 (15%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFT--DPKAPAQPIPKDGAFR---  114
            TA F  + KA+ +KTL++ ++     +P+ G   ECG T  DP  P Q +P    +R   
Sbjct  66   TAAFTTHFKASRFKTLKDLIES----QPSGG---ECGITKLDPSKP-QALPSVVRWRHGD  117

Query  115  TSGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRP  172
              G+T  HEGPCE+W D+ RV   +NC  +I++ +    ID + C G   L+++WL +  
Sbjct  118  NEGFTPSHEGPCELWCDNTRVYDNENCAKNIADGSM--PIDTAKCAGAKTLRFFWLALH-  174

Query  173  TGKSYSWQIYKACIPL  188
               S SWQ+YK C+ L
Sbjct  175  ---SSSWQVYKNCVAL  187

>PYIR_20481
Length=277

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 9/131 (7%)

Query  60   TADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGY-  118
            T  F +      YK+L+E +D      P  G T   G     +  + +         G+ 
Sbjct  63   TKMFTSAFANTGYKSLKEMLD---LSVPGCGFTLTDGAPVDVSGLKSMKWQNDQEQKGFI  119

Query  119  -THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSY  177
             +H GPCE+WID+ ++ H D+C  D +       +DYS CKG C L +YWL +       
Sbjct  120  DSHHGPCEVWIDNTKIMHSDDCRADYTAYPAEIPVDYSKCKGKCQLTFYWLALHEP----  175

Query  178  SWQIYKACIPL  188
            +WQIYK C+P+
Sbjct  176  NWQIYKQCVPI  186

>PYIW_24289
Length=196

 Score = 77.4 bits (189),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 68/140 (49%), Gaps = 13/140 (9%)

Query  51   KLEKQGYKTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKD  110
            ++    +KT   F++   +  Y+ LR+ +D    +  ++G   ECGFT+  +  QP+   
Sbjct  68   EMNALAFKTA--FSSQTDSIKYRNLRDLIDTKAVF--SAGTDKECGFTNVTSAKQPL---  120

Query  111  GAFRTSGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWL  168
             A  T G+T  H+GPCEIW D V V   DNC  +            S C G  MLK+YWL
Sbjct  121  SAHATGGFTPTHQGPCEIWCDRVLVFQNDNCAKNYPAAPAQLPYQKSRCAGAKMLKFYWL  180

Query  169  GIRPTGKSYSWQIYKACIPL  188
             +     S  W+ Y  C PL
Sbjct  181  AVH----SIKWEAYINCAPL  196

>PPTG_03156
Length=445

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 65/134 (49%), Gaps = 12/134 (9%)

Query  61   ADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAF---RTSG  117
            A F      + YK+L+ F+D   A    +GAT  CG  +P A AQP+P    +    + G
Sbjct  65   ASFTKAFATSTYKSLKAFIDDK-AKITVTGATLTCGNAEPDATAQPLPDKLEWYHSESEG  123

Query  118  YT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIR-PTG  174
            +T  HEGPCE W D  RV H +NC  +          + S C G   L +YW+ +  PT 
Sbjct  124  FTASHEGPCEAWCDSERVFHDENCAANFKTAPAEMPYEKSKCSGASTLTFYWMAMHGPT-  182

Query  175  KSYSWQIYKACIPL  188
                WQ+Y  C PL
Sbjct  183  ----WQVYVNCAPL  192

>PYU1_G005872
Length=297

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 69/141 (49%), Gaps = 25/141 (18%)

Query  58   KTTADFNAYLKANNYKTLREFMDK--PGAYKPNSGATFECGFTDPKAPAQPIPKDGA--F  113
            + T  F A      YK+L++ MDK  PG           CG+++P A    + K  A  F
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMDKAVPG-----------CGYSNPNAAPVDVSKMSAMKF  114

Query  114  RTSGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYW  167
            + + Y      +H GPCE WID+ RV H D+C         T  + Y +CKGTC L +YW
Sbjct  115  QNNEYKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYW  174

Query  168  LGIRPTGKSYSWQIYKACIPL  188
            L +     S  WQ YK+C+ +
Sbjct  175  LALH----SPKWQAYKSCVAI  191

>PYU1_G005871
Length=284

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 69/141 (49%), Gaps = 25/141 (18%)

Query  58   KTTADFNAYLKANNYKTLREFMDK--PGAYKPNSGATFECGFTDPKAPAQPIPKDGA--F  113
            + T  F A      YK+L++ MDK  PG           CG+++P A    + K  A  F
Sbjct  66   QNTQQFTAAWPKTGYKSLKQMMDKAVPG-----------CGYSNPNAAPVDVSKMSAMKF  114

Query  114  RTSGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYW  167
            + + Y      +H GPCE WID+ RV H D+C         T  + Y +CKGTC L +YW
Sbjct  115  QNNEYKEGFLGSHHGPCEGWIDNTRVFHYDDCVAKFPGYPATIPMSYKSCKGTCRLTFYW  174

Query  168  LGIRPTGKSYSWQIYKACIPL  188
            L +     S  WQ YK+C+ +
Sbjct  175  LALH----SPKWQAYKSCVAI  191

>PHYSO_318683
Length=352

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 65/136 (48%), Gaps = 10/136 (7%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFR---  114
            + TA F     ++ Y +++EF+   G    N GA  ECG TDP    QP+P +  +    
Sbjct  59   ENTAAFWTAFNSSQYSSIKEFVTDLGQIVAN-GANIECGLTDPDETPQPLPDELEWTHSD  117

Query  115  TSGYT--HEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRP  172
            T G+T  HEGPCE W D+ RV    +C    +        D + C G   L +YWL +  
Sbjct  118  TEGFTSSHEGPCEAWCDNTRVFQDTDCAAHYTTAPAKMPYDKAGCSGASRLTFYWLALH-  176

Query  173  TGKSYSWQIYKACIPL  188
               S +WQ+Y  C  L
Sbjct  177  ---SSTWQVYVDCAAL  189

>PHYKE_5749
Length=300

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFD-----IS  144
            CG T P    QPIP DG  +       G+TH GPCEI++DD  V H D+C  +     + 
Sbjct  87   CGNTLPDGDPQPIPSDGKAKWLGNEGGGFTHTGPCEIYLDDKMVLHSDDCEDEFKGGPVG  146

Query  145  ETAFTD-KIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             T  +D  +DYS+C G C+   YWL  +    +  WQ Y  C+PL
Sbjct  147  STQTSDMPVDYSSCNGKCLFTIYWLAFQ----NAQWQTYINCVPL  187

>PHYSO_484051
Length=285

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 67/130 (52%), Gaps = 14/130 (11%)

Query  68   KANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSG-YTHEGPCEI  126
            ++N Y  +R  +D   +     GA  +CGFT+P A  +  P  G    S    H  PCEI
Sbjct  74   ESNGYSDIRTLLDSDTSLY---GA--DCGFTNPDASPKDPPTTGDPTFSRCMVHASPCEI  128

Query  127  WIDDVRVKHGDNCHF----DISETA--FTDKIDYSACKGT-CMLKWYWLGIRPTGKSYSW  179
            W+DD  V   D+C         ETA  FT  +DYS+C  + CML++YWL  +       W
Sbjct  129  WLDDTMVLSNDDCQTAYGDGTQETASVFT-PVDYSSCSTSGCMLRFYWLAFQGVDSKMVW  187

Query  180  QIYKACIPLS  189
            Q+YK C+PL+
Sbjct  188  QVYKDCVPLT  197

>PYAP_23672
Length=257

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 5/103 (5%)

Query  88   NSGATFECGFTDPKAPAQPIPKDGAFRTSGYTHEGPCEIWIDDVRV-KHGDNCHFDISET  146
            ++G+T ECG++DPK   QP+P+   F T G+ H GPCE + D+V V KH  +C       
Sbjct  86   DTGSTPECGYSDPKGTPQPLPEKIQFHT-GFMHWGPCEAYCDNVLVTKHAADCKVAYPGG  144

Query  147  AFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPLS  189
            A     D + C G    K+YWLG+  +G S  WQ Y  C+PLS
Sbjct  145  AV--PYDKAKCAGKKQFKFYWLGMD-SGNSAPWQAYVNCVPLS  184

>PHYRA_83499
Length=473

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 52/105 (50%), Gaps = 15/105 (14%)

Query  95   CGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHF------DI  143
            CG+T      QPIP DG  +       G+TH GPCEI+IDD  V HGD+C        D 
Sbjct  86   CGYTRTDVDPQPIPTDGKVKWWGNGGGGFTHTGPCEIYIDDTMVLHGDDCEEEYPGGPDG  145

Query  144  SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
            S       +DYS+C G C L  YWL  +    +  WQ Y  C+ L
Sbjct  146  SNKMSEMPVDYSSCNGECTLTIYWLAFQ----NAQWQAYVNCVSL  186

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 38/67 (57%), Gaps = 10/67 (15%)

Query  122  GPCEIWIDDVRVKHGDNCHFDISETA-----FTDK-IDYSACKGTCMLKWYWLGIRPTGK  175
            GPCEI++DD  + HGDNC  + S  A      +D  IDYS+C G C L  YWLG +    
Sbjct  351  GPCEIYLDDTMILHGDNCEDEYSGGADDSGIMSDMPIDYSSCNGACTLAIYWLGFQ----  406

Query  176  SYSWQIY  182
            +  WQ Y
Sbjct  407  NEQWQAY  413

>PYU1_G005985
Length=200

 Score = 77.4 bits (189),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 68/142 (48%), Gaps = 27/142 (19%)

Query  58   KTTADFNAYLKANNYKTLREFMD--KPGAYKPNSGATFECGFTDPKAPAQPIPKDGA--F  113
            + T  F +   A  Y +L+  +D   PG           CG +    P   + +  A  F
Sbjct  66   ENTQQFTSGFHAAGYSSLKALLDPVAPG-----------CGNSRVDVPPVGVSRLAAMEF  114

Query  114  RTSGY------THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYW  167
            R   +      +H GPCE+WID+ R+ HGD+C    +    T  +++S C+G C L +YW
Sbjct  115  RNDEFHEGFVNSHHGPCEVWIDNKRMFHGDDCRAQFAGYPATIPVNFSVCQGKCTLTFYW  174

Query  168  LGI-RPTGKSYSWQIYKACIPL  188
            L +  PT     WQ+YK C+P+
Sbjct  175  LALHEPT-----WQVYKQCVPI  191

>PHYCA_103479
Length=314

 Score = 79.3 bits (194),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 76/183 (42%), Gaps = 42/183 (23%)

Query  28   QRVFLPDVVYTVANRNTNWGPQAKLEKQGYKTTADFNAYL-----KANNYKTLREFMDKP  82
            +  + P+ VYT  N  T     +      Y  +   NA +      A  YK+LRE +D  
Sbjct  27   KATYQPNTVYTTYNALTTAAVNSAFAGGKYDGSPSQNAQVFADHWNATGYKSLREMVDPI  86

Query  83   GAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSGYT----------------HEGPCEI  126
                       + GF+   A     P D     +GYT                HEGPCE 
Sbjct  87   AT---------DYGFSVKTA----TPVD----VTGYTEMWWQNDEYKEGFIASHEGPCEG  129

Query  127  WIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACI  186
            WIDD R+ H DNC             DYS+CKG C+  +YWL +       +WQIYK C+
Sbjct  130  WIDDTRIFHYDNCAAQFKTYPAKIPADYSSCKGDCLFSFYWLALH----EPNWQIYKQCV  185

Query  187  PLS  189
            P++
Sbjct  186  PIT  188

>PPTG_07516
Length=294

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 55/106 (52%), Gaps = 15/106 (14%)

Query  94   ECGFTDPKAPAQPIPKDGAFR-----TSGYTHEGPCEIWIDDVRVKHGDNCHFDI-----  143
            +CG T      QPIP DG  +       G+TH GPCEI++DD  V HGD+C  +      
Sbjct  83   KCGNTLENGDPQPIPADGKVKWHGNEGGGFTHTGPCEIYLDDKMVLHGDDCEDEFKGGPN  142

Query  144  -SETAFTDKIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             S+      +D+S+C G C+L  YWL  +    +  WQ Y  C+PL
Sbjct  143  GSKQTSDMPVDFSSCNGKCLLTIYWLAFQ----NAQWQTYVNCVPL  184

>PHYKE_10295
Length=292

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 61/134 (46%), Gaps = 9/134 (7%)

Query  58   KTTADFNAYLKANNYKTLREFMDKPGAYKPNSGATFECGFTDPKAPAQPIPKDGAFRTSG  117
            K TA F +    + +KTLR  MD      P+ G T   G     +    +         G
Sbjct  61   KNTATFTSSFPKSQFKTLRALMD---TVAPDCGNTALTGSPVDVSALSSMKWQNDQEQKG  117

Query  118  Y--THEGPCEIWIDDVRVKHGDNCHFDISETAFTDKIDYSACKGTCMLKWYWLGIRPTGK  175
            +  +H GPCE WIDD RV   D+C  D         IDYS+C G C   +YW+ +     
Sbjct  118  FIDSHHGPCEAWIDDTRVMQSDDCRADYPNYPAEIPIDYSSCSGDCTFTFYWMALH----  173

Query  176  SYSWQIYKACIPLS  189
              +WQ+YK C P++
Sbjct  174  EPNWQVYKQCAPIT  187

>PHYSO_374518
Length=116

 Score = 75.1 bits (183),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 53/98 (54%), Gaps = 7/98 (7%)

Query  94   ECGFTDPKAPAQPIPKDGAFR--TSGYTHEGPCEIWIDDVRVKHGDNCHFDIS-ETAFTD  150
            ECG T+ K  AQP+P DG  +  T G +H GPCEIW DD RV H  NC  + + E     
Sbjct  7    ECGNTEKKGLAQPVPSDGYAQHDTLGSSHPGPCEIWCDDTRVFHNTNCAQEYAGEVPTKL  66

Query  151  KIDYSACKGTCMLKWYWLGIRPTGKSYSWQIYKACIPL  188
             ID S CK +    +YWL +     +  WQ+Y  C+ L
Sbjct  67   PIDVSTCKASSEFVFYWLALH----AQPWQVYINCVAL  100

Lambda      K        H        a         alpha
   0.319    0.135    0.442    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11475046035

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40