Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_144875698646746722260.0
PYAP_173349729165028412261e-162
PYVX_15641926262928411866e-157
PYIW_168739729149628511686e-156
PYIR_158579729157728411671e-154
PYU1_G0139279729164928411661e-153
HYAP_015407534563424611608e-153
PPTG_02122926265728811558e-152
PHYSO_4800105698665328411522e-151
PHYSO_485614926765328411512e-151
PHYCA_1044294084764528811486e-151
PHYRA_72463926265828811481e-150
SDRG_11899926765228411471e-150
SPRG_04533926765228411462e-150
PHYSO_344705926279828811555e-150
PITG_11244926266329411429e-150
PHYRA_478736903539628511152e-149
PHYSO_486085926565328411373e-149
PITG_11249926765328411374e-149
PITG_11247926565328411358e-149
PHYRA_47865926738128911037e-148
PHYCA_104465926765328411235e-147
PHYCA_5329125698662628611199e-147
PHYCA_1043356903565628611141e-145
PHYRA_724155698665528511141e-145
H310_0261014834765028411087e-145
PYIR_167389399655549610868e-143
PPTG_0212075345100128611165e-142
CCA16153926766324610844e-141
CCI40249926766024610821e-140
CCI4322116052066024610532e-136
PYVX_229818037761228410457e-136
PYIW_16876926264324610479e-136
PYU1_G013931926266324610472e-135
PYAP_192359943964328410312e-133
SDRG_0577812752661845010241e-132
SPRG_0006812211564324610252e-132
PITG_11252927065428510235e-132
PHYSO_482793927065828910236e-132
PYAP_17333926265724610165e-131
SDRG_1147312211563624610103e-130
PHYRA_7165592706532849922e-127
PYIR_1585992626262469884e-127
HYAP_0153792706512849889e-127
H257_1295892676492469818e-126
PHALS_0980292706512469811e-125
H310_0955792676442849703e-124
PHYCA_10444492706442859679e-124
PYAR_198079262161324610191e-123
PHYKE_701692706502479565e-122
CCI402471524566432859287e-118
CCA161511524566432859224e-117
H257_173221483476062378831e-111
PHALS_01338300173832248622e-111
PHYKE_6984569864502268657e-111
CCA1496715203914312319228e-111
PHYKE_2977753452201708367e-110
PHALS_04330314037852248794e-109
PPTG_19690248375662248573e-108
H310_02604415933122208334e-108
PPTG_02121972912222118132e-106
PHYRA_41888687195862248374e-105
PPTG_1672792702172077829e-102
PHALS_1279092652141637375e-95
PYIR_167374785112467523e-93
PYAP_133414786572467476e-91
H257_167751460792912467151e-90
PYIW_217554786582467423e-90
PYU1_G0040984786562467372e-89
PHALS_008334786522467337e-89
PYAR_1835447810842467522e-88
PYVX_167384786582467293e-88
H310_094344786582467233e-87
SPRG_003334786152477177e-87
PYU1_G004097939966632467154e-86
PITG_005274786562467145e-86
PHYSO_2863764786602467137e-86
PHALS_00667297021421426662e-85
PPTG_082454786582467084e-85
PHYCA_5106964786592467084e-85
PHYRA_710424786542467042e-84
CCI502344786652467032e-84
HYAP_010054786602467014e-84
HYAP_01004939966602467014e-84
CCA249364786612466981e-83
PHYKE_79924786572466883e-82
SDRG_035644786582476858e-82
PYIR_24387849376332336577e-78
SPRG_105191275427823016658e-78
SDRG_0577797617863016641e-77
PYIW_22144849376332336551e-77
SPRG_1047797617622216622e-77
H310_147591275427872326623e-77
PYAP_22238849376332336524e-77
H257_1888597617862326604e-77
PYU1_G001540849376332336472e-76
HYAP_1266097617862336544e-76
H257_000071275427872326526e-76
PYVX_1812197616332336446e-76
PYIW_265671658555642196371e-75
PHALS_0207997617862336482e-75
PITG_1191397617862336464e-75
PPTG_0312197617863016464e-75
PHYCA_50982097617862156431e-74
CCI4609197617872336431e-74
PHYRA_7819397617862336422e-74
PHYKE_1081597617862336422e-74
CCA2082897617872336371e-73
PHYRA_72238694196012205403e-61
PHYSO_5252361275422462285003e-59
SPRG_104761275262702394946e-58
HYAP_06818127283162514977e-58
PHYSO_54956197613612374973e-57
PYAP_19738127286482075128e-57
PYU1_G003754127286502105083e-56
PHYRA_71123127286332105064e-56
H257_01277127286522175059e-56
PHALS_07616127286772105051e-55
PHYKE_9008127286502105031e-55
PHYSO_500480127286332105031e-55
PYVX_15051127286322415021e-55
PHYCA_541134127286332105021e-55
PITG_15786127286332105022e-55
PPTG_18274127286482105022e-55
H310_06631127286512175004e-55
SDRG_11043127286492104962e-54
CCI45982127286612204962e-54
SDRG_058161275424792354844e-54
SPRG_02294127286342104915e-54
CCA21514127286592144901e-53
PYIR_19697127286082484844e-53
PYIW_17145127284432014711e-52
PYAR_22188127286342734741e-51
PYAR_19930849376251804564e-49
PHYRA_51904408471291274013e-46
PHYSO_525429598456102274257e-45
H310_100601468051871913934e-44
H257_180821468051871933925e-44
PHYSO_339666694195852074107e-43
PYIR_2412330975672173983e-41
PITG_0572148643021353798e-41
SPRG_111331278736762343961e-40
H310_1276530975602173912e-40
PHYRA_7159130975702173913e-40
PYAP_1621630975642313903e-40
PYU1_G00694030975652173904e-40
PHYSO_55211630975702173886e-40
HYAP_0151156986206903632e-39
PPTG_1012230975692163852e-39
PITG_0354630975692163824e-39
PYIW_19165309711242173876e-39
HYAP_015389267130703473e-38
HYAP_0199330975692173763e-38
PHALS_0039030975692173754e-38
H257_0765030975632173736e-38
PHYCA_532207309711182183743e-37
SPRG_1569530975812223676e-37
PYU1_G002895133105612283658e-37
SDRG_1003830975652183658e-37
PITG_1537012408474773611e-36
PHYKE_6430975692173641e-36
PHYCA_6458133105602273622e-36
PYIR_13638133105432053612e-36
PYAR_246871058826182183623e-36
PYIW_17320133105632253613e-36
PYAR_14579133105672293613e-36
PHYRA_79054133105632283595e-36
PPTG_05819133105612273596e-36
PHYSO_493381133105622303571e-35
PITG_16528133105612273561e-35
PHALS_02692133105572263482e-34
SPRG_01255133105662153482e-34
CCI45261133105582293374e-33
H257_01680133105712153359e-33
PYVX_18450139303861903271e-32
CCA2022930975832323342e-32
PYVX_13615133105852373342e-32
CCI4758230975822303323e-32
CCA22305133105612343262e-31
H310_03911133105702333252e-31
SPRG_06720139304252183176e-31
PYVX_1769230975512143083e-29
PYAP_19903133105272113083e-29
H257_04453139304232173025e-29
SDRG_16559139304612173029e-29
PHYSO_339667525751601522822e-28
PYIW_19676457646645413042e-28
H310_12260139304242172956e-28
PYU1_G006843139304812142967e-28
HYAP_01856618952891232833e-27
PHALS_09281139304652202913e-27
PPTG_1708323795304982834e-27
PPTG_0405431403324982834e-27
PYAR_2470430975252012906e-27
PHYCA_120845139304442162877e-27
PYIW_19956139304592152871e-26
PHYRA_53570139303952182841e-26
SDRG_16621133105311142872e-26
PPTG_09003139304492182842e-26
PHYKE_7077133106312202872e-26
PYAR_221401046463531972792e-26
PITG_17383139304382182806e-26
HYAP_01857133104921162826e-26
PYIR_21692139304682272721e-24
PYAP_21865139304812312721e-24
CCA27145139304632232711e-24
PHYRA_423357534588942411e-23
SDRG_010671221796112162633e-23
SDRG_010681221786212382581e-22
SPRG_001831221796092492535e-22
HYAP_04460457648182262511e-21
PHYSO_285382139303791812451e-21
PHALS_04095457648032172458e-21
SPRG_001821221786152052448e-21
PPTG_19375457648092172431e-20
HYAP_0151040847138612241e-20
PHYKE_6664457648042412431e-20
PYVX_13288457648102252412e-20
PHYCA_111740415938102412403e-20
PYAR_15468457647692172393e-20
PHYRA_82545457648062172377e-20
PYU1_G008851457647952192377e-20
PYAP_18643457648042232332e-19
PHYSO_249902459321301322133e-19
HYAP_10418139303151142244e-19
CCA159131523708572282271e-18
CCI11769139303721332202e-18
PITG_1511112219186452102e-18
H310_062291261518002272243e-18
CCI467091523708192282233e-18
PHYCA_504114127148872162225e-18
PHYSO_24993230017232752115e-18
PYIR_18381457647472202225e-18
SPRG_06288127148692152217e-18
H257_164841261517952262209e-18
PPTG_1315922448197662061e-17
SDRG_171221278733611222151e-17
SDRG_01828127148662152201e-17
PPTG_18280242463842082151e-17
PITG_15771127148832082181e-17
PYU1_G003764127149102132172e-17
PHALS_08498127148952082154e-17
SDRG_032661261517922172154e-17
PYIR_24220127149082132154e-17
HYAP_07918127148972172154e-17
SPRG_1718513203283701925e-17
SPRG_080601261517932172145e-17
PHYRA_73661127148842082121e-16
PHYKE_9011127149022082111e-16
H310_01496127149042082102e-16
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_14487

Length=467
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR_14487                                                            862        0.0   
PYAP_17334                                                            476        1e-162
PYVX_15641                                                            461        6e-157
PYIW_16873                                                            454        6e-156
PYIR_15857                                                            454        1e-154
PYU1_G013927                                                          453        1e-153
HYAP_01540                                                            451        8e-153
PPTG_02122                                                            449        8e-152
PHYSO_480010                                                          448        2e-151
PHYSO_485614                                                          447        2e-151
PHYCA_104429                                                          446        6e-151
PHYRA_72463                                                           446        1e-150
SDRG_11899                                                            446        1e-150
SPRG_04533                                                            446        2e-150
PHYSO_344705                                                          449        5e-150
PITG_11244                                                            444        9e-150
PHYRA_47873                                                           434        2e-149
PHYSO_486085                                                          442        3e-149
PITG_11249                                                            442        4e-149
PITG_11247                                                            441        8e-149
PHYRA_47865                                                           429        7e-148
PHYCA_104465                                                          437        5e-147
PHYCA_532912                                                          435        9e-147
PHYCA_104335                                                          433        1e-145
PHYRA_72415                                                           433        1e-145
H310_02610                                                            431        7e-145
PYIR_16738                                                            422        8e-143
PPTG_02120                                                            434        5e-142
CCA16153                                                              422        4e-141
CCI40249                                                              421        1e-140
CCI43221                                                              410        2e-136
PYVX_22981                                                            407        7e-136
PYIW_16876                                                            407        9e-136
PYU1_G013931                                                          407        2e-135
PYAP_19235                                                            401        2e-133
SDRG_05778                                                            399        1e-132
SPRG_00068                                                            399        2e-132
PITG_11252                                                            398        5e-132
PHYSO_482793                                                          398        6e-132
PYAP_17333                                                            395        5e-131
SDRG_11473                                                            393        3e-130
PHYRA_71655                                                           386        2e-127
PYIR_15859                                                            385        4e-127
HYAP_01537                                                            385        9e-127
H257_12958                                                            382        8e-126
PHALS_09802                                                           382        1e-125
H310_09557                                                            378        3e-124
PHYCA_104444                                                          377        9e-124
PYAR_19807                                                            397        1e-123
PHYKE_7016                                                            372        5e-122
CCI40247                                                              362        7e-118
CCA16151                                                              359        4e-117
H257_17322                                                            344        1e-111
PHALS_01338                                                           336        2e-111
PHYKE_6984                                                            337        7e-111
CCA14967                                                              359        8e-111
PHYKE_2977                                                            326        7e-110
PHALS_04330                                                           343        4e-109
PPTG_19690                                                            334        3e-108
H310_02604                                                            325        4e-108
PPTG_02121                                                            317        2e-106
PHYRA_41888                                                           327        4e-105
PPTG_16727                                                            305        9e-102
PHALS_12790                                                           288        5e-95 
PYIR_16737                                                            294        3e-93 
PYAP_13341                                                            292        6e-91 
H257_16775                                                            280        1e-90 
PYIW_21755                                                            290        3e-90 
PYU1_G004098                                                          288        2e-89 
PHALS_00833                                                           286        7e-89 
PYAR_18354                                                            294        2e-88 
PYVX_16738                                                            285        3e-88 
H310_09434                                                            283        3e-87 
SPRG_00333                                                            280        7e-87 
PYU1_G004097                                                          280        4e-86 
PITG_00527                                                            279        5e-86 
PHYSO_286376                                                          279        7e-86 
PHALS_00667                                                           261        2e-85 
PPTG_08245                                                            277        4e-85 
PHYCA_510696                                                          277        4e-85 
PHYRA_71042                                                           275        2e-84 
CCI50234                                                              275        2e-84 
HYAP_01005                                                            274        4e-84 
HYAP_01004                                                            274        4e-84 
CCA24936                                                              273        1e-83 
PHYKE_7992                                                            269        3e-82 
SDRG_03564                                                            268        8e-82 
PYIR_24387                                                            257        7e-78 
SPRG_10519                                                            260        8e-78 
SDRG_05777                                                            260        1e-77 
PYIW_22144                                                            256        1e-77 
SPRG_10477                                                            259        2e-77 
H310_14759                                                            259        3e-77 
PYAP_22238                                                            255        4e-77 
H257_18885                                                            258        4e-77 
PYU1_G001540                                                          253        2e-76 
HYAP_12660                                                            256        4e-76 
H257_00007                                                            255        6e-76 
PYVX_18121                                                            252        6e-76 
PYIW_26567                                                            249        1e-75 
PHALS_02079                                                           254        2e-75 
PITG_11913                                                            253        4e-75 
PPTG_03121                                                            253        4e-75 
PHYCA_509820                                                          252        1e-74 
CCI46091                                                              252        1e-74 
PHYRA_78193                                                           251        2e-74 
PHYKE_10815                                                           251        2e-74 
CCA20828                                                              249        1e-73 
PHYRA_72238                                                           212        3e-61 
PHYSO_525236                                                          197        3e-59 
SPRG_10476                                                            194        6e-58 
HYAP_06818                                                            196        7e-58 
PHYSO_549561                                                          196        3e-57 
PYAP_19738                                                            201        8e-57 
PYU1_G003754                                                          200        3e-56 
PHYRA_71123                                                           199        4e-56 
H257_01277                                                            199        9e-56 
PHALS_07616                                                           199        1e-55 
PHYKE_9008                                                            198        1e-55 
PHYSO_500480                                                          198        1e-55 
PYVX_15051                                                            197        1e-55 
PHYCA_541134                                                          197        1e-55 
PITG_15786                                                            197        2e-55 
PPTG_18274                                                            197        2e-55 
H310_06631                                                            197        4e-55 
SDRG_11043                                                            195        2e-54 
CCI45982                                                              195        2e-54 
SDRG_05816                                                            191        4e-54 
SPRG_02294                                                            193        5e-54 
CCA21514                                                              193        1e-53 
PYIR_19697                                                            191        4e-53 
PYIW_17145                                                            186        1e-52 
PYAR_22188                                                            187        1e-51 
PYAR_19930                                                            180        4e-49 
PHYRA_51904                                                           159        3e-46 
PHYSO_525429                                                          168        7e-45 
H310_10060                                                            155        4e-44 
H257_18082                                                            155        5e-44 
PHYSO_339666                                                          162        7e-43 
PYIR_24123                                                            157        3e-41 
PITG_05721                                                            150        8e-41 
SPRG_11133                                                            157        1e-40 
H310_12765                                                            155        2e-40 
PHYRA_71591                                                           155        3e-40 
PYAP_16216                                                            154        3e-40 
PYU1_G006940                                                          154        4e-40 
PHYSO_552116                                                          154        6e-40 
HYAP_01511                                                            144        2e-39 
PPTG_10122                                                            152        2e-39 
PITG_03546                                                            151        4e-39 
PYIW_19165                                                            153        6e-39 
HYAP_01538                                                            138        3e-38 
HYAP_01993                                                            149        3e-38 
PHALS_00390                                                           149        4e-38 
H257_07650                                                            148        6e-38 
PHYCA_532207                                                          148        3e-37 
SPRG_15695                                                            145        6e-37 
PYU1_G002895                                                          145        8e-37 
SDRG_10038                                                            145        8e-37 
PITG_15370                                                            143        1e-36 
PHYKE_64                                                              144        1e-36 
PHYCA_6458                                                            144        2e-36 
PYIR_13638                                                            143        2e-36 
PYAR_24687                                                            144        3e-36 
PYIW_17320                                                            143        3e-36 
PYAR_14579                                                            143        3e-36 
PHYRA_79054                                                           142        5e-36 
PPTG_05819                                                            142        6e-36 
PHYSO_493381                                                          142        1e-35 
PITG_16528                                                            141        1e-35 
PHALS_02692                                                           138        2e-34 
SPRG_01255                                                            138        2e-34 
CCI45261                                                              134        4e-33 
H257_01680                                                            133        9e-33 
PYVX_18450                                                            130        1e-32 
CCA20229                                                              133        2e-32 
PYVX_13615                                                            133        2e-32 
CCI47582                                                              132        3e-32 
CCA22305                                                              130        2e-31 
H310_03911                                                            129        2e-31 
SPRG_06720                                                            126        6e-31 
PYVX_17692                                                            123        3e-29 
PYAP_19903                                                            123        3e-29 
H257_04453                                                            120        5e-29 
SDRG_16559                                                            120        9e-29 
PHYSO_339667                                                          113        2e-28 
PYIW_19676                                                            121        2e-28 
H310_12260                                                            118        6e-28 
PYU1_G006843                                                          118        7e-28 
HYAP_01856                                                            113        3e-27 
PHALS_09281                                                           116        3e-27 
PPTG_17083                                                            113        4e-27 
PPTG_04054                                                            113        4e-27 
PYAR_24704                                                            116        6e-27 
PHYCA_120845                                                          115        7e-27 
PYIW_19956                                                            115        1e-26 
PHYRA_53570                                                           114        1e-26 
SDRG_16621                                                            115        2e-26 
PPTG_09003                                                            114        2e-26 
PHYKE_7077                                                            115        2e-26 
PYAR_22140                                                            112        2e-26 
PITG_17383                                                            112        6e-26 
HYAP_01857                                                            113        6e-26 
PYIR_21692                                                            109        1e-24 
PYAP_21865                                                            109        1e-24 
CCA27145                                                              108        1e-24 
PHYRA_42335                                                           97.4       1e-23 
SDRG_01067                                                            105        3e-23 
SDRG_01068                                                            103        1e-22 
SPRG_00183                                                            102        5e-22 
HYAP_04460                                                            101        1e-21 
PHYSO_285382                                                          99.0       1e-21 
PHALS_04095                                                           99.0       8e-21 
SPRG_00182                                                            98.6       8e-21 
PPTG_19375                                                            98.2       1e-20 
HYAP_01510                                                            90.9       1e-20 
PHYKE_6664                                                            98.2       1e-20 
PYVX_13288                                                            97.4       2e-20 
PHYCA_111740                                                          97.1       3e-20 
PYAR_15468                                                            96.7       3e-20 
PHYRA_82545                                                           95.9       7e-20 
PYU1_G008851                                                          95.9       7e-20 
PYAP_18643                                                            94.4       2e-19 
PHYSO_249902                                                          86.7       3e-19 
HYAP_10418                                                            90.9       4e-19 
CCA15913                                                              92.0       1e-18 
CCI11769                                                              89.4       2e-18 
PITG_15111                                                            85.5       2e-18 
H310_06229                                                            90.9       3e-18 
CCI46709                                                              90.5       3e-18 
PHYCA_504114                                                          90.1       5e-18 
PHYSO_249932                                                          85.9       5e-18 
PYIR_18381                                                            90.1       5e-18 
SPRG_06288                                                            89.7       7e-18 
H257_16484                                                            89.4       9e-18 
PPTG_13159                                                            84.0       1e-17 
SDRG_17122                                                            87.4       1e-17 
SDRG_01828                                                            89.4       1e-17 
PPTG_18280                                                            87.4       1e-17 
PITG_15771                                                            88.6       1e-17 
PYU1_G003764                                                          88.2       2e-17 
PHALS_08498                                                           87.4       4e-17 
SDRG_03266                                                            87.4       4e-17 
PYIR_24220                                                            87.4       4e-17 
HYAP_07918                                                            87.4       4e-17 
SPRG_17185                                                            78.6       5e-17 
SPRG_08060                                                            87.0       5e-17 
PHYRA_73661                                                           86.3       1e-16 
PHYKE_9011                                                            85.9       1e-16 
H310_01496                                                            85.5       2e-16 
H310_01493                                                            85.5       2e-16 
PYAR_16202                                                            85.5       2e-16 
PHYRA_81377                                                           83.6       3e-16 
PHYSO_255506                                                          84.3       5e-16 
PYAP_19741                                                            84.0       5e-16 
CCI45987                                                              84.0       6e-16 
PYIR_25979                                                            82.0       1e-15 
PYVX_15061                                                            82.8       1e-15 
H257_00287                                                            82.0       2e-15 
CCA21519                                                              82.0       2e-15 
PYVX_17117                                                            80.9       5e-15 
PHYSO_247517                                                          80.5       7e-15 
PHYSO_342817                                                          74.7       2e-14 
PPTG_14555                                                            78.2       3e-14 
PYIW_14231                                                            76.3       2e-13 
PITG_21580                                                            75.9       2e-13 
PHYRA_46132                                                           69.3       4e-13 
PYU1_G000896                                                          74.7       4e-13 
CCI45196                                                              68.6       7e-13 
PHYSO_321565                                                          72.4       2e-12 
PHYCA_558934                                                          72.0       2e-12 
PITG_03068                                                            71.6       3e-12 
SPRG_11007                                                            60.8       6e-09 
PYU1_G004743                                                          58.9       4e-08 
PHYSO_383637                                                          52.8       6e-08 
PYIW_21045                                                            57.0       2e-07 
PPTG_22662                                                            55.8       2e-07 
PYIR_22849                                                            53.1       6e-07 
PYVX_22561                                                            54.3       1e-06 
PHYSO_530254                                                          48.1       2e-06 
HYAP_04461                                                            49.7       5e-06 
PPTG_04864                                                            52.0       5e-06 
PHYRA_54751                                                           46.2       7e-06 
SPRG_00713                                                            51.2       9e-06 
SDRG_01561                                                            50.4       2e-05 
PHYCA_549822                                                          48.5       6e-05 
PHYRA_82300                                                           48.9       6e-05 
H257_18435                                                            48.5       7e-05 
PYIR_14416                                                            47.0       2e-04 
PYAP_23247                                                            46.2       3e-04 
PHALS_00479                                                           46.2       3e-04 
PPTG_09610                                                            41.2       4e-04 
PYIW_19781                                                            45.4       6e-04 
PHYSO_353741                                                          45.4       6e-04 
PYVX_22905                                                            45.4       7e-04 
PYU1_G008203                                                          45.1       8e-04 
PITG_11248                                                            41.6       0.001 
PYAR_13948                                                            44.7       0.001 
PPTG_10700                                                            42.4       0.001 
PITG_02259                                                            44.7       0.001 
H310_05216                                                            43.9       0.002 
PYIR_20734                                                            43.1       0.003 
PPTG_18422                                                            42.0       0.007 
HYAP_00880                                                            42.0       0.008 
PPTG_23039                                                            39.3       0.008 
PHYKE_585                                                             42.0       0.008 
PHYKE_9691                                                            41.6       0.012 
PHYSO_532708                                                          39.3       0.039 
SDRG_11277                                                            35.8       0.040 
PHYCA_502791                                                          39.3       0.048 
PPTG_22091                                                            35.0       0.056 
PPTG_05521                                                            35.0       0.056 
PYIW_26103                                                            38.5       0.092 
CCI47104                                                              38.1       0.093 
PYAP_20766                                                            38.1       0.098 
PYAR_14386                                                            38.5       0.10  
SPRG_08648                                                            35.4       0.65  
PHYRA_80453                                                           35.4       0.75  
SDRG_10651                                                            34.7       1.2   
PITG_03970                                                            33.9       1.9   
CCI44418                                                              34.3       2.0   
PPTG_17863                                                            32.3       3.3   
PYAR_19840                                                            33.1       4.4   
PYVX_15388                                                            32.0       8.4   

>PYAR_14487
Length=467

 Score = 862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/467 (100%), Positives = 467/467 (100%), Gaps = 0/467 (0%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENTITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDS  120
            QVAMNAENTITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDS
Sbjct  61   QVAMNAENTITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDS  120

Query  121  QRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEE  180
            QRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEE
Sbjct  121  QRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEE  180

Query  181  GIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPT  240
            GIFEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPT
Sbjct  181  GIFEAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSQGLETAGGVMTVLIPRNTTVPT  240

Query  241  KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  300
            KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA
Sbjct  241  KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  300

Query  301  NGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGL  360
            NGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGL
Sbjct  301  NGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGL  360

Query  361  ENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420
            ENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI
Sbjct  361  ENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420

Query  421  ANPILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ANPILQKMYASAGAAGGMPGGAPGAPGAPGPAPSAGGDQGPKIEEVD
Sbjct  421  ANPILQKMYASAGAAGGMPGGAPGAPGAPGPAPSAGGDQGPKIEEVD  467

>PYAP_17334
Length=650

 Score = 476 bits (1226),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 264/284 (93%), Positives = 271/284 (95%), Gaps = 3/284 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLS GLETAGGVMT LIPRNTTVPTKKT
Sbjct  370  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTVPTKKT  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSA+EKSTGKENKITITNDKGRLSQADI+RMV+EAEKYK+EDEANKIRIEAKNGLENY
Sbjct  490  LNVSAIEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKIRIEAKNGLENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+SQIPEDDRKAIDDKVTE+INWLDAHQASEKEEFEAKQKELEGIANP
Sbjct  550  AYNLRNTLNDEKLKSQIPEDDRKAIDDKVTEVINWLDAHQASEKEEFEAKQKELEGIANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY    +AG   G    APGAPGPAPSAGGDQGPKIEEVD
Sbjct  610  ILQKMY---ASAGAAGGMPGAAPGAPGPAPSAGGDQGPKIEEVD  650

 Score = 350 bits (898),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 183/224 (82%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+V+GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MAQAVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFTVSPGAGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVLTKMREV+EAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLTKMREVAEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PYVX_15641
Length=629

 Score = 461 bits (1186),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 248/284 (87%), Positives = 262/284 (92%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LIPRNTTVPTKK+
Sbjct  346  EAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTTVPTKKS  405

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  406  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  465

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYK+EDEANK+RI+AKNGLENY
Sbjct  466  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKAEDEANKVRIDAKNGLENY  525

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            +YNLRNTLNDEKL+SQI E+DRKAIDDKVTE INWLDA+Q++EKEEFEAKQKELEGIANP
Sbjct  526  SYNLRNTLNDEKLKSQISEEDRKAIDDKVTETINWLDANQSAEKEEFEAKQKELEGIANP  585

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMYA+AG A G   G        G  P+ G DQGPKIEEVD
Sbjct  586  ILQKMYAAAGGAPGGMPGGGMPGADAGAPPAGGADQGPKIEEVD  629

 Score = 342 bits (876),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MAQAVSGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     I V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFTLTSGPGDKPQIQVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PYIW_16873
Length=496

 Score = 454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 252/285 (88%), Positives = 266/285 (93%), Gaps = 1/285 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  212  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKKS  271

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  272  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  331

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYK+EDE+NK+RIEAKNGLENY
Sbjct  332  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRIEAKNGLENY  391

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTL+DEKL+SQI E+DR AI+DKVTE INWLDA+Q++EKEEFEAKQKELEGIANP
Sbjct  392  AYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQKELEGIANP  451

Query  424  ILQKMY-asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY A+ GA G   G   G PGA  P P+AGGDQGPKIEEVD
Sbjct  452  ILQKMYAAAGGAGGMPGGAPGGMPGAGAPPPAAGGDQGPKIEEVD  496

 Score = 130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/66 (97%), Positives = 64/66 (97%), Gaps = 0/66 (0%)

Query  122  RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG
Sbjct  1    RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  60

Query  182  IFEAVA  187
            IFE  A
Sbjct  61   IFEVKA  66

>PYIR_15857
Length=577

 Score = 454 bits (1167),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 246/284 (87%), Positives = 260/284 (92%), Gaps = 1/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  295  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  354

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  355  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  414

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYK+EDE+NK+RIEAKNGLENY
Sbjct  415  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRIEAKNGLENY  474

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTL+DEKL+SQI E+DR AI+DKVTE INWLDA+Q++EKEEFEAKQKELEGIANP
Sbjct  475  AYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQKELEGIANP  534

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY +A    G   G        G  P+AGGDQGPKIEEVD
Sbjct  535  ILQKMY-AAAGGAGGMPGGAPGAPGAGAPPAAGGDQGPKIEEVD  577

 Score = 184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 100/142 (70%), Gaps = 37/142 (26%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGE+KTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKD  105
            EEISSMVL KMREVSEAFIGK+
Sbjct  121  EEISSMVLIKMREVSEAFIGKE  142

>PYU1_G013927
Length=649

 Score = 453 bits (1166),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 246/284 (87%), Positives = 260/284 (92%), Gaps = 4/284 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYK+EDE+NK+RIEAKNGLENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKAEDESNKVRIEAKNGLENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTL+DEKL+SQI E+DR AI+DKVTE INWLDA+Q++EKEEFEAKQKELEG+ANP
Sbjct  550  AYNLRNTLDDEKLKSQISEEDRSAINDKVTETINWLDANQSAEKEEFEAKQKELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY    AA G  GG PG     G  P+   DQGPKIEEVD
Sbjct  610  ILQKMY----AAAGGAGGMPGGAPPAGAPPAGAPDQGPKIEEVD  649

 Score = 343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADCKHWPFTVSAGPGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREVSEAFIGK+V+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVRNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>HYAP_01540
Length=634

 Score = 451 bits (1160),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 238/246 (97%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  332  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  391

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  392  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  451

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANKIRIEAKN LENY
Sbjct  452  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKIRIEAKNALENY  511

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QIPEDDRKAIDDKVTE INWLDA+Q++EKEE+EAKQKE+E +ANP
Sbjct  512  AYNLRNTLNDEKLKDQIPEDDRKAIDDKVTETINWLDANQSAEKEEYEAKQKEVESVANP  571

Query  424  ILQKMY  429
            ILQKMY
Sbjct  572  ILQKMY  577

 Score = 151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 104/169 (62%), Gaps = 25/169 (15%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTP-----SYVAFTDSERLIG  55
            MAQ+++  SVGID+GT YS VGVWQND VEIIA DQGNRT+      ++    D +RLIG
Sbjct  1    MAQTMSDYSVGIDVGTMYSRVGVWQNDSVEIIAKDQGNRTSAVVAMNAHNTVFDGKRLIG  60

Query  56   DAAKNQVAM--------------NAENTITVTFKGESKTFQPEEISSMVLTKMREVSEAF  101
                + V                  +  ITV FKGESKTFQ EEISSMVL KMREV+EAF
Sbjct  61   RKFSDAVVQADVKHWPFKLTSGAGDKPQITVQFKGESKTFQSEEISSMVLIKMREVAEAF  120

Query  102  IGKDVKNAVITVPAYFNDSQRQATK------DAGAIAGLNVLRIINEPT  144
            +GK+VK AVITVPAYFNDSQRQ  +      D+     L   R+   PT
Sbjct  121  MGKEVKKAVITVPAYFNDSQRQRRRMQGPLLDSTCSVSLTSRRLRPSPT  169

>PPTG_02122
Length=657

 Score = 449 bits (1155),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 248/288 (86%), Positives = 261/288 (91%), Gaps = 4/288 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QI EDD+KAIDDKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  550  AYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  609

Query  424  ILQKMY----asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY     + GA GGMPGG PG     G  P+   DQGPKIEEVD
Sbjct  610  ILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  657

 Score = 344 bits (883),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 181/224 (81%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYSO_480010
Length=653

 Score = 448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 261/284 (92%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ +IPE D+K +DDKVTE I WLDAHQ+SEKEE+EAKQKELEG+ANP
Sbjct  550  AYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQK+YA+AG  GGMPGG P   GA     + G DQGPKIEEVD
Sbjct  610  VLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

 Score = 342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYSO_485614
Length=653

 Score = 447 bits (1151),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 261/284 (92%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ +IPE D+K +DDKVTE I WLDAHQ+SEKEE+EAKQKELEG+ANP
Sbjct  550  AYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQK+YA+AG  GGMPGG P   GA     + G DQGPKIEEVD
Sbjct  610  VLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGADQGPKIEEVD  653

 Score = 342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYCA_104429
Length=645

 Score = 446 bits (1148),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 246/288 (85%), Positives = 261/288 (91%), Gaps = 4/288 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  358  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  417

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  418  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  477

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK+RIEAKN LENY
Sbjct  478  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENY  537

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QI EDD+KAI+DKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  538  AYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  597

Query  424  ILQKMY----asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY     + GA GGMPGG PG     G  P+   DQGPKIEEVD
Sbjct  598  ILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  645

 Score = 345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 181/224 (81%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYRA_72463
Length=658

 Score = 446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 246/288 (85%), Positives = 261/288 (91%), Gaps = 4/288 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  371  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  430

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  431  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  490

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK+RIEAKN LENY
Sbjct  491  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENY  550

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QI EDD+KAI+DKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  551  AYNLRNTLNDEKLKDQISEDDKKAIEDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  610

Query  424  ILQKMY----asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY     + GA GGMPGG PG     G  P+   DQGPKIEEVD
Sbjct  611  ILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  658

 Score = 337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 180/225 (80%), Gaps = 38/225 (17%)

Query  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            MAQ+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            PEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  225

>SDRG_11899
Length=652

 Score = 446 bits (1147),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 257/284 (90%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  369  EAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  429  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRL++ DIERMV EAEKYKSEDEANK+RIEAKNGLENY
Sbjct  489  LNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKLQ +I E D+KAIDDKVT++INWLDA+Q++EKEEFEAKQKELEGIANP
Sbjct  549  AYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGIANP  608

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            I+QKMYA+AG A G   G     G  G  P A   QGPKIEEVD
Sbjct  609  IMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHAQGPKIEEVD  652

 Score = 329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            V GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            N  NT                                     ITV FKGESKTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEIS  123

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+EVSEAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>SPRG_04533
Length=652

 Score = 446 bits (1146),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 257/284 (90%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  369  EAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  429  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQIDVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRL++ DIERMV EAEKYKSEDEANK+RIEAKNGLENY
Sbjct  489  LNVSAVEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKLRIEAKNGLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKLQ +I E D+KAIDDKVT++INWLDA+Q++EKEEFEAKQKELEGIANP
Sbjct  549  AYNLRNTLNDEKLQGKIDEADKKAIDDKVTDVINWLDANQSAEKEEFEAKQKELEGIANP  608

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            I+QKMYA+AG A G   G     G  G  P A   QGPKIEEVD
Sbjct  609  IMQKMYAAAGGAPGGMPGGMPDMGGAGAPPPASHAQGPKIEEVD  652

 Score = 329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            V GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            N  NT                                     ITV FKGESKTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPATQADIKHWPFKVTPGAGDKPQITVEFKGESKTFQPEEIS  123

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+EVSEAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSPVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PHYSO_344705
Length=798

 Score = 449 bits (1155),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 248/288 (86%), Positives = 261/288 (91%), Gaps = 4/288 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  511  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  570

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  571  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  630

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  631  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKSEDEANKVRIEAKNALENY  690

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QI EDD+KAIDDKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  691  AYNLRNTLNDEKLKDQISEDDKKAIDDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  750

Query  424  ILQKMY----asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY     + GA GGMPGG PG     G  P+   DQGPKIEEVD
Sbjct  751  ILQKMYAAAGGAPGAEGGMPGGMPGGMPGAGAPPAGAPDQGPKIEEVD  798

 Score = 344 bits (883),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 181/224 (81%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  142  MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  201

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  202  QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKISSGAGDKPQITVQFKGESKTFQP  261

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  262  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  321

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  322  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  365

>PITG_11244
Length=663

 Score = 444 bits (1142),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 237/294 (81%), Positives = 250/294 (85%), Gaps = 10/294 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKL+ QI EDD+K IDDKVTE INWLDA+Q++EKEE+E KQKELEG+ANP
Sbjct  550  AYNLRNTLNDEKLKDQISEDDKKVIDDKVTETINWLDANQSAEKEEYEGKQKELEGVANP  609

Query  424  ILQKMY----------asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY                            A G  P+   DQGPKIEEVD
Sbjct  610  ILQKMYAAAGGAPGAEGGMPGGMPGGMPGGMPGAAGGAPPAGAPDQGPKIEEVD  663

 Score = 344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 181/224 (81%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKITAGAGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYRA_47873
Length=396

 Score = 434 bits (1115),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 257/285 (90%), Gaps = 1/285 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAIL GND S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK 
Sbjct  112  EAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKA  171

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGI
Sbjct  172  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGI  231

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ+DI+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  232  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENY  291

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ QIPE D+K +DDKVTE I WLDAHQ++E EE+E+KQKELEG+ANP
Sbjct  292  AYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANP  351

Query  424  ILQKMYasagaaggmpggap-gapgapgpapsaggDQGPKIEEVD  467
            ILQKMYA+AG A G  GG P G PGA     S G DQGPKIEEVD
Sbjct  352  ILQKMYAAAGGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  396

>PHYSO_486085
Length=653

 Score = 442 bits (1137),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 260/284 (92%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ +IPE D+K +DDKVTE I WLDAHQ+SEKEE+EAKQKELEG+ANP
Sbjct  550  AYSLRNSLNDEKLKEKIPEADKKVVDDKVTETIQWLDAHQSSEKEEYEAKQKELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQK+YA+AG  GGMPGG P   GA     + G  +GPKI+EVD
Sbjct  610  VLQKVYAAAGGMGGMPGGMPAGAGASAAPSAGGAGEGPKIDEVD  653

 Score = 342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQTTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPVVQADIQHWPFKISSGPGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PITG_11249
Length=653

 Score = 442 bits (1137),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 258/284 (91%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+IERMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSEDEANKVRIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEK++ +IPE D+K +DDKVTE+I W+DAHQ+SEKEE+E+KQKELE +ANP
Sbjct  550  AYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWMDAHQSSEKEEYESKQKELESVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQK+YASAG AG    G+         + S+G +QGPKIEEVD
Sbjct  610  VLQKVYASAGGAGDGMPGSMPNDMPGTDSRSSGAEQGPKIEEVD  653

 Score = 339 bits (869),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 179/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M Q+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PITG_11247
Length=653

 Score = 441 bits (1135),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 255/284 (90%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+IERMVAEAEKYKS DEANK RIEAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIERMVAEAEKYKSADEANKARIEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEK++ +IPE D+K +DDKVTE+I WLDAHQ+SEKEE+E+KQKELE +ANP
Sbjct  550  AYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDAHQSSEKEEYESKQKELESVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQK+YASAG AG    G          + S+G +QGPKIEEVD
Sbjct  610  VLQKVYASAGGAGDGMPGGMPGDMPGTDSRSSGAEQGPKIEEVD  653

 Score = 340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 179/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M Q+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGE+KTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPVVQADIKHWPFKITAGPGDKPQITVQFKGETKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYRA_47865
Length=381

 Score = 429 bits (1103),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 236/289 (82%), Positives = 255/289 (88%), Gaps = 5/289 (2%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAIL GND S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK 
Sbjct  93   EAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKA  152

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGI
Sbjct  153  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGI  212

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ+DI+RMVAEAEKYKSED+ANK+RIEAKN LENY
Sbjct  213  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDKANKVRIEAKNALENY  272

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ QIPE D+K +DDKVTE INWLDA+Q++E EE+E+KQKELEG+ANP
Sbjct  273  AYSLRNSLNDEKLKEQIPEADKKVVDDKVTETINWLDANQSAETEEYESKQKELEGVANP  332

Query  424  ILQKMYasagaaggmpggapgapgapgpapsag-----gDQGPKIEEVD  467
            ILQKMYA+AG A G  GG PG      P   A       DQGPKIEEVD
Sbjct  333  ILQKMYAAAGGAPGAEGGVPGGMPGGMPGAGAAPSSGGADQGPKIEEVD  381

>PHYCA_104465
Length=653

 Score = 437 bits (1123),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 230/284 (81%), Positives = 252/284 (89%), Gaps = 1/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  371  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  430

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  431  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  490

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK RIEAKN LENY
Sbjct  491  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENY  550

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEK++ +IPE D+KA+DDKVTE+I WLDA+Q+ EK+ +E+KQKELEG+ANP
Sbjct  551  AYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANP  610

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQKMY ++G                 P  S+G DQGPKIEEVD
Sbjct  611  VLQKMY-ASGGGMAGGVPGGMPGADAAPTSSSGTDQGPKIEEVD  653

 Score = 338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 179/225 (80%), Gaps = 38/225 (17%)

Query  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            M Q+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            PEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  225

>PHYCA_532912
Length=626

 Score = 435 bits (1119),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 232/286 (81%), Positives = 253/286 (88%), Gaps = 2/286 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  341  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  400

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  401  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  460

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK RIEAKN LENY
Sbjct  461  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENY  520

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEK++ +IPE D+KA+DDKVTE+I WLDA+Q+ EK+ +E+KQKELEG+ANP
Sbjct  521  AYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANP  580

Query  424  ILQKMYasa--gaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQKMYA+A                G PG  P+   DQGPKIEEVD
Sbjct  581  VLQKMYAAAGGSPGAEGGMPGGVPGGMPGAPPAGAADQGPKIEEVD  626

 Score = 265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 149/225 (66%), Gaps = 68/225 (30%)

Query  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            M Q+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            PEEISSMVL KMRE                              DAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMRE------------------------------DAGAIAGLNVLRIINE  150

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  151  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  195

>PHYCA_104335
Length=656

 Score = 433 bits (1114),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 231/286 (81%), Positives = 253/286 (88%), Gaps = 2/286 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  371  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  430

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  431  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  490

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYKSEDEANK RIEAKN LENY
Sbjct  491  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKSEDEANKQRIEAKNALENY  550

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEK++ +IPE D+KA+DDKVTE+I WLDA+Q+ EK+ +E+KQKELEG+ANP
Sbjct  551  AYSLRNSLNDEKMKEKIPEADKKAVDDKVTEVIQWLDANQSLEKDAYESKQKELEGVANP  610

Query  424  ILQKMYasa--gaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            +LQKMYA+A                G PG  P+   +QGPKIEEVD
Sbjct  611  VLQKMYAAAGGSPGAEGGMPGGVPGGMPGAPPAGAAEQGPKIEEVD  656

 Score = 338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 179/225 (80%), Gaps = 38/225 (17%)

Query  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            M Q+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK
Sbjct  1    MTQATTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  60

Query  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPVVQADIKHWPFQVTSGAGDKPQITVQFKGESKTFQ  120

Query  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            PEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  225

>PHYRA_72415
Length=655

 Score = 433 bits (1114),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 257/285 (90%), Gaps = 1/285 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAIL GND S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK 
Sbjct  371  EAVAYGATVQAAILGGNDSSDKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKA  430

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDN+LLGKFNLD IPPMPRGVPQIDVTFDIDANGI
Sbjct  431  QTFSTYADNQPGVLIQVFEGERSMTRDNHLLGKFNLDAIPPMPRGVPQIDVTFDIDANGI  490

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ+DI+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  491  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVAEAEKYKSEDEANKVRIEAKNALENY  550

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+LNDEKL+ QIPE D+K +DDKVTE I WLDAHQ++E EE+E+KQKELEG+ANP
Sbjct  551  AYSLRNSLNDEKLKEQIPEADKKVVDDKVTETIQWLDAHQSAETEEYESKQKELEGVANP  610

Query  424  ILQKMYasagaaggmpggap-gapgapgpapsaggDQGPKIEEVD  467
            ILQKMYA+AG A G  GG P G PGA     S G DQGPKIEEVD
Sbjct  611  ILQKMYAAAGGAPGAEGGVPGGMPGAGAAPSSGGADQGPKIEEVD  655

 Score = 337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 180/225 (80%), Gaps = 38/225 (17%)

Query  1    MAQSVT-GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            MAQ+ T G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAK
Sbjct  1    MAQAKTSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAK  60

Query  60   NQVAMNAENT-------------------------------------ITVTFKGESKTFQ  82
            NQVAMNA NT                                     ITV FKGESKTFQ
Sbjct  61   NQVAMNAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQ  120

Query  83   PEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            PEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE
Sbjct  121  PEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  180

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  225

>H310_02610
Length=650

 Score = 431 bits (1108),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 254/284 (89%), Gaps = 2/284 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  369  EAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIQRNTTVPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF+LDGIPPMPRGVPQ+DVTFDIDANGI
Sbjct  429  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFSLDGIPPMPRGVPQVDVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSA+EKSTGKENKITITNDKGRL++ DIERMV EAEKYKSEDEANK+RIEAKNGLENY
Sbjct  489  LNVSAIEKSTGKENKITITNDKGRLTKDDIERMVQEAEKYKSEDEANKVRIEAKNGLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEKLQ ++   D+K +DDKVTE I+WLDA+Q++EKEEFEAKQKELEG+ANP
Sbjct  549  AYNLRNTLNDEKLQGKLDAADKKTVDDKVTETISWLDANQSAEKEEFEAKQKELEGVANP  608

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            I+QK+YA+ GA GG  G      G   P  S+   QGPKIEEVD
Sbjct  609  IMQKLYAAGGAPGGPGGMPDFGAGGAPPPASSA--QGPKIEEVD  650

 Score = 327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            V GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            N  NT                                     ITV FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+EVSEA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PYIR_16738
Length=555

 Score = 422 bits (1086),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 234/496 (47%), Positives = 325/496 (66%), Gaps = 69/496 (14%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  26   AKGPRGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  85

Query  61   QVAMNAENT------------------------------------ITVTFKGESKTFQPE  84
            Q  +N E T                                    I V  KGE K F PE
Sbjct  86   QATINPEQTLFDVKRLIGRSYNDKSVQADKKLLPYKIVDKDGKPAIEVPIKGEKKLFSPE  145

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDA-----GAIAGLNVLRI  139
            EIS+M+LTKM++++E ++GKD+ +AV+TVPAYFND+QRQATKDA       + G +    
Sbjct  146  EISAMILTKMKQIAEGYLGKDIHDAVVTVPAYFNDAQRQATKDAXXXXDSLLDGEDFSET  205

Query  140  INEPTAAAIAYGLDKK--GGERNVL------------IFDLGGGTFDVSLLSIEEGIF--  183
            ++      +   L KK  G    VL            I  +GG T    +  + +  F  
Sbjct  206  LSRARFEKLNEDLFKKTLGPVEKVLKDAGVKKSEVDEIVLVGGSTRIPKVQQLIKDYFNG  265

Query  184  ----------EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIP  233
                      EAVA+GA VQ  ILSG +Q E L D++L+DV PLSQG+ET GGVMT LI 
Sbjct  266  KEPSRGVNPDEAVAYGAAVQGGILSGAEQ-EGLGDMVLIDVVPLSQGIETVGGVMTKLIN  324

Query  234  RNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID  293
            +NT +PTKK+Q FST+ DNQP V I+V+EGER++ +DN+LLGKF+L GIPP PRGVPQI 
Sbjct  325  KNTAIPTKKSQVFSTHVDNQPAVSIKVYEGERALVKDNHLLGKFDLTGIPPAPRGVPQIQ  384

Query  294  VTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIR  353
            VTF++DANGIL VSA +K TGK  KITIT +KGRLSQ +I+R++ EAE++  ED+  K R
Sbjct  385  VTFEVDANGILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRIIREAEQFAEEDKRVKER  444

Query  354  IEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAK  413
            I+++N LE+Y YN++N++ D+K+ +++ ++D+ A+   V + ++WL+ +Q ++K++F+AK
Sbjct  445  IDSQNALESYLYNVKNSVEDDKVAAKMEDEDKDAVLKSVQDAMDWLEDNQEADKDDFDAK  504

Query  414  QKELEGIANPILQKMY  429
            QKE+E I NPI++K+Y
Sbjct  505  QKEVEKIVNPIMKKVY  520

>PPTG_02120
Length=1001

 Score = 434 bits (1116),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 227/286 (79%), Positives = 251/286 (88%), Gaps = 2/286 (1%)

Query  184   EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
             EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  716   EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  775

Query  244   QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
             QTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  776   QTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  835

Query  304   LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
             LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMVAEAEKYKSEDEANK+RIEAKN LENY
Sbjct  836   LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVAEAEKYKSEDEANKVRIEAKNALENY  895

Query  364   AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             AY+LRN+LNDEK++ +IPE D+K +DDKVTE+I WLDA+Q++EKEE+E+KQKELE +ANP
Sbjct  896   AYSLRNSLNDEKMKEKIPEADKKVVDDKVTEVIQWLDANQSAEKEEYESKQKELESVANP  955

Query  424   ILQKMY--asagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
             +LQK+Y  A                    P+ S+  DQGPKIEEVD
Sbjct  956   VLQKVYASAGGADGMAGGMAGGMPGAGAAPSSSSSTDQGPKIEEVD  1001

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 45/50 (90%), Gaps = 0/50 (0%)

Query  138  RIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            R +  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  521  RGLYHPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  570

>CCA16153
Length=663

 Score = 422 bits (1084),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/246 (85%), Positives = 231/246 (94%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDV PLS GLETAGGVMTVLIPRNTT+PTKK+
Sbjct  366  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANGI
Sbjct  426  QLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYK +DEANK+RIEAKNGLENY
Sbjct  486  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLENY  545

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRN+LNDEKL+SQ+ EDDRK +DDK++E +NWLDA+Q++EKEE+E  QK+LE IANP
Sbjct  546  AYNLRNSLNDEKLKSQLSEDDRKILDDKISETMNWLDANQSAEKEEYEKLQKDLEAIANP  605

Query  424  ILQKMY  429
            ILQKMY
Sbjct  606  ILQKMY  611

 Score = 315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 170/220 (77%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            +T  ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  1    MTDKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  60

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     I V FKGE K FQPEEIS
Sbjct  61   NAANTVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVIFKGEKKIFQPEEIS  120

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KMREVSEA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  121  SMVLVKMREVSEAYIGKTVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  180

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGL+KKG E NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  IAYGLEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKA  220

>CCI40249
Length=660

 Score = 421 bits (1082),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/246 (85%), Positives = 231/246 (94%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGNDQSEKLQDLLLLDV PLS GLETAGGVMTVLIPRNTT+PTKK+
Sbjct  366  EAVAFGATVQAAILSGNDQSEKLQDLLLLDVAPLSLGLETAGGVMTVLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST+ DNQ  V IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+V +DIDANGI
Sbjct  426  QLFSTFQDNQCSVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVCYDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV+EAEKYK +DEANK+RIEAKNGLENY
Sbjct  486  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVSEAEKYKQQDEANKVRIEAKNGLENY  545

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRN+LNDEKL+SQ+ EDDRK +DDK++E ++WLDA+Q++EKEE+E  QK+LE IANP
Sbjct  546  AYNLRNSLNDEKLKSQLSEDDRKVLDDKISETMSWLDANQSAEKEEYEKLQKDLEAIANP  605

Query  424  ILQKMY  429
            ILQKMY
Sbjct  606  ILQKMY  611

 Score = 317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 171/220 (78%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            +T  ++GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  1    MTDKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  60

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     I VTFKGE K FQPEEIS
Sbjct  61   NAANTVFDAKRLIGRTFSDPIVQADMKHWPFTVQNGPGNKPLIEVTFKGEKKIFQPEEIS  120

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KMREVSEA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  121  SMVLVKMREVSEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  180

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGL+KKG E NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  IAYGLEKKGQECNVLIFDLGGGTFDVSLLTIEDGIFEVKA  220

>CCI43221
Length=660

 Score = 410 bits (1053),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 230/246 (93%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG +QSEKLQDLLLLDV PLS GLETAGGVMT LIPRNTT+PTKK+
Sbjct  369  EAVAFGATVQAAILSGTEQSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+VTFDIDANGI
Sbjct  429  QMFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSA+EKST KENKITITNDKGRLSQADI+RMV+EAEKYK EDEAN+IRIEAKNGLENY
Sbjct  489  LNVSAIEKSTNKENKITITNDKGRLSQADIDRMVSEAEKYKKEDEANRIRIEAKNGLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A+NLR+TL+DEK+++QI  +DR  +++KV E+++WLDA+Q++EKEEFE KQK+LE +ANP
Sbjct  549  AFNLRSTLDDEKIKNQISPEDRTTVENKVKEVVSWLDANQSAEKEEFEHKQKDLEAVANP  608

Query  424  ILQKMY  429
            I+QKMY
Sbjct  609  IMQKMY  614

 Score = 331 bits (849),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 180/224 (80%), Gaps = 38/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQ-VSGPSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  59

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV +KGE+K+F+P
Sbjct  60   QVAMNATNTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSSEGDKTMITVQYKGETKSFRP  119

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EAF+GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  120  EEISSMVLIKMREIAEAFLGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  179

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  180  TAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PYVX_22981
Length=612

 Score = 407 bits (1045),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 243/284 (86%), Gaps = 4/284 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+D S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KK+
Sbjct  333  EAVAFGATVQAAILSGHDSSAKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTVPAKKS  392

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDNNLLGKFNLD +PPMPRGVPQIDVTFDIDANGI
Sbjct  393  QTFSTYADNQPGVLIQVFEGERTMTRDNNLLGKFNLDALPPMPRGVPQIDVTFDIDANGI  452

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNV+AVEKSTGKENKITITNDKGRLSQADI+RMVAEAEKYK +DE  K R+++KN LENY
Sbjct  453  LNVTAVEKSTGKENKITITNDKGRLSQADIDRMVAEAEKYKQQDEVQKQRVDSKNSLENY  512

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY LRN+LND+K++ Q+ ++DRKA+DD+VT+ INWLD++Q +EK+EF+AKQKEL  +ANP
Sbjct  513  AYGLRNSLNDDKIKEQLSDNDRKAVDDQVTQTINWLDSNQMAEKDEFDAKQKELADVANP  572

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMY    A+ G   G          AP    ++GPKIEEVD
Sbjct  573  ILQKMY----ASAGGAPGKMPGADEMPTAPGGSDEKGPKIEEVD  612

 Score = 229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 124/168 (74%), Gaps = 37/168 (22%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            VTG SVGIDLGTTYSCVGVWQN+RVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  12   VTGQSVGIDLGTTYSCVGVWQNERVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  71

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     ITV F+GE KTFQPEEIS
Sbjct  72   NAANTVFDAKRLIGRKFNDPVVQQDIRHWPFKVSAGSDSKPQITVQFQGERKTFQPEEIS  131

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLN  135
            SMVL KMR+V+EAFIGK VKNAVITVPAYFNDSQRQATKDAG IAGLN
Sbjct  132  SMVLMKMRDVAEAFIGKPVKNAVITVPAYFNDSQRQATKDAGVIAGLN  179

>PYIW_16876
Length=643

 Score = 407 bits (1047),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 227/246 (92%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND+S +LQDLLLLDV PLS GLETAGGVMT LIPRNTTVPTKK+
Sbjct  370  EAVAFGATVQAAILSGNDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDN+ LGKF+LDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  430  QTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFSLDGIPPMPRGVPQIDVTFDIDANGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMV EAE+YK  DE NK+R+EAKN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVEEAERYKDADERNKLRVEAKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY LRN+L +EKLQ+++  DD+K ++DK+ E I WLDA+QA+EK+EF+AKQKELE +A+P
Sbjct  550  AYGLRNSLQEEKLQAKLAADDKKTLEDKIAETIAWLDANQAAEKDEFDAKQKELESVASP  609

Query  424  ILQKMY  429
            ILQKMY
Sbjct  610  ILQKMY  615

 Score = 335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 171/224 (76%), Positives = 177/224 (79%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQ+V G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQAVAGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMN  NT                                     I V FKGE+KTFQP
Sbjct  61   QVAMNPANTVFDAKRLIGRKFSDQVVQADLKHWPFKVVAGADNKPQIVVHFKGETKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREVSEAFIGK+VKNAVITVPAYFNDSQRQATKDAGAI+GLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVSEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAISGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  224

>PYU1_G013931
Length=663

 Score = 407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 202/246 (82%), Positives = 226/246 (92%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+D+S +LQDLLLLDV PLS GLETAGGVMT LIPRNTTVPTKK+
Sbjct  376  EAVAFGATVQAAILSGSDKSSRLQDLLLLDVAPLSMGLETAGGVMTTLIPRNTTVPTKKS  435

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  436  QTFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  495

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ +I+RMV +AE+YK +DE NK+R+EAKN LENY
Sbjct  496  LNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVTDAERYKDQDERNKLRVEAKNSLENY  555

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRN+L +EKL S++  DD+K +DDK+ E INWLDA+QA+EKEEF  KQKELE  ANP
Sbjct  556  AYSLRNSLQEEKLASKLSADDKKLLDDKIAETINWLDANQAAEKEEFADKQKELESFANP  615

Query  424  ILQKMY  429
            ILQ+MY
Sbjct  616  ILQRMY  621

 Score = 327 bits (837),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 174/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            VTG SVGIDLGTTYSCVGVWQ+DRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA+NQVAM
Sbjct  11   VTGQSVGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAARNQVAM  70

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     I V FKGESKTFQPEEIS
Sbjct  71   NAHNTVFDAKRLIGRKFTDPVVQADTKHWPFKVVAGAESKPQIVVQFKGESKTFQPEEIS  130

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVLTKM+E++EA+IGK VKNAVITVPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAA
Sbjct  131  SMVLTKMKEIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAA  190

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  191  IAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  230

>PYAP_19235
Length=643

 Score = 401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 238/284 (84%), Gaps = 9/284 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGA VQAAILSG+D+S KLQDLLLLDVTPLS GLETAGGVMT LIPRNT VPTKK+
Sbjct  369  EAVAFGAAVQAAILSGDDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIPRNTAVPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGERSMT+DNNLLGKF+LDGIPPMPRG P+I+VTFDIDANGI
Sbjct  429  QTFSTYADNQPGVLIQVFEGERSMTKDNNLLGKFSLDGIPPMPRGKPEIEVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGK+NKITITNDKGRLSQ++I+RMV EAEKY  ED  NK R++AKN LENY
Sbjct  489  LNVSAVEKSTGKDNKITITNDKGRLSQSEIDRMVKEAEKYAKEDADNKARVDAKNTLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRN+L+D  ++ Q+ EDDRK IDD V+E I WLDAHQ SEK+E+E KQKELEGIANP
Sbjct  549  AYNLRNSLDDAPVKQQMNEDDRKKIDDAVSETIKWLDAHQMSEKQEYEMKQKELEGIANP  608

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQKMYA+  AA         +  + G         GPKIEEVD
Sbjct  609  ILQKMYANGAAAANAGEAPSASTESTG---------GPKIEEVD  643

 Score = 331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 176/221 (80%), Gaps = 37/221 (17%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  63
            +V+GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA
Sbjct  3    AVSGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  62

Query  64   MNAENT-------------------------------------ITVTFKGESKTFQPEEI  86
            MNA NT                                     ITV FKGE K FQPEEI
Sbjct  63   MNAHNTVFDAKRLIGRKFTDPVVQADMKHWPFKVVTGAGDKPQITVEFKGEKKVFQPEEI  122

Query  87   SSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            SSMVLTKM+E++EA++G DVKNAVITVPAYFNDSQRQAT+DAG IAGLNV+RIINEPTAA
Sbjct  123  SSMVLTKMKEIAEAYLGTDVKNAVITVPAYFNDSQRQATRDAGTIAGLNVMRIINEPTAA  182

Query  147  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  183  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  223

>SDRG_05778
Length=618

 Score = 399 bits (1024),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 221/450 (49%), Positives = 283/450 (63%), Gaps = 69/450 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  193  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAASNATNT  252

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V+FKGE K F PEEISSMVLT
Sbjct  253  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEISSMVLT  312

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  313  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  372

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqd  208
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D    +  
Sbjct  373  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGEDFDSNM--  427

Query  209  lllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMT  268
                          T G VM+VLI RNT +P KKT+ ++T  D Q  V + ++EGER+  
Sbjct  428  --------------TVGRVMSVLIKRNTAIPIKKTRVYTTEEDYQTQVDVCIYEGERACV  473

Query  269  RDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRL  328
              NN LG+F + GI    RG PQ+ VTF+IDANGILNVSA++K T  + + TI N+ GRL
Sbjct  474  DHNNKLGEFTISGIERAKRGEPQVQVTFEIDANGILNVSALDKKTNAKAETTINNNNGRL  533

Query  329  SQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAI  388
            +Q DI+RMVA+AEK+K +D     +IEA+N LE++ Y     L  EK  +        A 
Sbjct  534  TQEDIDRMVADAEKFKKDDAEVLKKIEARNSLESFIYRALE-LTREKGDA--------AA  584

Query  389  DDKVTEIINWLDAHQASEKEEFEAKQKELE  418
            ++ + E   WL+ H+ +   E E K++ LE
Sbjct  585  ENTIREAREWLEDHEDATLRELEEKKRVLE  614

>SPRG_00068
Length=643

 Score = 399 bits (1025),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 203/246 (83%), Positives = 225/246 (91%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG++QS KLQDLLLLDV PLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  368  EAVAFGATVQAAILSGDNQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTVPTKKS  427

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQV+EGERSMT DNNLLGKF+LDGIPPMPRGVPQ+DVTFDIDANGI
Sbjct  428  QTFSTYADNQPGVLIQVYEGERSMTADNNLLGKFSLDGIPPMPRGVPQVDVTFDIDANGI  487

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLS+ DI+RMV EAEKYK++DEA+K+R+EAKN LENY
Sbjct  488  LNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKNALENY  547

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLNDEK+  +I  DD+K +DD VT+ INWLD +  +EKEEFE KQKELE +ANP
Sbjct  548  AYNLRNTLNDEKV--KIDADDKKRLDDMVTDTINWLDHNSHAEKEEFEGKQKELEAVANP  605

Query  424  ILQKMY  429
            I+QKMY
Sbjct  606  IMQKMY  611

 Score = 322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 173/221 (78%), Gaps = 37/221 (17%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  63
            + T  SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA
Sbjct  2    ATTTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVA  61

Query  64   MNAENT-------------------------------------ITVTFKGESKTFQPEEI  86
            MNA NT                                     ITV FKGESKTFQPEEI
Sbjct  62   MNAANTVFDAKRLIGRKFHDAVVQADIKHWPFKVTPGAADKPQITVEFKGESKTFQPEEI  121

Query  87   SSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            SSMVL KM+E+SEA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA
Sbjct  122  SSMVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  181

Query  147  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AIAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  182  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  222

>PITG_11252
Length=654

 Score = 398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 209/285 (73%), Positives = 246/285 (86%), Gaps = 1/285 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGN+ S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP+KKT
Sbjct  370  EAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPSKKT  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q+FSTYADNQ GVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QSFSTYADNQSGVLIQVFEGERTMTRDNHHLGKFNLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ+DI+RMVA+AEKYK +DE NK+R+E+KN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQSDIDRMVADAEKYKDQDERNKLRVESKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A++LRN+  +EK+ +++ E+D+K+I+DKV E ++WLDA+QA+EKEEF+AKQ+ELEG+ANP
Sbjct  550  AFSLRNSTREEKIAAKLSEEDKKSIEDKVAETLHWLDANQAAEKEEFDAKQQELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsagg-DQGPKIEEVD  467
            ILQK+YAS   AG    G  G          +   ++GPKIEEVD
Sbjct  610  ILQKIYASEAGAGMGGMGGAGPRPGGPSGAGSADGEEGPKIEEVD  654

 Score = 332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 175/224 (78%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M + VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MPEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGE KTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFNVIRGAESKPQVVVQFKGEKKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  224

>PHYSO_482793
Length=658

 Score = 398 bits (1023),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 216/289 (75%), Positives = 249/289 (86%), Gaps = 5/289 (2%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND S KLQDLLLLDV PLS GLETAGGVMT LIPRNTT+P+KKT
Sbjct  370  EAVAYGATVQAAILSGNDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTIPSKKT  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QSFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQADI+RMVA+AEKYK +DE NK+RIE+KN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQADIDRMVADAEKYKDQDERNKLRIESKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A++LR++  +EKL +++ EDD+K I+ KV + ++WLDA+QA+EKEEF+AKQ+ELE +ANP
Sbjct  550  AFSLRSSTREEKLAAKLSEDDKKTIEYKVADTLHWLDANQAAEKEEFDAKQQELESMANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsagg-----DQGPKIEEVD  467
            ILQK+YA+   AG   GG  GA  A   A   G      D+GPKIEEVD
Sbjct  610  ILQKVYAAEAGAGAGMGGMGGATAAGAGAGPHGPGGADGDEGPKIEEVD  658

 Score = 332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 176/224 (79%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M + VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTEPVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVARGPENKPQLVVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EA+IGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  224

>PYAP_17333
Length=657

 Score = 395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 224/246 (91%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+D+S KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  371  EAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  430

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDG+PPMPRGVPQIDVTFDIDANGI
Sbjct  431  QTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDGLPPMPRGVPQIDVTFDIDANGI  490

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ +I+RMV EAEKYK +DE NK+R+EAKN LENY
Sbjct  491  LNVSAVEKSTGKENKITITNDKGRLSQEEIDRMVQEAEKYKDQDERNKLRVEAKNALENY  550

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A++LR+ + DEKL  ++ +DD+K ID  V  +I WLD HQA+EKEE++AK KELEG+ANP
Sbjct  551  AFSLRSAVQDEKLVMKLDQDDKKTIDSAVNGVIEWLDQHQAAEKEEYDAKMKELEGVANP  610

Query  424  ILQKMY  429
            I+QK+Y
Sbjct  611  IMQKLY  616

 Score = 319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 171/220 (78%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIGDAAKNQVAM
Sbjct  6    VTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGTERLIGDAAKNQVAM  65

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     I V FKGESK F  EEIS
Sbjct  66   NAHNTVFDAKRLIGRKFRDPVVQADLKHWPFQVVAGPDDKPQIIVEFKGESKRFYAEEIS  125

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVLTKMR+++EA+IGK VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  126  SMVLTKMRDIAEAYIGKQVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  186  IAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  225

>SDRG_11473
Length=636

 Score = 393 bits (1010),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/246 (81%), Positives = 225/246 (91%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+ QS KLQDLLLLDV PLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  367  EAVAFGATVQAAILSGDTQSAKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTVPTKKS  426

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQV+EGERSMT DN+LLGKF+LDGIPPMPRGVPQ+DVTFDIDANGI
Sbjct  427  QTFSTYADNQPGVLIQVYEGERSMTADNHLLGKFSLDGIPPMPRGVPQVDVTFDIDANGI  486

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLS+ DI+RMV EAEKYK++DEA+K+R+EAKN LENY
Sbjct  487  LNVSAVEKSTGKENKITITNDKGRLSKDDIDRMVQEAEKYKAQDEAHKVRVEAKNALENY  546

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRNTLNDEK+  +I  +D+K +DD V++ INWLD +  +EKEEFEAKQKELE +ANP
Sbjct  547  AYSLRNTLNDEKV--KIDVNDKKRLDDMVSDTINWLDHNTHAEKEEFEAKQKELEAVANP  604

Query  424  ILQKMY  429
            I+QKMY
Sbjct  605  IMQKMY  610

 Score = 323 bits (828),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 166/219 (76%), Positives = 172/219 (79%), Gaps = 37/219 (17%)

Query  6    TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65
            T  SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  3    TTYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62

Query  66   AENT-------------------------------------ITVTFKGESKTFQPEEISS  88
            A NT                                     ITV FKGESKTFQPEEISS
Sbjct  63   ATNTVFDAKRLIGRKFHDAVVQADIKHWPFKVTSGAADKPQITVQFKGESKTFQPEEISS  122

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            MVL KM+E+SEA++G  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  123  MVLIKMKEISEAYLGGPVANAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  182

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  183  AYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  221

>PHYRA_71655
Length=653

 Score = 386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 209/284 (74%), Positives = 243/284 (86%), Gaps = 0/284 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EA+A+GATVQAAILSG+D S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KK 
Sbjct  370  EAIAYGATVQAAILSGHDSSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPAKKA  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKI ITNDKGRLSQ++I RMV +AEKYK +DE NK+RIE+KN LENY
Sbjct  490  LNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESKNALENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A++LR++  DEK+ +++ ++D+K I+DKV E ++WLDA+QA+ KEEF+AKQ+ELEG+ NP
Sbjct  550  AFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQELEGVTNP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            I+QK+Y +A  A    GGA    GAP  A  AGGD GPKIEEVD
Sbjct  610  IMQKIYTAASGAASGMGGAGTGGGAPSGAGGAGGDDGPKIEEVD  653

 Score = 327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 174/224 (78%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M +SVTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EA+IGK VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  224

>PYIR_15859
Length=626

 Score = 385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 197/246 (80%), Positives = 217/246 (88%), Gaps = 7/246 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG D+S +LQDLLLLDV PLS GLETAGGVMT LIP          
Sbjct  354  EAVAFGATVQAAILSGADKSSRLQDLLLLDVAPLSLGLETAGGVMTTLIP-------XXX  406

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
             TFSTYADNQPGVLIQVFEGER+MTRDN+ LGKFNLDGIPPMPRGVPQIDVTFDIDANGI
Sbjct  407  XTFSTYADNQPGVLIQVFEGERTMTRDNHSLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  466

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ DI+RMVAEAEKYK  DE NK+R+EAKN LENY
Sbjct  467  LNVSAVEKSTGKENKITITNDKGRLSQEDIDRMVAEAEKYKDADERNKLRVEAKNALENY  526

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY LRN+L +EK+Q+++  DD+K +DDK+TE I WLDA+QA+EKEEF+AKQKELEG+ANP
Sbjct  527  AYGLRNSLQEEKIQAKLSADDKKRVDDKITETIAWLDANQAAEKEEFDAKQKELEGVANP  586

Query  424  ILQKMY  429
            ILQKMY
Sbjct  587  ILQKMY  592

 Score = 277 bits (708),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 154/220 (70%), Gaps = 57/220 (26%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            VTG +VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  9    VTGQTVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  68

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            NA NT                                     ITV FKGE+KTFQPEEIS
Sbjct  69   NAHNTVFDAKRLIGRKFSDPIVQADIKHWPFKVSPGAGDKPQITVEFKGETKTFQPEEIS  128

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+E+SEA+IGK VKNAVITVPAYFNDSQRQATKDAG IAGLN            
Sbjct  129  SMVLIKMKEISEAYIGKQVKNAVITVPAYFNDSQRQATKDAGVIAGLN------------  176

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
                    GGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  177  --------GGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  208

>HYAP_01537
Length=651

 Score = 385 bits (988),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 201/284 (71%), Positives = 238/284 (84%), Gaps = 2/284 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSG   S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KK+
Sbjct  370  EAVAYGATVQAAILSGGGASSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPAKKS  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q+FSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QSFSTYADNQPGVLIQVFEGERAMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQA+I+RMV +AE YK +DE NK+R+E+KNGLENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQAEIDRMVNDAETYKDQDERNKLRVESKNGLENY  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A+++R +++DEK+  ++  DD+K ++DKV EI+ WLDA+ ++EKEE +AKQKELEG+ANP
Sbjct  550  AFSVRTSVSDEKIAVKLSTDDKKIVEDKVAEILQWLDANHSAEKEEIDAKQKELEGVANP  609

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            I+QK+YA+   AG   G    +             +GPKIEEVD
Sbjct  610  IMQKIYAAEAGAGMGGGATGASGPGASFGAKDK--EGPKIEEVD  651

 Score = 328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 176/224 (79%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M +SVTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT+SERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTESERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGE+K FQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPEVQSDIKHWPFKVTRDSADKPQVEVQFKGETKRFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EA+IGK V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAYIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLLSIE+GIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLSIEDGIFEVKA  224

>H257_12958
Length=649

 Score = 382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 193/246 (78%), Positives = 223/246 (91%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG   S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  369  EAVAFGATVQAAILSGTSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  428

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER MT+DNNLLGKF+LDG+PPMPRG+PQ+DVTFDIDANGI
Sbjct  429  QTFSTYADNQPGVLIQVFEGERVMTKDNNLLGKFSLDGLPPMPRGMPQVDVTFDIDANGI  488

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLS+ +I+RMV +AEKYK+EDE N+ RIEAKNGLENY
Sbjct  489  LNVSAVEKSTGKENKITITNDKGRLSKDEIDRMVNDAEKYKAEDEKNRARIEAKNGLENY  548

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRNTLND+K++  +   D+K ++DKV + I W+D + A+EK+EFEAKQ+ELE +ANP
Sbjct  549  AYSLRNTLNDDKIKGAVDPADKKTLEDKVADTIAWMDRNLAAEKDEFEAKQQELESVANP  608

Query  424  ILQKMY  429
            I+QK+Y
Sbjct  609  IMQKLY  614

 Score = 312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 167/216 (77%), Gaps = 37/216 (17%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAEN  68
            SVGIDLGTTYSCVG WQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN  N
Sbjct  8    SVGIDLGTTYSCVGTWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPSN  67

Query  69   T-------------------------------------ITVTFKGESKTFQPEEISSMVL  91
            T                                     I V FKGE KTFQPEEISSMVL
Sbjct  68   TVFDAKRLIGRKFNDPMIQADIKHWPFKVIAGAGDKPQIVVEFKGERKTFQPEEISSMVL  127

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
             KM+EV+EA++G DV+NAVITVPAYFNDSQRQATKDAGAIAGL V+RIINEPTAAAIAYG
Sbjct  128  IKMKEVAEAYLGLDVQNAVITVPAYFNDSQRQATKDAGAIAGLTVMRIINEPTAAAIAYG  187

Query  152  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            LDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  188  LDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PHALS_09802
Length=651

 Score = 382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 224/246 (91%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSG++ S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KK 
Sbjct  370  EAVAYGATVQAAILSGSESSAKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPAKKM  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q+FSTY DNQ GVLIQVFEGER+MTRDN+LLGKF+LDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QSFSTYTDNQSGVLIQVFEGERTMTRDNHLLGKFSLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ++I+RMVA+A+KYK +DE NK+RIE+KN LEN+
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADADKYKDQDERNKLRIESKNSLENF  549

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A++LR+++NDEK+ ++I  +DRK ID KV E + WL+A+QA+EK EF+AKQ+ELEG+ANP
Sbjct  550  AFSLRSSINDEKVVAKISAEDRKLIDGKVAETLQWLEANQAAEKGEFDAKQQELEGVANP  609

Query  424  ILQKMY  429
            I+QKMY
Sbjct  610  IMQKMY  615

 Score = 332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 178/224 (79%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M++ +TG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MSEPITGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFADSEVQSDIKHWPFKVVCGPENKPQVVVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EAFIGK V+NAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREIAEAFIGKQVRNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE +VLIFDLGGGTFDVSLL+IEEGIFE +A
Sbjct  181  TAAAIAYGLDKKGGEHHVLIFDLGGGTFDVSLLTIEEGIFEVMA  224

>H310_09557
Length=644

 Score = 378 bits (970),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 236/284 (83%), Gaps = 7/284 (2%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+  S+KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  368  EAVAFGATVQAAILSGSSGSQKLQDLLLLDVTPLSLGLETAGGVMTTLISRNTTVPTKKS  427

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQV+EGER+MT DN+LLGKF+LDG+PPMPRGVPQ+DVTFDIDANGI
Sbjct  428  QTFSTYADNQPGVLIQVYEGERTMTHDNHLLGKFSLDGLPPMPRGVPQVDVTFDIDANGI  487

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLS+ +IERMV +AEKYK+ED  NK R+EAKNGLENY
Sbjct  488  LNVSAVEKSTGKENKITITNDKGRLSKDEIERMVNDAEKYKAEDTKNKERVEAKNGLENY  547

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AY+LRNTL +EK+Q  +   D+K ++DKV +II+W+D + A+EK+E+E KQ+ELE +ANP
Sbjct  548  AYSLRNTLQEEKIQGAMDAGDKKVLEDKVHDIISWMDRNLAAEKDEYEGKQQELESVANP  607

Query  424  ILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            ILQK++AS G            P   G         GPKIEEVD
Sbjct  608  ILQKVHASGGGGTPGGMPGSQGPSTSGA-------DGPKIEEVD  644

 Score = 318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/219 (75%), Positives = 171/219 (78%), Gaps = 37/219 (17%)

Query  6    TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65
            T  SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  4    TEQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  63

Query  66   AENT-------------------------------------ITVTFKGESKTFQPEEISS  88
              NT                                     I V FKGESKTFQPEEISS
Sbjct  64   PSNTVFDAKRLIGRKFNDPMIQADIKHWPFKVVAGPGDKPQIVVEFKGESKTFQPEEISS  123

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            MVL KM++V+EAFIG +V+NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI
Sbjct  124  MVLIKMKQVAEAFIGVEVQNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  183

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  AYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  222

>PHYCA_104444
Length=644

 Score = 377 bits (967),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 238/285 (84%), Gaps = 11/285 (4%)

Query  184  EAVAFGATVQAAILSGN-DQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVA+GATVQAAILSG+ + S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KK
Sbjct  370  EAVAYGATVQAAILSGSGNMSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPAKK  429

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            TQ+FSTY+DNQ GVLIQVFEGERS+T+DN+LLGKFNLDGIPPM RGVPQIDVTFD+D NG
Sbjct  430  TQSFSTYSDNQSGVLIQVFEGERSLTQDNHLLGKFNLDGIPPMQRGVPQIDVTFDVDVNG  489

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            ILNVSAVEKSTGKENKITITNDKGRLSQ++I+RMVA+AEKYK +DE NK+RIE+KN LEN
Sbjct  490  ILNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLRIESKNALEN  549

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            YA++LR+++ ++KL +++   D+K I+DKV E + WLDA+QA+EKEEF++KQ+ELEG+AN
Sbjct  550  YAFSLRSSMKEDKLATKLSAADKKTIEDKVAETLQWLDANQAAEKEEFDSKQQELEGVAN  609

Query  423  PILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            PI+QK+Y                  AP    S G D GPKIEEVD
Sbjct  610  PIMQKVY----------AAEVDKGTAPDGRGSGGDDNGPKIEEVD  644

 Score = 328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 175/224 (78%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M ++VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTEAVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGE +TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKLVRGPESKPLVEVQFKGEKRTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  224

>PYAR_19807
Length=1613

 Score = 397 bits (1019),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/246 (79%), Positives = 225/246 (91%), Gaps = 0/246 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG+D+S KLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  360  EAVAFGATVQAAILSGSDKSSKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  419

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTYADNQPGVLIQVFEGER+MTRDN+LLGKF+LD +PPMPRGVPQIDVTFDIDANGI
Sbjct  420  QTFSTYADNQPGVLIQVFEGERTMTRDNHLLGKFSLDALPPMPRGVPQIDVTFDIDANGI  479

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ +I+RMV+EAE YK +DE NK+R+EAKNGLENY
Sbjct  480  LNVSAVEKSTGKENKITITNDKGRLSQQEIDRMVSEAETYKDQDERNKLRVEAKNGLENY  539

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            A+ LRN+L D+K+ +++ ++D+K + D + E++ WLD HQA+EKEE++AKQKELE +A P
Sbjct  540  AFTLRNSLQDDKVTAKLGDEDKKTLGDAIAEVVAWLDGHQAAEKEEYDAKQKELENVATP  599

Query  424  ILQKMY  429
            ILQKMY
Sbjct  600  ILQKMY  605

 Score = 293 bits (750),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 161/223 (72%), Gaps = 49/223 (22%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  61
            A  VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ
Sbjct  4    ASVVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQ  63

Query  62   VAMNAENT-------------------------------------ITVTFKGESKTFQPE  84
            VAMNA NT                                     I V FKGE+K F  E
Sbjct  64   VAMNAHNTVFDAKRLIGRKFTDAVVQADIKHWPFRVMADSANKPQIVVQFKGETKKFYAE  123

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            EISSMVLTKMR+V+EAFIGK VKNA            RQATKDAGAIAGLNVLRIINEPT
Sbjct  124  EISSMVLTKMRDVAEAFIGKQVKNA------------RQATKDAGAIAGLNVLRIINEPT  171

Query  145  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AAAIAYGLD+KGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  172  AAAIAYGLDRKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  214

>PHYKE_7016
Length=650

 Score = 372 bits (956),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 186/247 (75%), Positives = 224/247 (91%), Gaps = 1/247 (0%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGATVQAAILSG  D S KLQDLLLLDV PLS GLETAGGVMT LI RNTTVP+KK
Sbjct  371  EAVAFGATVQAAILSGAGDTSSKLQDLLLLDVAPLSLGLETAGGVMTTLIARNTTVPSKK  430

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            +QTFSTY+DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPM RG+PQIDVTFDIDANG
Sbjct  431  SQTFSTYSDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMRRGIPQIDVTFDIDANG  490

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            ILNVSAVEKSTGKENKITITNDKGRLSQ +I+RMVAEA+K+K +D  NK+RIE+KN +EN
Sbjct  491  ILNVSAVEKSTGKENKITITNDKGRLSQDEIDRMVAEADKFKDQDARNKLRIESKNSVEN  550

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            YA++LR+++ +EKL  ++  +D++ I+DKV E+++WL+ +QA+EKEEF+AKQKELE +AN
Sbjct  551  YAFSLRSSIREEKLAVKLTAEDKQVIEDKVAEVLSWLEVNQAAEKEEFDAKQKELEDVAN  610

Query  423  PILQKMY  429
            PI++K++
Sbjct  611  PIMEKIF  617

 Score = 330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM
Sbjct  6    VTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAM  65

Query  65   NAENTI-------------------------------------TVTFKGESKTFQPEEIS  87
            NA NT+                                      V FKGESKTFQPEEIS
Sbjct  66   NAHNTVFDAKRLIGRKFSDLEVQSDIKHWPFKVVRGPDNKPQVVVQFKGESKTFQPEEIS  125

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KMREV+EAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  126  SMVLIKMREVAEAFIGKQVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  185

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKK GE NVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  186  IAYGLDKKRGEHNVLIFDLGGGTFDVSLLSIEEGIFEVKA  225

>CCI40247
Length=643

 Score = 362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 230/285 (81%), Gaps = 13/285 (5%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVA+GATVQAAILSG +DQSE+LQ+++LLDV PLS GLETAGGVMTVLI RNTTVPT+K
Sbjct  371  EAVAYGATVQAAILSGGSDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIARNTTVPTRK  430

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            +QTFSTYADNQ GVLIQV+EGERSMTRDN+LLGKFNL+GIPPMPRGVPQI+VTF++DANG
Sbjct  431  SQTFSTYADNQSGVLIQVYEGERSMTRDNHLLGKFNLEGIPPMPRGVPQIEVTFEVDANG  490

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            IL+V+AVEKSTGKENKITITNDKGRLS+ +I+RMV EA+ YK +DE NK+R+E+KN LE+
Sbjct  491  ILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKLRVESKNKLES  550

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            Y + +RNT+ D K+   + ++D+K ++ K+ + I+WLD H A+E++EFE+KQKE+E + N
Sbjct  551  YVFQVRNTIRDGKIAGNLSDEDKKQMESKIEDTISWLDQHSAAERDEFESKQKEIESMVN  610

Query  423  PILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            P+LQK Y               A         +  + GPKIEEVD
Sbjct  611  PLLQKAY------------GAAASATGESTAPSSKEGGPKIEEVD  643

 Score = 306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 170/222 (77%), Gaps = 37/222 (17%)

Query  3    QSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQV  62
            ++V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIG+AAKNQV
Sbjct  4    KAVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQV  63

Query  63   AMNAENT-------------------------------------ITVTFKGESKTFQPEE  85
            AMNAENT                                     I V  KG  K F  EE
Sbjct  64   AMNAENTVFDAKRLIGRKFHDQAVQQDTKHWPFRVVCGPEDKPQIVVEVKGAKKMFYAEE  123

Query  86   ISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  145
            IS+MVL+KMRE++EA++G+ VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTA
Sbjct  124  ISAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTA  183

Query  146  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FE  A
Sbjct  184  AAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRA  225

>CCA16151
Length=643

 Score = 359 bits (922),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 236/285 (83%), Gaps = 13/285 (5%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVA+GATVQAAILSG +DQSE+LQ+++LLDV PLS GLETAGGVMTVLIPRNTTVPT+K
Sbjct  371  EAVAYGATVQAAILSGASDQSERLQNVVLLDVAPLSMGLETAGGVMTVLIPRNTTVPTRK  430

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            +QTFSTYADNQPGVLIQV+EGER+MTRDN+LLGKFNL+ IPPMPRGVPQI+VTF++DANG
Sbjct  431  SQTFSTYADNQPGVLIQVYEGERTMTRDNHLLGKFNLEEIPPMPRGVPQIEVTFEVDANG  490

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            IL+V+AVEKSTGKENKITITNDKGRLS+ +I+RMV EA+ YK +DE NK+R+E KN LE+
Sbjct  491  ILSVTAVEKSTGKENKITITNDKGRLSKEEIDRMVQEADLYKDQDERNKLRVECKNKLES  550

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            Y +++RNT+ D+K+  ++ ++++K ++ K+ E I+WLD + A+E++EFE+KQK++E + N
Sbjct  551  YVFHVRNTIRDDKIADKLSDEEKKQVESKIEETISWLDQNTAAERDEFESKQKDVEDMVN  610

Query  423  PILQKMYasagaaggmpggapgapgapgpapsaggDQGPKIEEVD  467
            P+LQK Y               A  A   A  +G + GPKIEEVD
Sbjct  611  PLLQKAY------------GAAASTAGESADPSGKEAGPKIEEVD  643

 Score = 302 bits (774),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 168/221 (76%), Gaps = 37/221 (17%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  63
            +V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT +ERLIG+AAKNQVA
Sbjct  5    TVSGLSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTGNERLIGEAAKNQVA  64

Query  64   MNAENT-------------------------------------ITVTFKGESKTFQPEEI  86
            MNAENT                                     I V   G  K F  EEI
Sbjct  65   MNAENTVFDAKRLIGRKFHDQTVQQDTKHWPFSVVCGPEDKPQIVVEVNGAKKMFYAEEI  124

Query  87   SSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            S+MVL+KMRE++EA++G+ VKNAV+TVPAYFNDSQRQATKDAG IAG+NVLRI+NEPTAA
Sbjct  125  SAMVLSKMREIAEAYLGRQVKNAVVTVPAYFNDSQRQATKDAGVIAGINVLRILNEPTAA  184

Query  147  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEG+FE  A
Sbjct  185  AIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGVFEVRA  225

>H257_17322
Length=606

 Score = 344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 186/237 (78%), Positives = 203/237 (86%), Gaps = 15/237 (6%)

Query  193  QAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADN  252
            QAAILSGND SEKLQDLLLLDVTPL   LETAGGVM  LI RNTTVPTKK+QTFST A+N
Sbjct  350  QAAILSGNDSSEKLQDLLLLDVTPLLLTLETAGGVMATLIQRNTTVPTKKSQTFSTCANN  409

Query  253  QPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKS  312
            Q GVLIQVF                 LDGIPPMPRGVP +DVTFDIDANGILNVSA+EKS
Sbjct  410  QSGVLIQVFRW---------------LDGIPPMPRGVPHVDVTFDIDANGILNVSAIEKS  454

Query  313  TGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLN  372
            TGKENKITITNDKGRLS+ DIERMV EAEKYKSEDEANK+RIEAKNGLENYAYNLRNTLN
Sbjct  455  TGKENKITITNDKGRLSKDDIERMVQEAEKYKSEDEANKLRIEAKNGLENYAYNLRNTLN  514

Query  373  DEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANPILQKMY  429
            DEKLQ ++ E D+K +DDKVTE INWLDA+Q++EKEE+EAKQKELEG+ANPI+QK+Y
Sbjct  515  DEKLQGKLDEADKKVVDDKVTETINWLDANQSAEKEEYEAKQKELEGVANPIMQKLY  571

 Score = 328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            V GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            N  NT                                     ITV FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDSVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+EVSEAFIG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAFIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PHALS_01338
Length=383

 Score = 336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 179/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M Q+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMN+ NT                                     ITV FKGE+KTFQP
Sbjct  61   QVAMNSSNTVFDAKRLIGRKYSDPVVKADIKHWPFKVTAGPGDKPQITVQFKGETKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EA+IGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAYIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

>PHYKE_6984
Length=450

 Score = 337 bits (865),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 180/226 (80%), Gaps = 39/226 (17%)

Query  1    MAQSVT--GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAA  58
            MAQ+ T  G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAA
Sbjct  1    MAQTTTSTGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAA  60

Query  59   KNQVAMNAENT-------------------------------------ITVTFKGESKTF  81
            KNQVAMNA NT                                     ITV FKGESKTF
Sbjct  61   KNQVAMNAHNTVFDAKRLIGRKFSDPIVQSDIKHWPFKLSSGAGDKPQITVQFKGESKTF  120

Query  82   QPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  141
            QPEEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAG+NVLRIIN
Sbjct  121  QPEEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGMNVLRIIN  180

Query  142  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  226

 Score = 130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/79 (94%), Positives = 75/79 (95%), Gaps = 0/79 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  372  EAVAFGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  431

Query  244  QTFSTYADNQPGVLIQVFE  262
            QTFSTYADNQPGVLIQVFE
Sbjct  432  QTFSTYADNQPGVLIQVFE  450

>CCA14967
Length=1431

 Score = 359 bits (922),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 207/231 (90%), Gaps = 6/231 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSG ++SEKLQDLLLLDV PLS GLETAGGVMT LIPRNTT+PTKK+
Sbjct  381  EAVAFGATVQAAILSGTEKSEKLQDLLLLDVAPLSLGLETAGGVMTTLIPRNTTLPTKKS  440

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY +NQPGV IQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQI+VTFDIDANGI
Sbjct  441  QTFSTYQENQPGVCIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIEVTFDIDANGI  500

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKST KENKITITNDKGRLSQADI+ MV+EAEKYK EDEAN+IR+EAKNGLENY
Sbjct  501  LNVSAVEKSTNKENKITITNDKGRLSQADIDLMVSEAEKYKKEDEANRIRVEAKNGLENY  560

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWL------DAHQASEKE  408
             +NLR+TL+DEK+++QI  +DR  I++KV E+++WL      D +Q S+ E
Sbjct  561  TFNLRSTLDDEKIKNQISPEDRTTIENKVKEVVSWLLQCREEDTNQMSKDE  611

 Score = 317 bits (812),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 173/224 (77%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M  S+      IDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  12   MTNSLEKKLPSIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  71

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV +KGE+K+F+P
Sbjct  72   QVAMNAINTVFDAKRLIGRRCSDPVVQADIKHWPFKVTSCEGDKPMITVQYKGETKSFRP  131

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE+++A++G DVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  132  EEISSMVLIKMREIAQAYLGNDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  191

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLD+KGGERN+LIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  192  TAAAIAYGLDRKGGERNILIFDLGGGTFDVSLLTIEEGIFEVKA  235

>PHYKE_2977
Length=220

 Score = 326 bits (836),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 165/170 (97%), Gaps = 0/170 (0%)

Query  260  VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  319
            VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI
Sbjct  1    VFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKI  60

Query  320  TITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQ  379
            TITNDKGRLSQADI+RMVAEAEKYKSEDEANKIRIEAKN LENYAYNLRNTLNDEKL+ Q
Sbjct  61   TITNDKGRLSQADIDRMVAEAEKYKSEDEANKIRIEAKNALENYAYNLRNTLNDEKLKDQ  120

Query  380  IPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANPILQKMY  429
            I EDD+KAIDDKVTE INWLDA+Q++EKEEFE KQKELEG+ANPILQKMY
Sbjct  121  ITEDDKKAIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  170

>PHALS_04330
Length=785

 Score = 343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 180/224 (80%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MAQSV+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MAQSVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     I V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDAKRLIGRKFSDPLVQADIKHWPFKVTSGAGDKPQIVVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEVKA  224

 Score = 123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/76 (92%), Positives = 72/76 (95%), Gaps = 0/76 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGND SEKLQDLLLLDVTPLS GLETAGGVMT LI RNTTVPTKK+
Sbjct  370  EAVAYGATVQAAILSGNDSSEKLQDLLLLDVTPLSLGLETAGGVMTTLIARNTTVPTKKS  429

Query  244  QTFSTYADNQPGVLIQ  259
            QTFSTYADNQPGVLIQ
Sbjct  430  QTFSTYADNQPGVLIQ  445

>PPTG_19690
Length=566

 Score = 334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 176/224 (79%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M + VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEEGIFEVKA  224

 Score = 322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 0/194 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GATVQAAILSGN+ S KLQDLLLLDV PLS GLETAGGVMT LIPRNTTVP KKT
Sbjct  370  EAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNTTVPAKKT  429

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQPGVLIQVFEGER+MTRDN+LLGKFNLDGIPPMPRGVPQIDVTFD+D NGI
Sbjct  430  QTFSTYTDNQPGVLIQVFEGERTMTRDNHLLGKFNLDGIPPMPRGVPQIDVTFDVDVNGI  489

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSAVEKSTGKENKITITNDKGRLSQ++I+RMVA+AEKYK +DE NK+RIE+KN LENY
Sbjct  490  LNVSAVEKSTGKENKITITNDKGRLSQSEIDRMVADAEKYKDQDERNKLRIESKNALENY  549

Query  364  AYNLRNTLNDEKLQ  377
            A++LRN+  +EK Q
Sbjct  550  AFSLRNSTREEKGQ  563

>H310_02604
Length=312

 Score = 325 bits (833),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 169/220 (77%), Positives = 173/220 (79%), Gaps = 37/220 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  64
            V GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM
Sbjct  4    VQGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAM  63

Query  65   NAENT-------------------------------------ITVTFKGESKTFQPEEIS  87
            N  NT                                     ITV FKGE+KTFQPEEIS
Sbjct  64   NPTNTVFDAKRLIGRKFNDPVIQADIKHWPFKVTPGAGDKPQITVEFKGETKTFQPEEIS  123

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVL KM+EVSEA+IG  V NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
Sbjct  124  SMVLIKMKEVSEAYIGSTVNNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  183

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYGLDKKGGERNVLIFDLGGGTFDVSLL+IEEGIFE  A
Sbjct  184  IAYGLDKKGGERNVLIFDLGGGTFDVSLLTIEEGIFEVKA  223

>PPTG_02121
Length=222

 Score = 317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 168/211 (80%), Gaps = 37/211 (18%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M Q+ +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
Sbjct  1    MTQATSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60

Query  61   QVAMNAENT-------------------------------------ITVTFKGESKTFQP  83
            QVAMNA NT                                     ITV FKGESKTFQP
Sbjct  61   QVAMNAANTVFDAKRLIGRKFSDPIVQADIKHWPFKITSGPGDKPQITVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK+VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKEVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  174
            TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS
Sbjct  181  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVS  211

>PHYRA_41888
Length=586

 Score = 327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 174/224 (78%), Gaps = 37/224 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M +SVTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTESVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGE  TFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIRHWPFKVARGPENKPEVVVQFKGEQVTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMRE++EA+IGK VKNAV+TVPAYFNDSQRQATKDAG IAGLNVLRIINEP
Sbjct  121  EEISSMVLVKMREIAEAYIGKQVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  224

 Score = 308 bits (789),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 172/192 (90%), Gaps = 0/192 (0%)

Query  238  VPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFD  297
            VP KK Q+FSTYADNQ GVLIQVFEGERSMT DN+LLGKFNLDGIPPMPRGVPQIDVTFD
Sbjct  364  VPAKKAQSFSTYADNQSGVLIQVFEGERSMTCDNHLLGKFNLDGIPPMPRGVPQIDVTFD  423

Query  298  IDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAK  357
            +D NGILNVSAVEKSTGKENKI ITNDKGRLSQ++I RMV +AEKYK +DE NK+RIE+K
Sbjct  424  VDVNGILNVSAVEKSTGKENKIIITNDKGRLSQSEINRMVDDAEKYKDQDERNKLRIESK  483

Query  358  NGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKEL  417
            N LENYA++LR++  DEK+ +++ ++D+K I+DKV E ++WLDA+QA+ KEEF+AKQ+EL
Sbjct  484  NALENYAFSLRSSTRDEKVAAKLSDEDKKTIEDKVVETLHWLDANQAAGKEEFDAKQQEL  543

Query  418  EGIANPILQKMY  429
            EG+ NPI+QK+Y
Sbjct  544  EGVTNPIMQKIY  555

>PPTG_16727
Length=217

 Score = 305 bits (782),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 161/207 (78%), Gaps = 37/207 (18%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            M + VTG SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1    MTEKVTGQSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            QVAMNA NT+                                      V FKGESKTFQP
Sbjct  61   QVAMNAHNTVFDVKRLIGRKFTDPEVQSDIKHWPFKVVRGAENKPQLVVQFKGESKTFQP  120

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EEISSMVL KMREV+EAFIGK VKNAV+TVPAYFNDSQRQATKDAGAIAGLNVLRIINEP
Sbjct  121  EEISSMVLIKMREVAEAFIGKHVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGT  170
            TAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  181  TAAAIAYGLDKKGGEHNVLIFDLGGGT  207

>PHALS_12790
Length=214

 Score = 288 bits (737),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)

Query  267  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  326
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  327  RLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRK  386
            RLSQADI+RMV+EAEKYKSEDEANK+RIEAKNGLENYAYNLRNTLNDEKL+ Q+ +DD+K
Sbjct  61   RLSQADIDRMVSEAEKYKSEDEANKVRIEAKNGLENYAYNLRNTLNDEKLKGQLSDDDKK  120

Query  387  AIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANPILQKMY  429
            AIDDKVTE INWLDA+Q++EKEEFE KQKELEG+ANPILQKMY
Sbjct  121  AIDDKVTETINWLDANQSAEKEEFEGKQKELEGVANPILQKMY  163

>PYIR_16737
Length=511

 Score = 294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 193/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  246  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  304

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  305  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  364

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK  KITIT +KGRLSQ +I+RMV EA +   ED+  K RI+ +NGLE Y
Sbjct  365  LQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRNGLEGY  424

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+NT++D KL  +I EDD+ ++   V + ++WL+ +Q ++KE+FEAKQKE+E I NP
Sbjct  425  LYSLKNTVDD-KLADKIEEDDKDSVLKAVQDAMDWLEDNQEADKEDFEAKQKEVEKIVNP  483

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  484  IMAKVY  489

 Score = 155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 91/100 (91%), Gaps = 1/100 (1%)

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            M+LTKM++V+E +IG++V +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAI
Sbjct  1    MILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAI  60

Query  149  AYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  61   AYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  100

>PYAP_13341
Length=657

 Score = 292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 192/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLS G+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILGG-EQDDVTKDILLIDVVPLSLGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+V+F++DANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERTMTKDNRLLGKFELTGLPPAPRGVPQIEVSFELDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK  KITIT +KGRLSQ +IERMV EAE++  ED+  K RI+ +NGLE Y
Sbjct  512  LQVGAEDKGTGKAEKITITAEKGRLSQEEIERMVKEAEEFADEDKKVKDRIDGRNGLEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + D KL  +I EDD++ +   V + ++WL+ +Q S+KE+FEAKQKE+E + NP
Sbjct  572  LYSLKNNVED-KLADKIDEDDKETVLKAVQDAMDWLEDNQDSDKEDFEAKQKEVEKVVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMAKVY  636

 Score = 253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 161/222 (73%), Gaps = 38/222 (17%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQV  62
            S  G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ 
Sbjct  26   SPRGPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQA  85

Query  63   AMNAENT------------------------------------ITVTFKGESKTFQPEEI  86
             +N E T                                    I VT KGE+K F PEE+
Sbjct  86   TINPEKTLFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDGKPFIQVTIKGENKLFAPEEV  145

Query  87   SSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            S+MVLTKM++++EA+IG++V +AV+TVPAYFND+QRQATKDAG I+G+ V RIINEPTAA
Sbjct  146  SAMVLTKMKQIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTISGMTVQRIINEPTAA  205

Query  147  AIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  206  AIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>H257_16775
Length=291

 Score = 280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 177/246 (72%), Gaps = 47/246 (19%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGATVQAAILSGND S++LQDLL L VTPLS GL                   K+ 
Sbjct  58   EAVAFGATVQAAILSGNDSSDRLQDLLFLHVTPLSLGL-------------------KQP  98

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
             TFST  DNQPG LIQVFEGERSMTRDNNLLGKF+ DGIPPM RGVPQ+DVTFDIDANGI
Sbjct  99   ATFST--DNQPGALIQVFEGERSMTRDNNLLGKFSFDGIPPMHRGVPQVDVTFDIDANGI  156

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVS +EKSTGKE  ITITN KGRLS+ DI                    IE  NGLENY
Sbjct  157  LNVSTIEKSTGKE--ITITNAKGRLSKDDI--------------------IERMNGLENY  194

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            AYNLRNTLN EKLQ ++ E D+K ++DKVTE I WLDA     KEE+EAKQKELEG+ANP
Sbjct  195  AYNLRNTLNVEKLQGKLDEADKKVMEDKVTETIKWLDA----TKEEYEAKQKELEGVANP  250

Query  424  ILQKMY  429
            I+QK+Y
Sbjct  251  IMQKLY  256

>PYIW_21755
Length=658

 Score = 290 bits (742),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 190/246 (77%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q E  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILGG-EQDELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK  KITIT +KGRLSQ +I+RMV EA +   ED+  K RI+ +NGLE Y
Sbjct  512  LQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRNGLEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N++ D KL  +I EDD+  +   V + ++WL+ +Q ++KE+FEAKQKE+E   NP
Sbjct  572  LYSLKNSVED-KLADKIEEDDKDTVLKSVQDAMDWLEDNQEADKEDFEAKQKEVEKAVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMAKVY  636

 Score = 253 bits (645),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V+ KGE KTF PEE+S+M
Sbjct  89   PEQTLFDVKRLIGRGYNDKSVQADKKLLPYNIINKDGKPLIEVSVKGEKKTFSPEEVSAM  148

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +LTKM++V+E +IG++V +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAIA
Sbjct  149  ILTKMKQVAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAIA  208

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  209  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>PYU1_G004098
Length=656

 Score = 288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 190/246 (77%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +  +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGG-ETDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK  KITIT +KGRLSQ +I+RMV EA +   ED+  K RI+ +NGLE Y
Sbjct  511  LQVGAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAAENAEEDKKVKDRIDGRNGLEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+NT+ D K+  +I EDD+ A+   V + ++WL+ +Q ++KE+FE KQKE+E + NP
Sbjct  571  LYSLKNTVED-KMADKIEEDDKDAVLKAVQDAMDWLEDNQEADKEDFEGKQKEVEKVVNP  629

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  630  IMAKVY  635

 Score = 251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 158/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I VT KGE K F PEE+S+M
Sbjct  88   PEKTLFDVKRLIGRGYNDKSVQADKKLLPYEIVNKDGKPVIQVTVKGEKKHFSPEEVSAM  147

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +LTKM++ +E +IG++V +AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAIA
Sbjct  148  ILTKMKQTAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIA  207

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  208  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>PHALS_00833
Length=652

 Score = 286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 193/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  511  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ ++ +DD+  + + V + ++WL+ +Q ++KE++EAKQKE+E + NP
Sbjct  571  LYSLKNNV-EEKLEDKLNDDDKDTVLNAVQDAMDWLEDNQEADKEDYEAKQKEVEKLVNP  629

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  630  IMSKVY  635

 Score = 248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 156/219 (71%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEII NDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIPNDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDGKPFIQVVIKGEKRQFAPEEVSAM  147

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VL+KM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  148  VLSKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  207

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  208  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>PYAR_18354
Length=1084

 Score = 294 bits (752),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 193/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVAFGA VQ  IL G +Q +  +D+LL+DV PLS G+ET GGVMT LI RNT +PTKK+
Sbjct  394  EAVAFGAAVQGGILGG-EQDDTNKDILLIDVAPLSLGIETVGGVMTKLINRNTVIPTKKS  452

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGERSMT+DN +LGKF L G+PP PRGVPQI+V+F++DANGI
Sbjct  453  QTFSTYQDNQPAVLIQVFEGERSMTKDNRMLGKFELTGLPPAPRGVPQIEVSFELDANGI  512

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK  KITIT DKGRLSQ ++ERMV EAE++  ED+  K RI+ +N LE Y
Sbjct  513  LQVGAEDKGTGKAEKITITADKGRLSQEEVERMVKEAEEFADEDKKIKDRIDGRNALEGY  572

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N++ D KL  +I EDD++++   V + ++WL+ +Q S+K++FEAKQKE+E I NP
Sbjct  573  LYSLKNSVED-KLADKIEEDDKESVLKAVQDAMDWLEDNQESDKDDFEAKQKEVEKIVNP  631

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  632  IMSKVY  637

 Score = 254 bits (648),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 158/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I VT KGE K F PEEIS+M
Sbjct  90   PEKTLFDVKRLIGRPYNDKSVQADKKLLPFDIVNKDGKPFIQVTIKGEKKQFSPEEISAM  149

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VL+KM+ ++EA+IG++V +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPTAAAIA
Sbjct  150  VLSKMKTIAEAYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPTAAAIA  209

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LLSI+ G+FE +A
Sbjct  210  YGIDKKAQGEKNVLVFDLGGGTFDVTLLSIDAGVFEVLA  248

>PYVX_16738
Length=658

 Score = 285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 187/246 (76%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G D  E  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGGAD-DELTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L V A +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  511  LQVGAEDKGTGKAESITITAEKGRLSQEEIDRMVQEAAEFADEDKLVKERIDGRNALEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + D KL  +I EDD+  +   V + ++WL+ +Q + KE+F+AKQKE+E + NP
Sbjct  571  LYSLKNNVED-KLADKIDEDDKDTVLTAVQDAMDWLEDNQEANKEDFDAKQKEVEKVVNP  629

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  630  IMAKVY  635

 Score = 251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 160/224 (71%), Gaps = 38/224 (17%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  23   AKGPRGPVIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  82

Query  61   QVAMNAENT------------------------------------ITVTFKGESKTFQPE  84
            Q  +N E T                                    I VT KGE + F PE
Sbjct  83   QATINPEKTLFDVKRLIGRKYADKSVQADKKLLPYHIADKQGKPFIEVTVKGEKRQFAPE  142

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            E+S+MVLTKM++++E +IG++V +AV+TVPAYFND+QRQATKDAG IAG+ V RIINEPT
Sbjct  143  EVSAMVLTKMKQIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGMTVQRIINEPT  202

Query  145  AAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  203  AAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>H310_09434
Length=658

 Score = 283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 188/246 (76%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G + S  L ++LLLDV PLS G+ET GGVMT +I RNT VPTKK+
Sbjct  393  EAVAYGAAVQGGILGGENDS-NLNEILLLDVAPLSLGIETVGGVMTKIINRNTVVPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP V IQVFEGER+MT+DN++LGKF L GIPP PRGVPQI+VTF++DANGI
Sbjct  452  QTFSTYQDNQPAVSIQVFEGERAMTKDNHILGKFELTGIPPAPRGVPQIEVTFEVDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK  KITIT +KGRLSQ +I+RMV EAE+   ED+  K RI+ +N LE Y
Sbjct  512  LQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGRNSLEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             YNL+N + D KL  +I E D+  +   V E ++WLD +Q ++KE+F+A+QK +E IANP
Sbjct  572  LYNLKNNVED-KLADKIEEADKDTLLKAVQEAMDWLDENQEADKEDFDAQQKAIEKIANP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMAKVY  636

 Score = 254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/225 (58%), Positives = 159/225 (71%), Gaps = 38/225 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAK  59
            MAQ   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   MAQEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAENT------------------------------------ITVTFKGESKTFQP  83
            NQ  +N ENT                                    I V  KGE+K F P
Sbjct  83   NQATINPENTLFDVKRLIGRSYNDKSVQADKKLLPFHIVNKDGRPFIEVKIKGEAKQFSP  142

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+S+M+LTKM+ ++E ++GK+V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEP
Sbjct  143  EEVSAMILTKMKTIAENYLGKEVHDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  202

Query  144  TAAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE ++
Sbjct  203  TAAAIAYGIDKKAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLS  247

>SPRG_00333
Length=615

 Score = 280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 145/247 (59%), Positives = 185/247 (75%), Gaps = 4/247 (2%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVA+GA VQ  IL+G ND   K   LL   V PLS G+ET GGVMT +I RNT VPTKK
Sbjct  351  EAVAYGAAVQGGILAGVNDDGTKDILLLD--VAPLSLGIETVGGVMTKIINRNTVVPTKK  408

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            +QTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQI+VTF++DANG
Sbjct  409  SQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFEVDANG  468

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            IL VSA +K TGK  KITIT +KGRLSQ +I+RMV EAE+   ED+  K RI+ +N LE 
Sbjct  469  ILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGRNSLEG  528

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            Y YNL+N + D KL  +I ++D+  +   V E ++WLD +Q ++KE+F+A+QK +E + N
Sbjct  529  YLYNLKNNVED-KLADKIDDEDKDTVLKAVQEAMDWLDENQEADKEDFDAQQKAVEKVVN  587

Query  423  PILQKMY  429
            PI+ K+Y
Sbjct  588  PIMSKVY  594

 Score = 249 bits (635),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 159/226 (70%), Gaps = 39/226 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAENT------------------------------------ITVTFKGESKTFQP  83
            NQ  +N ENT                                    I V  KGE+KTF  
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPFEIINKEGRPYIQVKVKGETKTFSA  142

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+S+M+LTKM+ ++E ++GK+V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEP
Sbjct  143  EEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  202

Query  144  TAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FE ++
Sbjct  203  TAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLS  248

>PYU1_G004097
Length=663

 Score = 280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 189/246 (77%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA +Q  IL G DQ EKLQDL+L+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  397  EAVAYGAAIQGGILGG-DQDEKLQDLVLIDVVPLSQGIETVGGVMTKLINRNTAIPTKKS  455

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST+ DNQ  V I+VFEGER++ + N LLGKF+L G+PP PRGVPQI+VTF+IDANGI
Sbjct  456  QVFSTHVDNQAAVSIKVFEGERTLVKHNRLLGKFDLAGLPPAPRGVPQIEVTFEIDANGI  515

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK  KITIT +KGRLSQ +IERMV +A ++  ED+  K RIE+KN LE Y
Sbjct  516  LQVSAQDKGTGKTEKITITAEKGRLSQEEIERMVQDAAEHAEEDKKVKERIESKNSLETY  575

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+ +NT+ D KL  +I EDD+  +   V + ++WLD ++ ++KE+FE KQK++E + NP
Sbjct  576  LYSAKNTVED-KLSDKIEEDDKGIVLQAVKDAMDWLDDNEDADKEDFEGKQKDVEKVVNP  634

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  635  IMAKVY  640

 Score = 253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 160/216 (74%), Gaps = 38/216 (18%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNAEN  68
            +GIDLGTTYSCVGV+++ +V+IIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N E 
Sbjct  36   IGIDLGTTYSCVGVFKDGKVDIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATINPEK  95

Query  69   TI------------------------------------TVTFKGESKTFQPEEISSMVLT  92
            TI                                     VT KG++K F PEEIS+MVL 
Sbjct  96   TIFDVKRLIGRSYNDKSVQADKKLLPYEIVNKDGKPVIQVTVKGQTKLFSPEEISAMVLG  155

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            KM++++EA++G+DV++AV+TVPAYFND+QRQATKDAG IAGL+V RIINEPTAAAIAYG+
Sbjct  156  KMKQIAEAYLGRDVRDAVVTVPAYFNDAQRQATKDAGTIAGLSVQRIINEPTAAAIAYGI  215

Query  153  DKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  216  DKKAQGEKNVLVFDLGGGTFDVTLLAIDNGVFEVLA  251

>PITG_00527
Length=656

 Score = 279 bits (714),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 193/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +NGLE Y
Sbjct  511  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKRVKDRIDGRNGLEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ +I EDD+  +   V + ++WL+ +Q ++KE+FEAKQKE+E + NP
Sbjct  571  LYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVEKLVNP  629

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  630  IMSKVY  635

 Score = 250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDGKPFIEVEVKGEKRQFAPEEVSAM  147

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  148  VLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  207

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  208  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>PHYSO_286376
Length=660

 Score = 279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 150/246 (61%), Positives = 193/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  ILSG +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILSG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  512  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ +I EDD+  +   V + ++WL+ +Q ++KE+FEAKQKE+E + NP
Sbjct  572  LYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVEKLVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMSKVY  636

 Score = 251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYELVNKDGKPFIQVEVKGEKRQFAPEEVSAM  148

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  149  VLTKMKQISEGYIGREVYDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  208

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  209  YGIDKKSQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>PHALS_00667
Length=142

 Score = 261 bits (666),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 136/142 (96%), Gaps = 0/142 (0%)

Query  267  MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  326
            MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG
Sbjct  1    MTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKG  60

Query  327  RLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRK  386
            RLSQA+I+RMVAEA+KYKSEDEANK+R+EAKN LENYAY+LRN+LN+EK++  IP+ D+K
Sbjct  61   RLSQAEIDRMVAEADKYKSEDEANKVRVEAKNALENYAYSLRNSLNEEKMKESIPKADKK  120

Query  387  AIDDKVTEIINWLDAHQASEKE  408
             +DDKVTE+I WLDAHQ+SEKE
Sbjct  121  VVDDKVTEVIQWLDAHQSSEKE  142

>PPTG_08245
Length=658

 Score = 277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 192/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  512  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ +I EDD+  +   V + ++WL+ +Q ++KE+FEAKQKE+E + NP
Sbjct  572  LYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVEKLVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMSKVY  636

 Score = 250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  89   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYNLVNKDGKPFIEVEVKGEKRQFAPEEVSAM  148

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  149  VLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  208

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  209  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>PHYCA_510696
Length=659

 Score = 277 bits (708),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/246 (61%), Positives = 192/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  511  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ +I EDD+  +   V + ++WL+ +Q ++KE+FEAKQKE+E + NP
Sbjct  571  LYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEAKQKEVEKLVNP  629

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  630  IMSKVY  635

 Score = 250 bits (639),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  88   PEKTLFDVKRLIGRKYNDKSVQADKKLLPYEIVNKEGKPFIEVEVKGEKRQFAPEEVSAM  147

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  148  VLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  207

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  208  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>PHYRA_71042
Length=654

 Score = 275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 191/246 (78%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  389  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  447

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  448  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  507

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  508  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  567

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + +EKL+ +I EDD+  +   V + ++WL+ +Q ++KE+FE KQKE+E + NP
Sbjct  568  LYSLKNNV-EEKLEDKIDEDDKDTVLTAVQDAMDWLEDNQEADKEDFEEKQKEVEKLVNP  626

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  627  IMSKVY  632

 Score = 251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 159/224 (71%), Gaps = 38/224 (17%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKN  60
            A+   G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKN
Sbjct  20   AEEARGPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKN  79

Query  61   QVAMNAENT------------------------------------ITVTFKGESKTFQPE  84
            Q  +N E T                                    I V  KGE + F PE
Sbjct  80   QATINPEKTLFDVKRLIGRKYNDKSVQSDKKLLPYEIINKDGKPFIQVEVKGEKREFAPE  139

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            E+S+MVLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPT
Sbjct  140  EVSAMVLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPT  199

Query  145  AAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  200  AAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  243

>CCI50234
Length=665

 Score = 275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 188/246 (76%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +DLLL+DV PLSQG+ET GGVMT +I RNT +PTKK+
Sbjct  399  EAVAYGAAVQGGILGG-EQDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTVIPTKKS  457

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+VTF++DANGI
Sbjct  458  QVFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFEVDANGI  517

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK  KITIT +KGRLS+ +I+RMV EAE++  ED+  K RI+ +N LE Y
Sbjct  518  LQVSAEDKGTGKAEKITITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGRNALEGY  577

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             YNL++ ++D KL  +I EDD++ + + V + ++WL+ +Q ++K +FEAKQKE+E I NP
Sbjct  578  LYNLKSQVDD-KLADKIEEDDKETVSNAVQDALDWLEDNQEADKPDFEAKQKEVEKIVNP  636

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  637  IMAKLY  642

 Score = 248 bits (634),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 153/221 (69%), Gaps = 38/221 (17%)

Query  5    VTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVA  63
            +TG  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF     RLIGDAAKNQ  
Sbjct  33   MTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDATGTRLIGDAAKNQAV  92

Query  64   MNAENTI------------------------------------TVTFKGESKTFQPEEIS  87
             N E TI                                     VT KGE K F PEEIS
Sbjct  93   HNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDGKPFIRVTVKGEQKVFAPEEIS  152

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            +MVL KM++++E  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPTAAA
Sbjct  153  AMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPTAAA  212

Query  148  IAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            IAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  213  IAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  253

>HYAP_01005
Length=660

 Score = 274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 189/246 (77%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  512  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRNSLEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             YNL+N + + KL  +I EDD+  +   V + ++WL+ +Q  +KE++EAKQKE+E + NP
Sbjct  572  LYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVEKVVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMSKVY  636

 Score = 249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE++ F PEE+S+M
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDGKPFIQVQVKGETRQFAPEEVSAM  148

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+ ++E +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  149  VLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  208

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  209  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>HYAP_01004
Length=660

 Score = 274 bits (701),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 189/246 (77%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  393  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  451

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  452  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  511

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  512  LQVSAEDKGTGKAETITITAEKGRLSQEEIDRMVQEASEFADEDKRVKDRIDGRNSLEGY  571

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             YNL+N + + KL  +I EDD+  +   V + ++WL+ +Q  +KE++EAKQKE+E + NP
Sbjct  572  LYNLKNNV-EGKLDDKIEEDDKDTVLTAVQDAMDWLEDNQEVDKEDYEAKQKEVEKVVNP  630

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  631  IMSKVY  636

 Score = 249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  29   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  88

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE++ F PEE+S+M
Sbjct  89   PEKTLFDVKRLIGRKYTDKSVQSDKKLLPYELVNKDGKPFIQVQVKGETRQFAPEEVSAM  148

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+ ++E +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  149  VLTKMKHIAEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  208

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  209  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  247

>CCA24936
Length=661

 Score = 273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 187/246 (76%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +DLLL+DV PLSQG+ET GGVMT +I RNT +PTKK 
Sbjct  395  EAVAYGAAVQGGILGG-EQDDLNKDLLLIDVIPLSQGIETVGGVMTKIINRNTVIPTKKA  453

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST +DNQ  V I V EGER+M +DN LLGKF L GIPP PRGVPQI+VTF++DANGI
Sbjct  454  QLFSTSSDNQNAVSISVLEGERAMAKDNRLLGKFELTGIPPAPRGVPQIEVTFEVDANGI  513

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK  K+TIT +KGRLS+ +I+RMV EAE++  ED+  K RI+ +N LE Y
Sbjct  514  LQVSAEDKGTGKAEKVTITAEKGRLSEEEIQRMVQEAEEFADEDKRIKERIDGRNALEGY  573

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             YNL++ + DEKL  +I EDD++ + + V + ++WL+ +Q ++K +FEAKQKE+E + NP
Sbjct  574  LYNLKSQV-DEKLAEKIEEDDKETVTNAVQDALDWLEDNQEADKADFEAKQKEVEKVVNP  632

Query  424  ILQKMY  429
            I+ K+Y
Sbjct  633  IMAKLY  638

 Score = 246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 154/224 (69%), Gaps = 38/224 (17%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKN  60
            A+ +TG  +GIDLGTTYSCVG ++N +VEII N+QGNR TPSYVAF     R+IGDAAKN
Sbjct  26   AKPMTGPVIGIDLGTTYSCVGYYKNKKVEIIPNEQGNRVTPSYVAFDVTGTRMIGDAAKN  85

Query  61   QVAMNAENTI------------------------------------TVTFKGESKTFQPE  84
            Q   N E TI                                     VT K E K F PE
Sbjct  86   QAIHNPEQTIFDVKRLIGRKFTDKSVQADKKLLPYEIINKDGKPFIRVTIKDEQKVFAPE  145

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            EIS+MVL KM++++E  IG  VK+AV+TVPAYFND+QRQATKDAG+IAGL V RIINEPT
Sbjct  146  EISAMVLQKMKDIAEKVIGTTVKDAVVTVPAYFNDAQRQATKDAGSIAGLTVQRIINEPT  205

Query  145  AAAIAYGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            AAAIAYG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  206  AAAIAYGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  249

>PHYKE_7992
Length=657

 Score = 269 bits (688),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 186/246 (76%), Gaps = 2/246 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q +  +D+LL+DV PLSQG+ET GGVMT LI RNT +PTKK+
Sbjct  392  EAVAYGAAVQGGILGG-EQDDLTKDVLLIDVVPLSQGIETVGGVMTKLINRNTVIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            QTFSTY DNQP VLIQVFEGER+MT+DN LLGKF L G+PP PRGVPQI+VTF+IDANGI
Sbjct  451  QTFSTYQDNQPAVLIQVFEGERAMTKDNRLLGKFELTGLPPAPRGVPQIEVTFEIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L VSA +K TGK   ITIT +KGRLSQ +I+RMV EA ++  ED+  K RI+ +N LE Y
Sbjct  511  LQVSAEDKGTGKAETITITAEKGRLSQDEIDRMVQEAAEFADEDKKVKDRIDGRNALEGY  570

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y+L+N + ++       EDD+  I   V + ++WL+ +Q ++KE++E KQKE+E + NP
Sbjct  571  LYSLKNNVEEKLEDKLD-EDDKDTITTAVQDAMDWLEDNQEADKEDYEEKQKEVEKLVNP  629

Query  424  ILQKMY  429
            I+ KMY
Sbjct  630  IMSKMY  635

 Score = 250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 157/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVG++++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  28   GPVIGIDLGTTYSCVGIYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  87

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             E T                                    I V  KGE + F PEE+S+M
Sbjct  88   PEKTLFDVKRLIGRKYTDKSVQADKKLLPYDLINKDGKPFIQVEVKGEKRQFAPEEVSAM  147

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLTKM+++SE +IG++V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  148  VLTKMKQISEGYIGREVFDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  207

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DKK  GE+NVL+FDLGGGTFDV+LL+I+ G+FE +A
Sbjct  208  YGIDKKAQGEKNVLVFDLGGGTFDVTLLAIDGGVFEVLA  246

>SDRG_03564
Length=658

 Score = 268 bits (685),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 188/247 (76%), Gaps = 4/247 (2%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVA+GA VQ  IL+G ND+S K   LL   V PLS G+ET GGVMT +I RNT VPTKK
Sbjct  394  EAVAYGAAVQGGILAGVNDESTKDILLLD--VAPLSLGIETVGGVMTKIINRNTVVPTKK  451

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            +QTFSTY DNQP V IQV+EGER+MT+DN++LGKF L GIPP PRGVPQI+VTF++DANG
Sbjct  452  SQTFSTYQDNQPAVSIQVYEGERTMTKDNHMLGKFELTGIPPAPRGVPQIEVTFEVDANG  511

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
            IL VSA +K TGK  KITIT +KGRLSQ +I+RMV EAE+   ED+  K RI+ +N LE 
Sbjct  512  ILQVSAEDKGTGKAEKITITAEKGRLSQEEIDRMVQEAEENAEEDKKIKDRIDGRNSLEG  571

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIAN  422
            Y YNL+N + ++KL  +I +DD+  +   V E ++WLD +Q ++KE+F+A+QK +E + N
Sbjct  572  YLYNLKNNV-EDKLADKIDDDDKDTVLKAVQEAMDWLDENQEADKEDFDAQQKAVEKVVN  630

Query  423  PILQKMY  429
            PI+ K+Y
Sbjct  631  PIMSKVY  637

 Score = 248 bits (634),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 159/226 (70%), Gaps = 39/226 (17%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAK  59
            +A+   G  +GIDLGTTYSCVG + N +VEIIANDQGNR TPSYVA+ ++ ERLIGD AK
Sbjct  23   VAEEPKGPVIGIDLGTTYSCVGHYANGKVEIIANDQGNRITPSYVAWDSNDERLIGDGAK  82

Query  60   NQVAMNAENT------------------------------------ITVTFKGESKTFQP  83
            NQ  +N ENT                                    I V  KGE+KTF  
Sbjct  83   NQATINPENTLFDVKRLIGRQYNDKSVQADKKLLPYEIVNKEGRPYIQVIVKGETKTFSA  142

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+S+M+LTKM+ ++E ++GK+V +AV+TVPAYFND+QRQATKDAG IAGL V RIINEP
Sbjct  143  EEVSAMILTKMKNIAENYLGKEVNDAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEP  202

Query  144  TAAAIAYGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            TAAAIAYG+DKK   GE+NVL+FDLGGGTFDV+LL+I+ G+FE ++
Sbjct  203  TAAAIAYGIDKKNAKGEKNVLVFDLGGGTFDVTLLTIDGGVFEVLS  248

>PYIR_24387
Length=633

 Score = 257 bits (657),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 158/233 (68%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  39   IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAASNATNT  98

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGESK F PEEISSMVLT
Sbjct  99   VFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEISSMVLT  158

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  159  RMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  218

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G    + NVLIFDLGGGTFDVS+LSIE GIFE  A G       L G D
Sbjct  219  DTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTH---LGGED  268

 Score = 196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 117/239 (49%), Positives = 156/239 (65%), Gaps = 14/239 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  404  EAVAYGAAVQGAILSGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  460

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  461  KTRVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  520

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG   + TI+N+ GRLSQ+DI+RMVA+AEK+K +D     RIEA+N LE
Sbjct  521  GILNVSARDKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRRIEARNSLE  580

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420
             Y Y     +  EK  + +    R A D        WL+ H+ +   E E K++ LE +
Sbjct  581  QYIYRAIE-IAREKGDANVETAIRDARD--------WLEDHEEATLRELEDKKRVLERL  630

>SPRG_10519
Length=782

 Score = 260 bits (665),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 147/301 (49%), Positives = 186/301 (62%), Gaps = 44/301 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIGDAAK Q A NA NT
Sbjct  188  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNEAERLIGDAAKLQAASNATNT  247

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I VTFKGE K F PEEISSMVLT
Sbjct  248  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGEGDKPLIQVTFKGEEKNFSPEEISSMVLT  307

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  308  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  367

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqd  208
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D    + D
Sbjct  368  DTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGEDFDSNMVD  424

Query  209  lllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMT  268
             L+ +    ++GL+      ++   R      K+  + +T A  +   L +  +   +MT
Sbjct  425  YLITEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFSSTMT  484

Query  269  R  269
            R
Sbjct  485  R  485

 Score = 189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 153/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+E  G VM+VLI RNT +P K
Sbjct  553  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIELVGKVMSVLIKRNTAIPVK  609

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+VTF+IDAN
Sbjct  610  KTRIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIEVTFEIDAN  669

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GIL+VSA +K TG +N  TI+N++GRL+Q DI+RMV EAEK+K +D     RI+A+N LE
Sbjct  670  GILHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKRIDARNDLE  729

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             Y Y          L++   ++D  A    + E  +W+D ++     E E K++ LE
Sbjct  730  GYLY--------RALEAASKKND-AAAQTALREARDWMDDNEELTVRELEDKRRVLE  777

>SDRG_05777
Length=786

 Score = 260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/301 (49%), Positives = 186/301 (62%), Gaps = 44/301 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIGDAAK Q A NA NT
Sbjct  193  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  252

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V+FKGE K F PEEISSMVLT
Sbjct  253  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDEDKPLIQVSFKGEDKRFTPEEISSMVLT  312

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  313  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  372

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqd  208
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D    + D
Sbjct  373  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGEDFDSNMVD  429

Query  209  lllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMT  268
             L+ +    ++GL+      ++   R      K+  + +T A  +   L +  +   +MT
Sbjct  430  FLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSAAIEVDSLFEGVDFSSTMT  489

Query  269  R  269
            R
Sbjct  490  R  490

 Score = 194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 156/239 (65%), Gaps = 14/239 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P K
Sbjct  558  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPIK  614

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T +D Q  V + ++EGER+    NN LG+F + G+    RG PQ++VTF+IDAN
Sbjct  615  KTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGLERAKRGEPQVEVTFEIDAN  674

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K T  + + TI+N+ GRLSQADI+RMV EAEK+K ED     +IEA+N LE
Sbjct  675  GILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLE  734

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420
            ++ Y     L  EK  +        A ++ + E   WL+ H+ +   E E K++ LE +
Sbjct  735  SFIYRALE-LTREKGDA--------AAENTIREAREWLEDHEDATLRELEEKKRVLERL  784

>PYIW_22144
Length=633

 Score = 256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/233 (59%), Positives = 158/233 (68%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  39   IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAASNATNT  98

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGESK F PEEISSMVLT
Sbjct  99   VFDAKRIIGRNFNDDIVKKDAKHFPFKIVEGDSNKVLIEVEFKGESKRFTPEEISSMVLT  158

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  159  RMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  218

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G    + NVLIFDLGGGTFDVS+LSIE GIFE  A G       L G D
Sbjct  219  DTNAGSNGEKTNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTH---LGGED  268

 Score = 199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 127/289 (44%), Positives = 175/289 (61%), Gaps = 23/289 (8%)

Query  142  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF------------EAVAFG  189
            E T   +    + K GE   L+  +GG T    + ++  G+F            EAVA+G
Sbjct  351  EETVLKVLQDANMKPGEITELVL-VGGSTRIPKVQTMLSGLFNGKELSKSINPDEAVAYG  409

Query  190  ATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTY  249
            A VQ AILSG  +++    LLL+DVTPLS G+ET G VM+VLI RNT +P +KT+ ++T 
Sbjct  410  AAVQGAILSG-IRNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKTRVYTTE  468

Query  250  ADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAV  309
             D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++VTF+IDANGILNVSA 
Sbjct  469  EDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDANGILNVSAR  528

Query  310  EKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRN  369
            +K TG   + TI+N+ GRLSQ+DI+RMVA+AEK+K +D     RIEA+N LE Y Y    
Sbjct  529  DKKTGARAETTISNNAGRLSQSDIDRMVADAEKFKKDDAELLRRIEARNALEQYIYRAIE  588

Query  370  TLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             L+ EK  + +    R A D        WL+ H+ +   E E K++ LE
Sbjct  589  -LSREKGDANVETAIRDARD--------WLEDHEEATLRELEDKKRALE  628

>SPRG_10477
Length=762

 Score = 259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 156/221 (71%), Gaps = 41/221 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIGDAAK Q A NA NT
Sbjct  184  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGDAAKLQAASNATNT  243

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V+FKGE K F PEEISSMVLT
Sbjct  244  VFDAKRIIGRAFSDPIVKKDAAHFPFKIVEGDDDKPLIQVSFKGEDKRFTPEEISSMVLT  303

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  304  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  363

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            D   G    + N+LIFDLGGGTFDVS+LSIE GIFE  A G
Sbjct  364  DTNAGSDGNKANILIFDLGGGTFDVSILSIENGIFEVKATG  404

 Score = 189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 153/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P K
Sbjct  534  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVK  590

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ VTF+IDAN
Sbjct  591  KTRVYTTEEDYQTQVDVCIYEGERACVDHNNKLGEFTISGIERAKRGEPQVQVTFEIDAN  650

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA++K T  + + TI N+ GRL+Q DI+RMVA+AEK+K +D     +IEA+N LE
Sbjct  651  GILNVSALDKKTNAKAETTINNNNGRLTQEDIDRMVADAEKFKKDDAEVLKKIEARNSLE  710

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
            ++ Y     L  EK  +        A ++ + E   WL+ H+ +   E E K++ LE
Sbjct  711  SFIYRALE-LTREKGDA--------AAENTIREAREWLEDHEDATLRELEEKKRVLE  758

>H310_14759
Length=787

 Score = 259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/232 (58%), Positives = 160/232 (69%), Gaps = 43/232 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A NA NT
Sbjct  194  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAASNATNT  253

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I VTF+GE K+F PEEISSMVLT
Sbjct  254  VFDAKRIIGRNFSDPIVKKDAAHFPFKISKGEGDKPLIQVTFRGEDKSFTPEEISSMVLT  313

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E F+G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  314  RMKETAENFLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  373

Query  153  DKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D      G+ N+LIFDLGGGTFDVS+LSIE GIFE  A G       L G D
Sbjct  374  DTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKATGGDTH---LGGED  422

 Score = 191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 153/240 (64%), Gaps = 14/240 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+E  G VM+VLI RNT +P K
Sbjct  558  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIELVGKVMSVLIKRNTAIPVK  614

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++VTF+IDAN
Sbjct  615  KTRIYTTEEDFQTSEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEVTFEIDAN  674

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GIL+VS  +K TG +N+ TI+N++GRLSQ DI+RMV EAEKYK  D     RIEA+N LE
Sbjct  675  GILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRIEARNDLE  734

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             + Y      + +K ++Q     R A D        WLD H  +  +E E K++ LE + 
Sbjct  735  GFIYRYLEVAS-KKGEAQAENALRDARD--------WLDEHAEATVKELEDKKRALERVC  785

>PYAP_22238
Length=633

 Score = 255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 158/233 (68%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A N  NT
Sbjct  39   IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAASNPSNT  98

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE+K+F PEEISSMVLT
Sbjct  99   VFDAKRIIGRNFSDEIVKKDATHFPFKITEGDDNKVLIQVEFKGETKSFTPEEISSMVLT  158

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  159  RMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  218

Query  153  DKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G+     NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  219  DTNAGQSGKGVNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  268

 Score = 195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 155/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  404  EAVAYGAAVQGAILSGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  460

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++VTF+IDAN
Sbjct  461  KTRVYTTEEDYQTSVDVCIYEGERACVDANNKLGEFNISGIERAKRGEPQVEVTFEIDAN  520

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG   + TI+N++GRL+Q DI+RMVAEAEKYK +D     +IEA+N LE
Sbjct  521  GILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVAEAEKYKKDDAELLRKIEARNELE  580

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y     +  EK +++     R A D        WL+ H+ +   E E K++ LE
Sbjct  581  QFIYRAIE-IAREKGETEAENAIRDARD--------WLEDHEDASLRELEDKKRMLE  628

>H257_18885
Length=786

 Score = 258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 161/232 (69%), Gaps = 43/232 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A NA NT
Sbjct  193  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAASNATNT  252

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I VTFKGE+K+F PEEISSMVLT
Sbjct  253  VFDAKRIIGRNFSDPIVKKDAAHFPFKITAGDDDKPLIEVTFKGEAKSFTPEEISSMVLT  312

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  313  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  372

Query  153  DKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D      G+ N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  373  DTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 154/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P K
Sbjct  557  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVK  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T AD Q  V + ++EGER+    NN LG+F + GI    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K T  + + TI+++ GRLSQ DI+RMVA+AEKYK +D     +IEA+N LE
Sbjct  674  GILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDDAEVLRKIEARNNLE  733

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y     +  EK  SQ         ++ + E   WL+ H+ +   E E K++ LE
Sbjct  734  GFIYRALE-IAREKGDSQ--------AENTIREAREWLEDHEEATLRELEDKKRLLE  781

>PYU1_G001540
Length=633

 Score = 253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 157/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A NA NT
Sbjct  39   IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNETERLIGEAAKIQAASNAHNT  98

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE K F PEEISSMVLT
Sbjct  99   VFDAKRIIGRNFNDEIVKKDAKHFPFKIVEGDDNKVLIEVEFKGEQKRFTPEEISSMVLT  158

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  159  RMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  218

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G    + NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  219  DTNAGNNGQKTNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  268

 Score = 196 bits (497),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 154/235 (66%), Gaps = 10/235 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ AILSG  +++    LLL+DVTPLS G+ET G VM+VLI RNT +P +KT
Sbjct  404  EAVAYGAAVQGAILSGI-RNDATNSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVRKT  462

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            + ++T  D Q  V + ++EGER+ T  NN LG+FN+ G+    RG PQ++VTF+IDANGI
Sbjct  463  RVYTTEEDYQTSVDVCIYEGERASTAVNNKLGEFNISGLERAKRGEPQVEVTFEIDANGI  522

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            LNVSA +K TG   + TI+ + GRLSQ DI+RMVAEAEK+K +D     RIEA+N LE +
Sbjct  523  LNVSARDKKTGARAETTISQNAGRLSQDDIDRMVAEAEKFKKDDAELLRRIEARNDLEQF  582

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             Y   + +  EK  S +    R A D        WL+ H+ +   E E K++ LE
Sbjct  583  IYRAID-IAREKGDSNVETSIRDARD--------WLEEHEEATLRELEDKKRSLE  628

>HYAP_12660
Length=786

 Score = 256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/233 (58%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEVVKKDAKHFPFKIKEGDDDKVLIEVEFKGEKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGGE----RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  372  DTNAGTDGKVCNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 110/237 (46%), Positives = 154/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDATN---SLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRL+Q DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLTQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y         +   Q  E     ++  + +  +WL+ H+ +   E E K++ LE
Sbjct  734  QFIY---------RAIEQAREKGDTTVESAIRDARDWLEDHEEATLRELEDKKRMLE  781

>H257_00007
Length=787

 Score = 255 bits (652),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/232 (57%), Positives = 161/232 (69%), Gaps = 43/232 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF ++ERLIG+AAK Q A NA NT
Sbjct  194  IGIDLGTTYSCVGVWKDGQVEIIANAEGNRTTPSWVAFNETERLIGEAAKLQAASNATNT  253

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V+F+GE+K+F PEEISSMVLT
Sbjct  254  VFDAKRIIGRNFSDPIVKKDAAHFPFKITKGEGDKPLIEVSFRGEAKSFTPEEISSMVLT  313

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+AYGL
Sbjct  314  RMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAALAYGL  373

Query  153  DKKG---GERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D      G+ N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  374  DTNAGAEGKSNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  422

 Score = 187 bits (475),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 152/240 (63%), Gaps = 14/240 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+E  G VM+VLI RNT +P K
Sbjct  558  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIELVGKVMSVLIKRNTAIPVK  614

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q    + ++EGER+   DNN LG+F + GI    RG P+++VTF+IDAN
Sbjct  615  KTRIYTTEEDFQTTEKVVIYEGERASVVDNNKLGEFEITGIERAKRGEPKLEVTFEIDAN  674

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GIL+VS  +K TG +N+ TI+N++GRLSQ DI+RMV EAEKYK  D     RIEA+N LE
Sbjct  675  GILHVSCKDKKTGAKNQTTISNNRGRLSQEDIDRMVDEAEKYKKADALLLKRIEARNELE  734

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             + Y         +      +    A ++ + E  +WL+ H  +  +E E K++ LE + 
Sbjct  735  GFIY---------RYLEVATKKGEAAAENLLRETRDWLEDHTEATVKELEDKKRALERVC  785

>PYVX_18121
Length=633

 Score = 252 bits (644),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  39   IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAASNATNT  98

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE+K F PEEISSMVL 
Sbjct  99   VFDAKRIIGRNFSDEVVKKDATHFPFKIVEGDDNKVLIEVEFKGEAKRFTPEEISSMVLL  158

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  159  RMKETAEAYLGQPINQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  218

Query  153  DKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  A G       L G D
Sbjct  219  DTNAGSDGKACNVLIFDLGGGTFDVSILSIENGIFEVKATGGDTH---LGGED  268

 Score = 196 bits (499),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 153/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  404  EAVAYGAAVQGAILSGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  460

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++VTF+IDAN
Sbjct  461  KTRVYTTEEDYQTSVDVCIYEGERACVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDAN  520

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG   + TI+N++GRL+Q DI+RMV EAEK+K +D     RIEA+N LE
Sbjct  521  GILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVQEAEKFKKDDAEMLRRIEARNDLE  580

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    T   EK  + +    R A D        WL+ H+ +   E E K++ LE
Sbjct  581  QFIYRAIETAR-EKGDANVENAIRDARD--------WLEDHEEATLRELEDKKRMLE  628

>PYIW_26567
Length=564

 Score = 249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 158/219 (72%), Gaps = 38/219 (17%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMN  65
            G  +GIDLGTTYSCVGV+++ +VEIIANDQGNR TPSYVA+ ++ ERLIGD AKNQ  +N
Sbjct  30   GPIIGIDLGTTYSCVGVYKDQKVEIIANDQGNRITPSYVAWDSNDERLIGDGAKNQATIN  89

Query  66   AENTI------------------------------------TVTFKGESKTFQPEEISSM  89
             E TI                                     V  KGE K F PEEIS+M
Sbjct  90   PEKTIFDVKRLIGRDYSDKSVQADKKLLPYHIVNKDGKPMIEVLIKGEKKLFSPEEISAM  149

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +LTKM++++E+++G++V +A++TVPAYFND+QRQATKDAG IAGL V RIINEPTAAAIA
Sbjct  150  ILTKMKQIAESYLGREVHDAIVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIA  209

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG+DK+  GE++VL+FDLGGGTFDV+LL+IE G+FE +A
Sbjct  210  YGIDKQSEGEKHVLVFDLGGGTFDVTLLAIEGGVFEVLA  248

 Score = 213 bits (542),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 139/172 (81%), Gaps = 1/172 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ  IL G +Q + L D++L+DV PLSQG+ET GGVMT LI RNT +P KK+
Sbjct  394  EAVAYGAAVQGGILGGMNQKD-LGDIVLIDVVPLSQGIETVGGVMTKLINRNTAIPNKKS  452

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST+ DNQP V I+V+EGER++ +DN+LLGKF+L GIPP PRG+PQI+VTF+IDANGI
Sbjct  453  QVFSTHVDNQPAVSIKVYEGERTLVKDNHLLGKFDLTGIPPAPRGIPQIEVTFEIDANGI  512

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIE  355
            L VSA +K TGK  KITIT +KGRLSQA+I+R++ EAE++  ED+  K RI+
Sbjct  513  LQVSAEDKGTGKAEKITITAEKGRLSQAEIDRIIEEAEQFAEEDKKVKERID  564

>PHALS_02079
Length=786

 Score = 254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 157/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAASNATNT  251

Query  70   I-------------------------------------TVTFKGESKTFQPEEISSMVLT  92
            I                                      V FKGE K+F PEEISSMVL 
Sbjct  252  IFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVDFKGEKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+++  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQNISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  372  DTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 154/240 (64%), Gaps = 20/240 (8%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYN---LRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    +     D   +S I    R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIEIAREKGDTNTESAI----RDARD--------WLEDHEEATLRELEDKKRMLE  781

>PITG_11913
Length=786

 Score = 253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDEDKVLIEVEFKGEKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  372  DTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 153/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    T   EK  +      R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIETAR-EKGDTNAESAIRDARD--------WLEDHEEATLRELEDKKRMLE  781

>PPTG_03121
Length=786

 Score = 253 bits (646),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 184/301 (61%), Gaps = 44/301 (15%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKGE+K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEVVKKDATHFPFKIKEGDDDKVLIEVEFKGENKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqd  208
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D    + +
Sbjct  372  DTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGEDFDNNMVE  428

Query  209  lllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMT  268
             LL +    ++ L+ +G    +   R      K+  + +T A  +   L +  +   ++T
Sbjct  429  HLLTEFKRKNRNLDPSGSARAMRRLRTACESAKRMLSTTTSASVEVDSLFEGVDFSSTVT  488

Query  269  R  269
            R
Sbjct  489  R  489

 Score = 195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 154/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y     +  EK  + +    R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIE-MAREKGDTNVESAIRDARD--------WLEDHEEATLRELEDKKRMLE  781

>PHYCA_509820
Length=786

 Score = 252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 150/215 (70%), Gaps = 41/215 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FK E K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEVVKKDATHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAAIAYGL
Sbjct  312  RMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAAIAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIF  183
            D   G      NVLIFDLGGGTFDVSLLSIEEGIF
Sbjct  372  DTNAGTDGKACNVLIFDLGGGTFDVSLLSIEEGIF  406

 Score = 194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 154/240 (64%), Gaps = 20/240 (8%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYN---LRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    +     D   +S I    R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIEMAREKGDTNAESAI----RDARD--------WLEDHEEATLRELEDKKRMLE  781

>CCI46091
Length=787

 Score = 252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTDSERLIG+AAK Q A N  NT
Sbjct  193  IGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDSERLIGEAAKIQAASNPTNT  252

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FK E+K F PEEIS+MVLT
Sbjct  253  VFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEFKKETKQFTPEEISAMVLT  312

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  313  RMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  372

Query  153  DKKGGE----RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+L IE GIFE  A G       L G D
Sbjct  373  DTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTH---LGGED  422

 Score = 197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 152/237 (64%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  558  EAVAYGAAVQGAILDGIRNDATN---SLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  614

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+F + GI    RG PQ+ VTF+IDAN
Sbjct  615  KTRVYTTEEDYQTAVDVCIYEGERACVDSNNKLGEFTISGIERARRGEPQVKVTFEIDAN  674

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMV++AEK+K +D     RIEA+NGLE
Sbjct  675  GILNVSATDKKTGAKAETTISNNRGRLSQEDIDRMVSDAEKFKKDDAEMLSRIEARNGLE  734

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y   N          + E    A  + + +   WLD H+ +   E E K++ LE
Sbjct  735  QFIYRAINI---------VQEKGDAATGNALRDAREWLDDHEDATLRELEEKKRMLE  782

>PHYRA_78193
Length=786

 Score = 251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF +SERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNESERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FKG+ K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEVVKKDAKHFPFTIKEGDDDKVLIEVEFKGDKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQSISQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  372  DTNAGTDGTACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/237 (49%), Positives = 153/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    T   EK  +      R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIETAR-EKGDTNAESAIRDARD--------WLEDHEEATLRELEDKKRMLE  781

>PHYKE_10815
Length=786

 Score = 251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/233 (58%), Positives = 155/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF DSERLIG+AAK Q A NA NT
Sbjct  192  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDSERLIGEAAKIQAAGNATNT  251

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V FK E K+F PEEISSMVL 
Sbjct  252  VFDAKRIIGRSFSDEMVKKDAKHFPFTIKEGDDDKVLIEVEFKNEKKSFTPEEISSMVLL  311

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EAF+G+ +  AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  312  RMKETAEAFLGQKIGQAVVTVPAYFNDQQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  371

Query  153  DKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+LSIE GIFE  + G       L G D
Sbjct  372  DTNAGTDGKACNVLIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGED  421

 Score = 194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/240 (48%), Positives = 154/240 (64%), Gaps = 20/240 (8%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  557  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  613

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  614  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  673

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  674  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  733

Query  362  NYAYN---LRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y    +     D   +S I    R A D        WL+ H+ +   E E K++ LE
Sbjct  734  QFIYRAIEMAREKGDTNAESAI----RDARD--------WLEDHEEATLRELEDKKRMLE  781

>CCA20828
Length=787

 Score = 249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 156/233 (67%), Gaps = 44/233 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAFTD+ERLIG+AAK Q A N  NT
Sbjct  193  IGIDLGTTYSCVGVWKDGQVEIIANTEGNRTTPSWVAFTDTERLIGEAAKIQAASNPTNT  252

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I V +K E+K F PEEIS+MVLT
Sbjct  253  VFDAKRIIGRSFADEAVQRDAQHFPFKIVSGDGDKPLIQVEYKKETKQFTPEEISAMVLT  312

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            +M+E +EA++G+ +K AV+TVPAYFND QRQ+TKDAG+IAGL+V RIINEPTAAA+AYGL
Sbjct  313  RMKETAEAYLGQPIKQAVVTVPAYFNDHQRQSTKDAGSIAGLDVKRIINEPTAAALAYGL  372

Query  153  DKKGGE----RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            D   G      NVLIFDLGGGTFDVS+L IE GIFE  A G       L G D
Sbjct  373  DTNAGSDGKACNVLIFDLGGGTFDVSILRIENGIFEVKATGGDTH---LGGED  422

 Score = 197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/265 (45%), Positives = 164/265 (62%), Gaps = 14/265 (5%)

Query  156  GGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSG--NDQSEKlqdlllld  213
            G  R   + +L  G F+   LS      EAVA+GA VQ AIL G  ND +     LLL+D
Sbjct  530  GSTRIPKVQNLLSGVFNGKELSKSINPDEAVAYGAAVQGAILDGIRNDATN---SLLLVD  586

Query  214  VTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNL  273
            VTPLS G+ET G VM+VLI RNT +P +KT+ ++T  D Q  V + ++EGER+    NN 
Sbjct  587  VTPLSLGIETVGKVMSVLIKRNTAIPVRKTRVYTTEEDYQTAVDVCIYEGERACVDSNNK  646

Query  274  LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADI  333
            LG+F + GI    RG PQ+ VTF+IDANGILNVSA +K TG + + TI+N++GRLSQ DI
Sbjct  647  LGEFTISGIERARRGEPQVKVTFEIDANGILNVSATDKKTGAKAETTISNNRGRLSQEDI  706

Query  334  ERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVT  393
            +RMV++AEK+K +D     RIEA+N LE + Y   N  N EK ++          ++ + 
Sbjct  707  DRMVSDAEKFKKDDAEMLARIEARNSLEQFIYRALNNGN-EKCEA--------GAENALR  757

Query  394  EIINWLDAHQASEKEEFEAKQKELE  418
            +   WLD H+ +   E E K++ LE
Sbjct  758  DAREWLDDHEEATLRELEDKKRTLE  782

>PHYRA_72238
Length=601

 Score = 212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 142/220 (65%), Gaps = 39/220 (18%)

Query  7    GASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNA  66
            G  VGIDLGTT++ VGVWQN+RVEI+ +  G+ +TPSYVAFT++ RLIG AAK Q+  NA
Sbjct  8    GPVVGIDLGTTFARVGVWQNNRVEIVPSCDGSYSTPSYVAFTETSRLIGHAAKYQLTRNA  67

Query  67   ENTI-------------------------------------TVTFKGESKTFQPEEISSM  89
             NT+                                      V F+GE+KTFQP EI +M
Sbjct  68   RNTVFGMNQLVGRKFSDPEVQRSMKHWPFKVICGQNDNPEVEVQFRGETKTFQPVEILAM  127

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +L ++RE++E   GK VK  V+TVP+ FN SQR+A KDAG IAGLNVLR +N  TAA+IA
Sbjct  128  LLAELRELAEKHTGKTVKEVVLTVPSCFNHSQRRAMKDAGEIAGLNVLRFVNPATAASIA  187

Query  150  YGLDKKG--GERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            YG DK    GE +VL+FDLGGG  DVS+++IE+GI+E  A
Sbjct  188  YGFDKDWTDGEHDVLVFDLGGGMLDVSVVTIEQGIYEVKA  227

 Score = 142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/243 (40%), Positives = 138/243 (57%), Gaps = 28/243 (12%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E  AFG TVQAAIL+    S  L D ++LDVTPLS   E  G    V+I R+TTVPTK+T
Sbjct  373  EGAAFGVTVQAAILNCV-ASPTLYDFIMLDVTPLSLWAEVDGTNSLVVIYRHTTVPTKRT  431

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
              FST  DNQ  + +++FEGE S    N LLG   +D IP  PRG  +I+VT DI+A+ I
Sbjct  432  VPFSTSEDNQAVMRVRIFEGEHSDMSANCLLGTIEVDNIPLKPRGESEIEVTLDINADDI  491

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NVS  E STG E  ++I                         D   ++R+ +K  LE+Y
Sbjct  492  VNVSVKEISTGLEKNLSI-----------------------GTDAREELRLGSKTALESY  528

Query  364  AYNLRN--TLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
            A  + +  T N  +L+  I   D +AI D  T+ ++WL+ + ++EKE F+ K+++LE +A
Sbjct  529  ANAVCSSATANIAELKRSIA--DMQAIKDSATDTLHWLNGNHSAEKEAFDVKRQKLEEVA  586

Query  422  NPI  424
             P+
Sbjct  587  TPV  589

>PHYSO_525236
Length=246

 Score = 197 bits (500),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/228 (46%), Positives = 137/228 (60%), Gaps = 42/228 (18%)

Query  1    MAQSVTGA-SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK  59
            MA   TG  S+GID+GT YS V +W  DR EI+ N  GNR T SYVAFTDS+ L+GDAA 
Sbjct  1    MANKTTGGPSIGIDIGTAYSRVAIWHKDRAEILPNRFGNRLTSSYVAFTDSKVLVGDAAA  60

Query  60   NQVAMNAENTI-----------------------------------------TVTFKGES  78
            +Q   NAENT+                                          V F+G++
Sbjct  61   DQRLQNAENTVFGITRLLGRKFSDPEVQERIKHWPFKVIRGPHDTPPPPPHVMVQFRGQT  120

Query  79   KTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLR  138
            K F P +I S++L++MR + E + GK+   AV+TVPA+FN SQRQA KDAGAIA + V+R
Sbjct  121  KIFHPVQILSLLLSEMRGIVETYTGKEATTAVVTVPAHFNYSQRQAVKDAGAIAEIQVMR  180

Query  139  IINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            +I+  TAA+I+YG++KKG ER VL+ DLG  T DVS++ IE+G FE  
Sbjct  181  MISRSTAASISYGINKKGSERRVLVVDLGASTLDVSVVEIEDGNFEVC  228

>SPRG_10476
Length=270

 Score = 194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/239 (49%), Positives = 155/239 (65%), Gaps = 14/239 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P K
Sbjct  42   EAVAYGAAVQGAILSGIRNDAT---NSLLLVDVTPLSLGIETVGRVMSVLIKRNTAIPVK  98

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T +D Q  V + ++EGER+    NN LG+F + GI    RG PQ++VTF+IDAN
Sbjct  99   KTRVYTTESDYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKRGEPQVEVTFEIDAN  158

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K T  + + TI+N+ GRLSQADI+RMV EAEK+K ED     +IEA+N LE
Sbjct  159  GILNVSARDKKTNAKAETTISNNHGRLSQADIDRMVEEAEKFKKEDAEALKKIEARNSLE  218

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420
             + Y     L  EK  +        A ++ + E   WL+ H+ +   E E K++ LE +
Sbjct  219  GFIYRALE-LTREKGDA--------AAENTIREAREWLEDHEDATLRELEEKKRVLERL  268

>HYAP_06818
Length=316

 Score = 196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 159/251 (63%), Gaps = 21/251 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  53   EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  107

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  108  QVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  167

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS A+IE+MVA+AE     D+  K  IEAKN  ++ 
Sbjct  168  VNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAVADQQRKELIEAKNEADSV  226

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIIN--WLDAHQASEK---EEFEAKQKELE  418
             Y    TL          E+ ++ ID    E +     D  Q SE    EE +A  KE++
Sbjct  227  LYTTEKTL----------EEHKEKIDADTLEKVKVALSDLRQKSESENTEEIKAALKEVQ  276

Query  419  GIANPILQKMY  429
             +A  I + +Y
Sbjct  277  EMAMKIGEAVY  287

>PHYSO_549561
Length=361

 Score = 196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 154/237 (65%), Gaps = 14/237 (6%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AIL G  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  132  EAVAYGAAVQGAILDGIRNDAT---NSLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  188

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ G+    RG PQ++VTF+IDAN
Sbjct  189  KTRVYTTEEDYQTSVDVCIYEGERACVESNNKLGEFNISGLERAKRGEPQVEVTFEIDAN  248

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG + + TI+N++GRLSQ DI+RMVAEA+K+K +D     RIEA+N LE
Sbjct  249  GILNVSARDKKTGAKAETTISNNRGRLSQEDIDRMVAEADKFKKDDAEMLRRIEARNDLE  308

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             + Y     +  EK  + +    R A D        WL+ H+ +   E E K++ LE
Sbjct  309  QFIYRAIE-MAREKGDTNVESAIRDARD--------WLEDHEEATLRELEDKKRMLE  356

>PYAP_19738
Length=648

 Score = 201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 144/207 (70%), Gaps = 8/207 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  389  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  443

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+VTFDIDANGI
Sbjct  444  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVTFDIDANGI  503

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NVSA +KSTGKE  I I +  G LS ADIERMV EAE     D+  K  IEAKN  ++ 
Sbjct  504  VNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIEAKNEADSV  562

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAI  388
            AY    TL  +++K+  +  E  + AI
Sbjct  563  AYTTEKTLKEHEDKVDGETAEQVKTAI  589

 Score = 198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 141/231 (61%), Gaps = 39/231 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  ++ ERL+G  AK Q   N +N
Sbjct  29   IGIDLGTTNSCVAVMEGKTPRVIENAEGARTTPSVVAILENDERLVGMPAKRQAVTNPDN  88

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + K + P +I SMVLTKM
Sbjct  89   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVPGPNGKDAWVEAKGKKYSPSQIGSMVLTKM  148

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E +++F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYGLDK
Sbjct  149  KETADSFLGKSVSQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGLDK  208

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEK  205
              G + + +FDLGGGTFDVS+L I  G+FE     AT    +L G D  E+
Sbjct  209  ADG-KVIAVFDLGGGTFDVSILEISGGVFE---VKATNGDTLLGGEDFDEE  255

>PYU1_G003754
Length=650

 Score = 200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  30   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  89

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + K + P +I SMVLTKM
Sbjct  90   TFYAVKRLIGRKFQDKETQEVSKVVSYKIVSGPNGKDAWVEAKGKKYSPSQIGSMVLTKM  149

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  150  KETADGFLGKSVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  209

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  210  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  238

 Score = 198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 161/248 (65%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  390  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  444

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  445  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  504

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV+A +K+TGKE  I I +  G LS ADIERMVAEAE     D+  K  IEAKN  ++ 
Sbjct  505  VNVAARDKATGKEQNIVIQSSGG-LSDADIERMVAEAEMNAEADQKRKELIEAKNEADSV  563

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
            +Y    TL  +++KL  +  E  +  ++       N     +    EE +A  +E++ ++
Sbjct  564  SYTTEKTLKEHEDKLDKETVEQVKAGLE-------NLRTKAEGENAEEIKAALEEVQKLS  616

Query  422  NPILQKMY  429
              I + +Y
Sbjct  617  LKIGEAVY  624

>PHYRA_71123
Length=633

 Score = 199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  11   IGIDLGTTNSCVAVMEGKAARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + K + P +I SMVLTKM
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGKDAWVEAKGKKYSPSQIGSMVLTKM  130

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  131  KETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  190

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  191  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  219

 Score = 182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 163/248 (66%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  371  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  426  QVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+++IE+MVA+AE   + D   K  IEAKN  ++ 
Sbjct  486  VNVGARDKATGKEQNIVIQSSGG-LSESEIEKMVADAEANAAADLERKELIEAKNDADST  544

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y    TL  +++K+ ++  E  + A+ D  T+        +    EE +A  +E++ ++
Sbjct  545  LYTTEKTLKEHEDKIDAETLEKVKAALADLRTK-------SETDNTEEIKAALEEVQKMS  597

Query  422  NPILQKMY  429
              I + +Y
Sbjct  598  MKIGEAVY  605

>H257_01277
Length=652

 Score = 199 bits (505),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 137/217 (63%), Gaps = 37/217 (17%)

Query  4    SVTGASV-GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQ  61
            S +GA V GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q
Sbjct  21   SASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQ  80

Query  62   VAMNAENTI---------------------TVTFK-------------GESKTFQPEEIS  87
               N  NT+                      V++K              + + + P +I 
Sbjct  81   AVTNPYNTLYAVKRLIGRKFQDKETQEVAKVVSYKIVAGTNGTDAWVEAQGQKYSPSQIG  140

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVLTKM+E +E F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA
Sbjct  141  SMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAA  200

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
            +AYGLDK  G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  201  LAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFE  236

 Score = 187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 135/201 (67%), Gaps = 8/201 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+ +      +LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  388  EVVAMGAAIQGGVLRGDVKD-----ILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  442

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+FDIDANGI
Sbjct  443  QVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSFDIDANGI  502

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+ +IERMV EAE     D   K  IEAKN  ++ 
Sbjct  503  VNVGARDKATGKEQNIVIQSSGG-LSEDEIERMVREAEVNAEADAKRKELIEAKNEADSL  561

Query  364  AYNLRNTL--NDEKLQSQIPE  382
             Y    TL  ++ KL + + E
Sbjct  562  VYTTEKTLTEHEAKLDASLVE  582

>PHALS_07616
Length=677

 Score = 199 bits (505),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  55   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  114

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + K + P +I SMVLTKM
Sbjct  115  TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGKDAWVEAKGKKYSPSQIGSMVLTKM  174

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  175  KETADGFLGKPITQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  234

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  235  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  263

 Score = 185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 165/248 (67%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  415  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  469

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  470  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  529

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  530  VNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKNDADST  588

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y    TL  +++K+ +++ E  + A+ D  T+        +    E+ +A  +E++ ++
Sbjct  589  IYTTEKTLKEHEDKIDAELLEKVKTALADLRTK-------AEGDNTEDIKAALEEVQKMS  641

Query  422  NPILQKMY  429
              I + +Y
Sbjct  642  MKIGEAVY  649

>PHYKE_9008
Length=650

 Score = 198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  28   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAIIDNDERLVGMPAKRQAVTNPEN  87

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + + + P +I SMVLTKM
Sbjct  88   TFYAVKRLIGRKFSDKETQEVSKVVSYKIVKGNNGKDAWVEAKGQKYSPSQIGSMVLTKM  147

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  148  KETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  207

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  208  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  236

 Score = 186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 162/248 (65%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  388  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  442

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  443  QVFSTAADSQTQVGIKVLQGEREMATDNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  502

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  503  VNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQERKELIEAKNDADST  561

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
            AY    TL  +++K+ ++  E  + A+ D            +    EE +A  +E++ ++
Sbjct  562  AYQTEKTLKEHEDKIDAETVEKVKAALAD-------LQKKAEGENTEEIKAALEEVQKLS  614

Query  422  NPILQKMY  429
              I + +Y
Sbjct  615  MKIGEAVY  622

>PHYSO_500480
Length=633

 Score = 198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  11   IGIDLGTTNSCVAVMEGKTPRVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + + + P +I SMVLTKM
Sbjct  71   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGKDAWVEAKGQKYSPSQIGSMVLTKM  130

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  131  KETADGFLGKHVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  190

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  191  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  219

 Score = 185 bits (470),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 164/248 (66%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  371  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  426  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  486  VNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKNEADST  544

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y    TL  +++K+ ++  E  + A+ D  T+        +    EE +A  +E++ ++
Sbjct  545  LYTTEKTLKEHEDKIDAETLEKVKAALADLRTK-------SEGDNTEEIKAALEEVQKMS  597

Query  422  NPILQKMY  429
              I + +Y
Sbjct  598  MKIGEAVY  605

>PYVX_15051
Length=632

 Score = 197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/241 (48%), Positives = 144/241 (60%), Gaps = 40/241 (17%)

Query  1    MAQSVTGASV-GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  58
            M  +  GA V GIDLGTT SCV V +     +I N +G RTTPS VA  ++ ERL+G  A
Sbjct  1    MFSAAAGAEVIGIDLGTTNSCVAVMEGKAPRVIENSEGARTTPSVVAILENDERLVGMPA  60

Query  59   KNQVAMNAENTI---------------------TVTFK-------------GESKTFQPE  84
            K Q   N +NT                       V+++              + K + P 
Sbjct  61   KRQAVTNPQNTFYAVKRLIGRKFTDKETQEVSKVVSYEIVSGPNGKDAWVEAKGKKYSPS  120

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            +I SMVLTKM+E +E F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPT
Sbjct  121  QIGSMVLTKMKETAEGFLGKSITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPT  180

Query  145  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSE  204
            AAA+AYGLDK  G + + +FDLGGGTFDVS+L I  G+FE     AT    +L G D  E
Sbjct  181  AAALAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFE---VKATNGDTLLGGEDFDE  236

Query  205  K  205
            +
Sbjct  237  E  237

 Score = 196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 144/207 (70%), Gaps = 8/207 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  371  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V FDIDANGI
Sbjct  426  QVFSTAADSQTQVGIKVLQGEREMASDNKLLGNFDLVGIPPAPRGVPQIEVAFDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NVSA +K+T KE  I I +  G LS +DIERMV EAE     D+  K  IE+KN  ++ 
Sbjct  486  VNVSARDKATNKEQSIVIQSSGG-LSDSDIERMVQEAEMNAEADQKRKELIESKNEADSV  544

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAI  388
            AYN+  TL  +++KL  +  E  + A+
Sbjct  545  AYNVEKTLKEHEDKLDDETKEQVKTAV  571

>PHYCA_541134
Length=633

 Score = 197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + + + P +I SMVLTKM
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGKDAWVEAKGQKYSPSQIGSMVLTKM  130

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  131  KETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  190

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  191  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  219

 Score = 184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 163/248 (66%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  371  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  426  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  486  VNVGARDKATGKEQNIVIQSSGG-LSDAEIEKMVADAEANAAADQQRKELIEAKNEADST  544

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y    TL  +++K+ ++  E  + A+ D  T+        +    EE +A  +E++ ++
Sbjct  545  LYTTEKTLTEHEDKIDAETLEKVKAALADLRTK-------SEGDNTEEIKAALEEVQKMS  597

Query  422  NPILQKMY  429
              I + +Y
Sbjct  598  MKIGEAVY  605

>PITG_15786
Length=633

 Score = 197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 132/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  11   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  70

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              + + + P +I SMVLTKM
Sbjct  71   TFYAVKRLIGRKFEDKETQEVSKVVSYKIVKGNNGKDAWVEAKGQKYSPSQIGSMVLTKM  130

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  131  KETADGFLGKPITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  190

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  191  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  219

 Score = 186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 165/248 (67%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  371  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  425

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  426  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  485

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  486  VNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKNDADST  544

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y+   TL  +++K+ ++  E  + A+ D  T+        +    EE +A  +E++ ++
Sbjct  545  LYSTEKTLKEHEDKIDAETLEQVKTALTDLRTK-------SEGDNTEEIKAALEEVQKLS  597

Query  422  NPILQKMY  429
              I + +Y
Sbjct  598  MKIGEAVY  605

>PPTG_18274
Length=648

 Score = 197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 131/210 (62%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G RTTPS VA  D+ ERL+G  AK Q   N EN
Sbjct  27   IGIDLGTTNSCVAVMEGKTARVIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPEN  86

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T                       V++K              +   + P +I SMVLTKM
Sbjct  87   TFYAVKRLIGRKFDDKETQEVSKVVSYKIVKGNNGKDAWVEAKGTKYSPSQIGSMVLTKM  146

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK V  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  147  KETADGFLGKPVTQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  206

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  207  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  235

 Score = 186 bits (471),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 119/248 (48%), Positives = 165/248 (67%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  387  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  441

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN LLG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  442  QVFSTAADSQTQVGIKVLQGEREMAADNKLLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  501

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+A+IE+MVA+AE   + D+  K  IEAKN  ++ 
Sbjct  502  VNVGARDKATGKEQNIVIQSSGG-LSEAEIEKMVADAEANAAADQQRKELIEAKNEADST  560

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
             Y+   TL  +++K+ ++  E  + A+ D  T+        +    EE +A  +E++ ++
Sbjct  561  LYSTEKTLKEHEDKIDAETLEKVKAALADLRTK-------SEGDNTEEIKAALEEVQKMS  613

Query  422  NPILQKMY  429
              I + +Y
Sbjct  614  MKIGEAVY  621

>H310_06631
Length=651

 Score = 197 bits (500),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 137/217 (63%), Gaps = 37/217 (17%)

Query  4    SVTGASV-GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQ  61
            + +GA V GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q
Sbjct  21   AASGAEVIGIDLGTTNSCVAVMEGKNPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQ  80

Query  62   VAMNAENTI---------------------TVTFK-------------GESKTFQPEEIS  87
               N  NT+                      V++K              + + + P +I 
Sbjct  81   AVTNPFNTLYAVKRLIGRKYQDKETQDVSKVVSYKIVAGPNGTDAWVEAQGQKYSPSQIG  140

Query  88   SMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
            SMVLTKM+E +E F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA
Sbjct  141  SMVLTKMKETAEGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAA  200

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
            +AYGLDK  G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  201  LAYGLDKADG-KVIAVFDLGGGTFDVSILEISGGVFE  236

 Score = 188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/246 (47%), Positives = 150/246 (61%), Gaps = 11/246 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+ +      +LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  388  EVVAMGAAIQGGVLRGDVKD-----ILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  442

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST +DNQ  V I+V +GER M  DN LLG F+L  IPP PRG+PQI+V+FDIDANGI
Sbjct  443  QVFSTASDNQTQVGIKVLQGEREMAADNKLLGNFDLQNIPPAPRGIPQIEVSFDIDANGI  502

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV A +K+TGKE  I I +  G LS+ +IERMV EAE     D   K  IEAKN  ++ 
Sbjct  503  VNVGARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEAKNEADSL  561

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
             Y    TL + + +      D   +D     +    DA +  + E  +A  +EL   +  
Sbjct  562  VYTTEKTLTEHEAKL-----DAALVDSVKASLQGVRDAIEKDDLETLKAALEELNKTSMK  616

Query  424  ILQKMY  429
            I + +Y
Sbjct  617  IGEAIY  622

>SDRG_11043
Length=649

 Score = 195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 133/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TI---------------------TVTFK-------------GESKTFQPEEISSMVLTKM  94
            T+                      V++K              + + + P +I SMVLTKM
Sbjct  87   TLYAVKRLIGRKFNDKETQEVSKVVSYKIVPGTNGSDAWVEAQGQKYSPSQIGSMVLTKM  146

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  147  KETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  206

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  207  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  235

 Score = 187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 133/192 (69%), Gaps = 6/192 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  387  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  441

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST +DNQ  V I+V +GER M  DN  LG F+L  IPP PRG+PQI+V+FDIDANGI
Sbjct  442  QVFSTASDNQTQVGIKVLQGEREMAADNKSLGNFDLQNIPPAPRGIPQIEVSFDIDANGI  501

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NVSA +K+TGKE  I I +  G LS+ +IERMV EAE     D   K  IE KN  ++ 
Sbjct  502  VNVSARDKATGKEQSIVIQSSGG-LSEDEIERMVREAELNAEADAKRKELIEVKNEADSL  560

Query  364  AYNLRNTLNDEK  375
             YN   TL++ +
Sbjct  561  VYNAEKTLSEHE  572

>CCI45982
Length=661

 Score = 195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 137/220 (62%), Gaps = 38/220 (17%)

Query  2    AQSV--TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAA  58
            AQ+V  +GA +GIDLGTT SCV   +     +I N +G RTTPS VA  D  ERL+G  A
Sbjct  26   AQNVAGSGAVIGIDLGTTNSCVATMEGKTPRVIENSEGARTTPSVVAILDGGERLVGMPA  85

Query  59   KNQVAMNAENTI---------------------TVTFK-------------GESKTFQPE  84
            K Q   N E+T                       V++K              + + + P 
Sbjct  86   KRQAVTNPESTFYAVKRLIGRKYNDGETNKVKEVVSYKIVPGPNGKDAWVETKGQKYSPS  145

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            +I SMVL KM+E +++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL+VLRIINEPT
Sbjct  146  QIGSMVLAKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLDVLRIINEPT  205

Query  145  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
            AAA+AYG+DK  G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  206  AAALAYGMDKADG-KVIAVFDLGGGTFDVSILEISGGVFE  244

 Score = 194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 157/246 (64%), Gaps = 16/246 (7%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  396  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  451  QVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  510

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV+A +K+TGKE  I I +  G LS+ADIERMV EAE   + D+  K  IE KN  +  
Sbjct  511  VNVAARDKATGKEQNIVIQSSGG-LSEADIERMVQEAEMNATADQQRKELIELKNDADGV  569

Query  364  AYNLRNTLND----------EKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAK  413
             Y+   TL +          E++++ + +   KA  D V EI   L+  Q S  +  EA 
Sbjct  570  IYSTEKTLKEYEDKIEATLVEQVKTDLADLRSKAEGDSVDEIKAALEKVQQSSLKIGEAV  629

Query  414  QKELEG  419
             K  +G
Sbjct  630  YKAQQG  635

>SDRG_05816
Length=479

 Score = 191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 153/235 (65%), Gaps = 10/235 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAVA+GA VQ AILSG  +++    LLL+DVTPLS G+E  G VM+VLI RNT +P KKT
Sbjct  250  EAVAYGAAVQGAILSGI-RNDATNSLLLVDVTPLSLGIELVGKVMSVLIKRNTAIPVKKT  308

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            + ++T  D Q    + +FEGER+   DNN LG+F + GI    RG PQI+VTF+IDANGI
Sbjct  309  RIYTTEEDWQTTEKVVIFEGERACVVDNNKLGEFEISGIERAKRGEPQIEVTFEIDANGI  368

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            L+VSA +K TG +N  TI+N++GRL+Q DI+RMV EAEK+K +D     RI+A+N LE Y
Sbjct  369  LHVSARDKKTGAKNATTISNNRGRLTQQDIDRMVEEAEKFKKDDAQMLKRIDARNDLEGY  428

Query  364  AYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELE  418
             Y          L++   ++D  A    + E  +W+D ++     E E K++ LE
Sbjct  429  LY--------RALEAASKKND-AAAQTALCEARDWMDDNEELTVRELEDKRRVLE  474

 Score = 153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 118/185 (64%), Gaps = 7/185 (4%)

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            MVLT+M+E +E ++G+++K AV+TVPAYFND QRQ+TKDAGAIAGL+V RIINEPTAAA+
Sbjct  1    MVLTRMKETAENYLGQEIKQAVVTVPAYFNDQQRQSTKDAGAIAGLDVKRIINEPTAAAL  60

Query  149  AYGLDKKGG----ERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSE  204
            AYGLD   G    + N+LIFDLGGGTFDVS+LSIE GIFE  + G       L G D   
Sbjct  61   AYGLDTNAGADGSKTNILIFDLGGGTFDVSILSIENGIFEVKSTGGDTH---LGGEDFDS  117

Query  205  KlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGE  264
             + D L+ +    ++GL+      ++   R      K+  + +T A  +   L +  +  
Sbjct  118  NMVDFLVTEFKRKNKGLDPTSSARSMRRLRTACESAKRMLSTTTSASIEVDSLFEGVDFS  177

Query  265  RSMTR  269
             +MTR
Sbjct  178  STMTR  182

>SPRG_02294
Length=634

 Score = 193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 133/210 (63%), Gaps = 36/210 (17%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            +GIDLGTT SCV V +     +I N +G+RTTPS VA  ++ ERL+G  AK Q   N  N
Sbjct  27   IGIDLGTTNSCVAVMEGKSPRVIENSEGSRTTPSVVAILENGERLVGMPAKRQAVTNPTN  86

Query  69   TI---------------------TVTF-------------KGESKTFQPEEISSMVLTKM  94
            T+                      V++             + + + + P +I SMVLTKM
Sbjct  87   TLYAVKRLIGRKFSDKETQEVSKVVSYNIVAGTNGQDAWVEAQGQKYSPSQIGSMVLTKM  146

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E ++ F+GK +  AV+TVPAYFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK
Sbjct  147  KETADGFLGKTITQAVVTVPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDK  206

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
              G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  207  ADG-KVIAVFDLGGGTFDVSILEISGGVFE  235

 Score = 179 bits (455),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 114/162 (70%), Gaps = 1/162 (1%)

Query  214  VTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNL  273
            VTPLS G+ET GGV T LIPRNTT+PTKK+Q FST +DNQ  V I+V +GER M  DN  
Sbjct  397  VTPLSLGIETLGGVFTKLIPRNTTIPTKKSQVFSTASDNQTQVGIKVLQGEREMAADNKS  456

Query  274  LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADI  333
            LG F+L  IPP PRG+PQI+V+FDIDANGI+NVSA +K+TGKE  I I +  G LS+ +I
Sbjct  457  LGNFDLQNIPPAPRGIPQIEVSFDIDANGIVNVSARDKATGKEQSIVIQSSGG-LSEDEI  515

Query  334  ERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEK  375
            ERMV EAE     D   K  IE KN  ++  YN   TL++ +
Sbjct  516  ERMVREAELNAEADAKRKELIEVKNEADSLVYNAEKTLSEHE  557

>CCA21514
Length=659

 Score = 193 bits (490),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 131/214 (61%), Gaps = 36/214 (17%)

Query  6    TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAM  64
            +GA +GIDLGTT SCV         +I N +G RTTPS VA  D  ERL+G  AK Q   
Sbjct  31   SGAVIGIDLGTTNSCVATMDGKTPRVIENSEGARTTPSVVAILDGGERLVGMPAKRQAVT  90

Query  65   NAENTI---------------------TVTFK-------------GESKTFQPEEISSMV  90
            N E+T                       V++K              + + + P +I SMV
Sbjct  91   NPESTFYAVKRLIGRKYNDHETNKVKEVVSYKIVPGSNGKDAWVETKGQKYSPSQIGSMV  150

Query  91   LTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            L KM+E +++F+G+ V  AVITVPAYFNDSQRQATKDAG IAGL VLRIINEPTAAA+AY
Sbjct  151  LGKMKETADSFLGQSVSQAVITVPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAAALAY  210

Query  151  GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
            G+DK  G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  211  GMDKADG-KVIAVFDLGGGTFDVSILEISGGVFE  243

 Score = 191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 156/246 (63%), Gaps = 16/246 (7%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  395  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  449

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  450  QVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  509

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV+A +K+TGKE  I I +  G LS ADIERMV EAE   + D+  K  IE KN  ++ 
Sbjct  510  VNVAARDKATGKEQNIIIQSSGG-LSDADIERMVQEAEMNAAADQQRKEVIELKNDADSV  568

Query  364  AYNLRNTLND----------EKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAK  413
             Y+   TL +          E++++ + +   KA  D   EI   L+  Q S  +  EA 
Sbjct  569  IYSTEKTLKEFEDKIEATLAEQVKTDLADLKSKAEGDSADEIKAALEKVQQSSLKIGEAV  628

Query  414  QKELEG  419
             K  +G
Sbjct  629  YKAQQG  634

>PYIR_19697
Length=608

 Score = 191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 158/248 (64%), Gaps = 15/248 (6%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  347  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  401

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  402  QVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  461

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV+A +K+TGKE  I I +  G LS ++IERMV EAE     D+  K  IE KN  ++ 
Sbjct  462  VNVAARDKATGKEQNIVIQSSGG-LSDSEIERMVQEAEMNAEADQKRKELIETKNEADSV  520

Query  364  AYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIA  421
            AY    TL  ++EKL  +  E  +  ++       N     +    EE +A  +E++ ++
Sbjct  521  AYTTEKTLKEHEEKLDKETVEQVKAGLE-------NLRSKAEGENAEEIKAALEEVQKLS  573

Query  422  NPILQKMY  429
              I + +Y
Sbjct  574  LKIGEAVY  581

 Score = 176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 119/189 (63%), Gaps = 36/189 (19%)

Query  31   IIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAENTI-------------------  70
            +I N +G RTTPS VA  D+ ERL+G  AK Q   N ENT                    
Sbjct  8    VIENSEGARTTPSVVAILDNDERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  71   --TVTFK-------------GESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPA  115
               V++K              + K + P +I SMVLTKM+E ++ F+GK +  AV+TVPA
Sbjct  68   SKVVSYKIVAGPNGKDAWVEAKGKKYSPSQIGSMVLTKMKETADGFLGKTITQAVVTVPA  127

Query  116  YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSL  175
            YFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFDVS+
Sbjct  128  YFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSI  186

Query  176  LSIEEGIFE  184
            L I  G+FE
Sbjct  187  LEISGGVFE  195

>PYIW_17145
Length=443

 Score = 186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 138/201 (69%), Gaps = 8/201 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LI RNTT+PTKK+
Sbjct  184  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLITRNTTIPTKKS  238

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+V+FDIDANGI
Sbjct  239  QVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVSFDIDANGI  298

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENY  363
            +NV+A +K+TGKE  I I +  G LS ++IERMV EAE     D   K  IEAKN  ++ 
Sbjct  299  VNVAARDKATGKEQNIVIQSSGG-LSDSEIERMVQEAEMNAEADLKRKELIEAKNEADSV  357

Query  364  AYNLRNTL--NDEKLQSQIPE  382
            AY    TL  ++EKL  +  E
Sbjct  358  AYTTEKTLKEHEEKLDKETVE  378

 Score = 41.6 bits (96),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 1/33 (3%)

Query  152  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFE  184
            +DK  G + + +FDLGGGTFDVS+L I  G+FE
Sbjct  1    MDKADG-KVIAVFDLGGGTFDVSILEISGGVFE  32

>PYAR_22188
Length=634

 Score = 187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 164/273 (60%), Gaps = 40/273 (15%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +Q  +L G+     ++D+LLLDVTPLS G+ET GGV T LIPRNTT+PTKK+
Sbjct  347  EVVAMGAAIQGGVLRGD-----VKDILLLDVTPLSLGIETLGGVFTKLIPRNTTIPTKKS  401

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            Q FST AD+Q  V I+V +GER M  DN  LG F+L GIPP PRGVPQI+VTFDIDANGI
Sbjct  402  QVFSTAADSQTQVGIKVLQGEREMAADNKSLGNFDLVGIPPAPRGVPQIEVTFDIDANGI  461

Query  304  LNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAE-------KYKS-----------  345
            +NVSA +KSTGKE  I I +  G LS ADIERMV EAE       K K+           
Sbjct  462  VNVSARDKSTGKEQSIVIQSSGG-LSDADIERMVQEAEMNAEADQKRKALIXXXXERMVQ  520

Query  346  -------EDEANKIRIEAKNGLENYAYNLRNTL--NDEKLQSQIPEDDRKAIDDKVTEII  396
                    D+  K  IEAKN  ++ AY+   +L  +++K+ ++  E  + AI        
Sbjct  521  EAEMNAEADQKRKALIEAKNEADSVAYSTEKSLKEHEDKIDAETSETVKTAIQ-------  573

Query  397  NWLDAHQASEKEEFEAKQKELEGIANPILQKMY  429
            N     +  + E  +A  +E++ +A  I + +Y
Sbjct  574  NLRTQAEGEDAEAIKAAVEEVQKLAMKIGEAVY  606

 Score = 176 bits (447),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 126/209 (60%), Gaps = 39/209 (19%)

Query  31   IIANDQGNRTTPSYVAFTDSE-RLIGDAAKNQVAMNAENTI-------------------  70
            +I N +G RTTPS VA  D+E RL+G  AK Q   N ENT                    
Sbjct  8    VIENAEGARTTPSVVAILDNEERLVGMPAKRQAVTNPENTFYAVKRLIGRKFQDKETQEV  67

Query  71   --TVTFK-------------GESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPA  115
               V++K              + K + P +I SMVLTKM+E ++ F+GK +  AV+TVPA
Sbjct  68   SKVVSYKIVAGPNGKDAWVEAKGKKYSPSQIGSMVLTKMKETADGFLGKPITQAVVTVPA  127

Query  116  YFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSL  175
            YFNDSQRQATKDAG IAGL+VLRIINEPTAAA+AYG+DK  G + + +FDLGGGTFDVS+
Sbjct  128  YFNDSQRQATKDAGKIAGLDVLRIINEPTAAALAYGMDKADG-KVIAVFDLGGGTFDVSI  186

Query  176  LSIEEGIFEAVAFGATVQAAILSGNDQSE  204
            L I  G+FE     AT    +L G D  E
Sbjct  187  LEISGGVFE---VKATNGDTLLGGEDFDE  212

>PYAR_19930
Length=625

 Score = 180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 5/180 (3%)

Query  184  EAVAFGATVQAAILSG--NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            EAVA+GA VQ AILSG  ND +     LLL+DVTPLS G+ET G VM+VLI RNT +P +
Sbjct  449  EAVAYGAAVQGAILSGIRNDATN---SLLLVDVTPLSLGIETVGKVMSVLIKRNTAIPVR  505

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
            KT+ ++T  D Q  V + ++EGER+    NN LG+FN+ GI    RG PQ++VTF+IDAN
Sbjct  506  KTRVYTTEEDYQTSVDVCIYEGERAHVDSNNKLGEFNISGIERAKRGEPQVEVTFEIDAN  565

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            GILNVSA +K TG   + TI+N++GRL+Q DI+RMV++AEK+K +D     +IEA+N LE
Sbjct  566  GILNVSARDKKTGARAETTISNNRGRLTQEDIDRMVSDAEKFKKDDAELLRKIEARNELE  625

 Score = 175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/264 (43%), Positives = 140/264 (53%), Gaps = 59/264 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GIDLGTTYSCVGVW++ +VEIIAN +GNRTTPS+VAF D ERLIG+AAK Q A N  NT
Sbjct  173  IGIDLGTTYSCVGVWKDGQVEIIANSEGNRTTPSWVAFNDQERLIGEAAKIQAASNPTNT  232

Query  70   ITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAG  129
                                                                RQ+TKDAG
Sbjct  233  ----------------------------------------------------RQSTKDAG  240

Query  130  AIAGLNVLRIINEPTAAAIAYGLDKKGGER----NVLIFDLGGGTFDVSLLSIEEGIFEA  185
            AIAGL+V RIINEPTAAA+AYGLD   G+     NVLIFDLGGGTFDVS+LSIE GIFE 
Sbjct  241  AIAGLDVKRIINEPTAAALAYGLDTNAGQSGAGVNVLIFDLGGGTFDVSILSIENGIFEV  300

Query  186  VAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQT  245
             + G       L G D    L D L+ +    ++GL+  G    +   R      K+  +
Sbjct  301  KSTGGDTH---LGGEDFDSNLVDFLVTEFKRKNKGLDPTGSARAMRRLRTACESAKRMLS  357

Query  246  FSTYADNQPGVLIQVFEGERSMTR  269
             +T A  +   L +  +   ++TR
Sbjct  358  TTTSAAVEVDSLFEGVDFSSTLTR  381

>PHYRA_51904
Length=129

 Score = 159 bits (401),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 86/127 (68%), Gaps = 37/127 (29%)

Query  6    TGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN  65
            +G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAMN
Sbjct  3    SGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMN  62

Query  66   AENT-------------------------------------ITVTFKGESKTFQPEEISS  88
            A NT                                     ITV FKGESKTFQPEEISS
Sbjct  63   AHNTVFDAKRLIGRKFSDPIVQADIKHWPFKLTSGAGDKPQITVQFKGESKTFQPEEISS  122

Query  89   MVLTKMR  95
            MVL KMR
Sbjct  123  MVLIKMR  129

>PHYSO_525429
Length=610

 Score = 168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 138/227 (61%), Gaps = 45/227 (20%)

Query  14   LGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTITVT  73
            + TT   VGVW N+ V ++ +D   R  PS+VAFTD+ERL+GD AK QVA N  NT+  T
Sbjct  1    MRTTCLRVGVWVNNNVAVLTSD---RPLPSFVAFTDTERLVGDVAKRQVATNVNNTVFGT  57

Query  74   ---------------------FK----------------GESKTFQPEEISSMVLTKMRE  96
                                 FK                G++KTF+P EI +M+L + RE
Sbjct  58   TRLIGRKFSDLEVQEDLKHWPFKVVGGPNDGPLVEVQAAGQTKTFRPVEILAMLLAEARE  117

Query  97   VSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK--  154
              E  +GK V+NAV+TVPA FN +QRQA KDAGA+AGLNV R+I+  TAAAIA+GL+   
Sbjct  118  TVETHLGKRVENAVVTVPASFNYAQRQAIKDAGAVAGLNVARLISASTAAAIAHGLENKT  177

Query  155  KGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            K G+RN+L+ DLGGGT DVSL++IEE I+E +   AT   A L G D
Sbjct  178  KAGQRNLLVLDLGGGTLDVSLVAIEEEIYEVL---ATAGNAHLGGED  221

 Score = 132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 145/237 (61%), Gaps = 17/237 (7%)

Query  188  FGATVQAAILSGNDQSEK-lqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTF  246
             GAT+ AA+L+      K L++ +LLDVTPLS G++      +V+IPR+TT+PT+KT+TF
Sbjct  362  LGATMHAAMLTDELSVIKPLEEFMLLDVTPLSLGVKIDDTNTSVMIPRSTTIPTRKTRTF  421

Query  247  STYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNV  306
            ST  DNQ  V I++ EGE     DN ++GK   DG+P  PRG  +I+VT ++DANG + V
Sbjct  422  STSQDNQSVVQIELLEGEDG---DNRVIGKLKGDGLPLEPRGEFKIEVTVEVDANGCITV  478

Query  307  SAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYN  366
               ++STG+  K+ ++ D   LS  +I+RM     K     +A+KI       LENYA +
Sbjct  479  LIADESTGQSKKLEVSGDC--LSALEIDRMRKSVMK-----DASKIE------LENYANS  525

Query  367  LRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGIANP  423
            +R+T      + +   ++ +A++++ TE ++WL+ + +  + + + K+++LE  A P
Sbjct  526  VRSTAAKRIAELKRSIEEMQAVEEQATETLHWLNRNHSVGRADIDVKRRKLEEAATP  582

>H310_10060
Length=187

 Score = 155 bits (393),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 121/191 (63%), Gaps = 9/191 (5%)

Query  228  MTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  287
            M+VLI RNT +P KKT+ ++T AD Q  V + ++EGER+    NN LG+F + GI    R
Sbjct  1    MSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKR  60

Query  288  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSED  347
            G PQ++VTF+IDANGILNVSA +K T  + + TI+++ GRLSQ DI+RMVA+AEKYK +D
Sbjct  61   GEPQVEVTFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDD  120

Query  348  EANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEK  407
                 +IEA+N LE + Y          L+    + D  A ++ + E   WL+ H+ +  
Sbjct  121  AEVLRKIEARNNLEGFIYRA--------LEIAREKGD-AAAENTIREAREWLEDHEEATL  171

Query  408  EEFEAKQKELE  418
             E E K++ LE
Sbjct  172  RELEDKKRSLE  182

>H257_18082
Length=187

 Score = 155 bits (392),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 122/193 (63%), Gaps = 9/193 (5%)

Query  228  MTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR  287
            M+VLI RNT +P KKT+ ++T AD Q  V + ++EGER+    NN LG+F + GI    R
Sbjct  1    MSVLIKRNTAIPVKKTRVYTTEADYQTQVNVVIYEGERACVDHNNKLGEFTISGIERAKR  60

Query  288  GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSED  347
            G PQ++VTF+IDANGILNVSA +K T  + + TI+++ GRLSQ DI+RMVA+AEKYK +D
Sbjct  61   GEPQVEVTFEIDANGILNVSAKDKKTHAKAETTISSNGGRLSQEDIDRMVADAEKYKKDD  120

Query  348  EANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEK  407
                 +IEA+N LE + Y     +  EK  SQ         ++ + E   WL+ H+ +  
Sbjct  121  AEVLRKIEARNNLEGFIYRALE-IAREKGDSQ--------AENTIREAREWLEDHEEATL  171

Query  408  EEFEAKQKELEGI  420
             E E K++ LE +
Sbjct  172  RELEDKKRLLERL  184

>PHYSO_339666
Length=585

 Score = 162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 121/207 (58%), Gaps = 40/207 (19%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            VGIDLGTT S VGVW+N+RVE I N Q    TPSYVAFT++  L+G+AAK Q+  N ENT
Sbjct  5    VGIDLGTTGSRVGVWRNERVEFIPNRQQAYWTPSYVAFTETALLVGEAAKRQLTTNPENT  64

Query  70   I-----------------------------------TVTFKGESKTFQPEEISSMVLTKM  94
            +                                    V +KGE+K+F P EI +++L +M
Sbjct  65   VFDLTQFVGRKFSELRESVIDWPFKVECGPEDTPQVVVQYKGETKSFMPVEIMAILLYEM  124

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            R+++E ++ ++V  AV TVP  FN  QRQA KDAGAIAGL+V+R++N  T A I YG + 
Sbjct  125  RKIAEIYLDQEVTKAVFTVPGSFNYFQRQAMKDAGAIAGLDVIRLVNSATVACIEYGFNT  184

Query  155  ---KGGERNVLIFDLGGGT--FDVSLL  176
               + GE NVL+ D G  +  FD  L+
Sbjct  185  LVGRVGELNVLVVDYGASSLNFDSRLV  211

 Score = 134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/260 (37%), Positives = 153/260 (59%), Gaps = 11/260 (4%)

Query  171  FDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMT-  229
            F+  +LS+ +   EA AFG  VQ   L G   S KL + +LLD   L   +E    +M  
Sbjct  327  FNGKMLSLRQD--EAAAFGVAVQGDFLGGLP-SPKLDEYMLLDTASLEFSVEIDDCMMKE  383

Query  230  VLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGV  289
            V + +N+T+P +K++TF T   N+  + I+ FEGE +    N LL +F +DGI   P  +
Sbjct  384  VPVSKNSTLPMRKSRTFLTANANKSTMRIKAFEGEATTVATNRLLCEFEMDGITMTPGRL  443

Query  290  PQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEA  349
             +I+V  D+DANG L VSAVEKSTGKE KITI  +  RLS +++ERM +  E+   + E 
Sbjct  444  SEIEVAIDVDANGSLTVSAVEKSTGKEKKITI--NCSRLSTSEVERMHSNIEETFLDPE-  500

Query  350  NKIRIEAKNGLENYAYNLRNTLNDE--KLQSQIPEDDRKAIDDKVTEIINWLDAHQASEK  407
             ++RI++K  LE YA ++ ++      KL+  + ++    I+    E + WLD + +++K
Sbjct  501  EELRIQSKAVLERYANSVCSSAAKRIAKLKRSLAKE--YTIESSAMEALQWLDTNPSAKK  558

Query  408  EEFEAKQKELEGIANPILQK  427
            E F+AK+++L  +A P  Q+
Sbjct  559  EHFDAKRQKLGEMATPSGQR  578

>PYIR_24123
Length=567

 Score = 157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 126/217 (58%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E ++GD A N+++ +AENTI
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIVGDTAVNKLSSHAENTI  64

Query  71   ---------------------TVTFK----------------GESKTFQPEEISSMVLTK  93
                                   +FK                GE+    P E  S+++  
Sbjct  65   FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSEDGAVHAATSRNGEAHHVTPVEFVSLLIKN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ V N V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGESVDNVVLSIPAHVTEKQKELLQAAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  154  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
               K      VL+FD+GG T DV+L++ ++G+FE VA
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVA  221

 Score = 115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 97/156 (62%), Gaps = 4/156 (3%)

Query  184  EAVAFGATVQAAILS--GNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            E VA GAT++A++ +   N +S K     +  VTPL+  +  A G +  +I R+T +P  
Sbjct  367  EVVAHGATIEASLRADLANFESPKKALNHVN-VTPLTLSVALANGSVAEVIHRDTVLPAT  425

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
             T+TF+T  DNQ  + +QV+EGER M +DN LL   ++ GI P P+G  +I+VTF ++  
Sbjct  426  ATETFTTSQDNQTAIFLQVYEGERVMAKDNTLLASLSVAGIAPAPKGEAEIEVTFTVNTK  485

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
            G+L ++AVE++ GK+  + + ND  RL+  D+  ++
Sbjct  486  GVLTITAVEQAAGKKT-LEVKNDPKRLTAKDVADII  520

>PITG_05721
Length=302

 Score = 150 bits (379),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 97/135 (72%), Gaps = 4/135 (3%)

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +L K +  +   I    K + +TVPAYFNDSQ QATKDAGAIAGLNVLRIINEPTAAAIA
Sbjct  1    MLQKCKPTTHRKIKNKTKTSEVTVPAYFNDSQHQATKDAGAIAGLNVLRIINEPTAAAIA  60

Query  150  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdl  209
            YGLD+KGGE NVLIFDLGGGTFDVSLL+IE+GIFE     AT     L G D   ++ + 
Sbjct  61   YGLDEKGGENNVLIFDLGGGTFDVSLLTIEDGIFEV---KATAGDTHLGGGDFDNRMVEF  117

Query  210  llldVTPLSQGLETA  224
             + +V PL + L TA
Sbjct  118  FVTEVKPLHR-LRTA  131

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 43/49 (88%), Gaps = 0/49 (0%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLI  232
            EAVA+GATVQAAILSGN+ S KLQDLLLLDV PLS GLETAG VMT LI
Sbjct  232  EAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGSVMTKLI  280

>SPRG_11133
Length=676

 Score = 157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 128/234 (55%), Gaps = 37/234 (16%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MA       +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD+ RL+GD AK+
Sbjct  1    MAGGSQSVVIGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKS  60

Query  61   QVAMNAENT------------------------------ITVTFKGESKTFQPEEISSMV  90
            Q   NA NT                              I V  KGE+K   PEEI + +
Sbjct  61   QAPRNAPNTVFNIMRIIGRRYDEVRKKTQVVCGPKNNPMIRVVEKGETKELHPEEILAEL  120

Query  91   LTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            + K+++    +    +++AV+TVP  FN  QRQA +DA AIAGL   RI + PT AA+A+
Sbjct  121  VVKLKDDVVTYTNARIEHAVVTVPTGFNLLQRQAVRDACAIAGLAKYRISDAPTTAAVAH  180

Query  151  GLDKKGGER---NVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
                KG  R   + ++ D+GGG   VSLL+IE+GIFE  A       A L G D
Sbjct  181  -TSIKGAPRCEVHDMVVDMGGGHLSVSLLAIEDGIFEVKAVAGD---ACLGGED  230

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 50/90 (56%), Gaps = 4/90 (4%)

Query  184  EAVAFGATVQAAILSGNDQ-SEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EA A GATV AA+   ND+ S     LL+L V P S G+ET GGVMT LI RNTT+P+KK
Sbjct  370  EAAAHGATVMAAL---NDETSPDDMHLLVLHVVPYSVGIETGGGVMTTLISRNTTIPSKK  426

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNN  272
            ++ F       P      F      T D++
Sbjct  427  SEKFKISQPQSPPYHPTPFSYRDECTCDDS  456

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 29/171 (17%)

Query  258  IQVFEGERSMTRDNNLLGKFNLDGI-PPMPRGVPQIDVTFDIDANGILN-VSAVEKSTGK  315
            I++F GERSM RDN  L    + G   P  R     DV FDID +G+L  +       G 
Sbjct  523  IKIFTGERSMVRDNTPLHTIAIHGFYDPTARS----DVAFDIDGDGLLTAIVTYTPHIGT  578

Query  316  ENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEK  375
               I +  DKG LSQ D++R+    E   + D+  + R+ A   L+ Y            
Sbjct  579  NETIVVKLDKGYLSQHDVKRLTTNFE--AAADDRTRRRV-AHEELQTYL-----------  624

Query  376  LQSQIPEDDRKAIDDKVTEIINWLDA-----HQASEKEEFEAKQKELEGIA  421
            +  + P    +A D    E++ WLD      H  +   E +AK +   G A
Sbjct  625  IGGKYPY--WRAAD--AAEVLEWLDTISLGRHIKASVCEIQAKYRIFLGPA  671

>H310_12765
Length=560

 Score = 155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 126/217 (58%), Gaps = 37/217 (17%)

Query  8    ASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAE  67
            AS+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA 
Sbjct  2    ASIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCMVSFASDDVVVGDSAVAKLHNNAA  61

Query  68   NTI----TVTFKGE-------------------------------SKTFQPEEISSMVLT  92
            NT+     V  K                                 S+     E  ++VL 
Sbjct  62   NTVYHLKRVLGKKHKDVHAHEYVKDWSFDLAADKHGAPIAKILDGSRDIHAVEFCTIVLR  121

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            K++ ++E + G  VKN+V+TVP  ++D Q+   ++A + A LNVLR I+EP AAAIAYGL
Sbjct  122  KLKALAEDYTGSSVKNSVLTVPEGYSDEQKALLQEAASAADLNVLRYISEPIAAAIAYGL  181

Query  153  --DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
              DKK   +  ++ D+GG + D++LLS+++G+F  +A
Sbjct  182  DEDKKNESKLAVVVDIGGASTDLTLLSVDKGLFNVIA  218

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 81/147 (55%), Gaps = 2/147 (1%)

Query  184  EAVAFGATVQAAILSGN-DQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGATV++  LS   D +     L  ++  PL+  L  A G +  +I R T +P   
Sbjct  365  EAVAFGATVESGTLSETADWTLPEDPLNNVEAVPLNLSLGLADGTVYDMIHRGTILPANH  424

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
             + F+T  DNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F +   G
Sbjct  425  QEVFTTQVDNQHAVYLQVYEGQRVLKKDNTLLANLTLTGIPPAPKGESEVEVSFTVTRKG  484

Query  303  ILNVSA-VEKSTGKENKITITNDKGRL  328
             L V A V  + G    + + +D  R+
Sbjct  485  QLTVKAHVRNAEGGSKALVVASDSKRV  511

>PHYRA_71591
Length=570

 Score = 155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 122/217 (56%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +AENTI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   -------------------------TVTF------------KGESKTFQPEEISSMVLTK  93
                                      VT              GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVSDRDYVKEWPFNVTAGADGVAQAETQRNGEKHPVTPVEFMALLLQN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            ++E++E F G+ +++ VI  PA+ ++S  +    A A AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGEKLEHVVINKPAHTDESYTELLDAAAAKAGVNVLTYLSEPLAAAIAYGLD  184

Query  154  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            +         VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  185  EASNNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVA  221

 Score = 105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 97/157 (62%), Gaps = 6/157 (4%)

Query  184  EAVAFGATVQA---AILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPT  240
            EAVAFGAT++A   A L G  + +K  +L+   V PL+  +  A G ++ LI R+T +P 
Sbjct  367  EAVAFGATIEASGLAELVGVPEPKKPLNLVN--VVPLNLSVALANGSVSELIQRDTVLPA  424

Query  241  KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  300
              T+ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P  +G  +I+V F +  
Sbjct  425  TATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPKAKGEVEIEVDFTVST  484

Query  301  NGILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
             G+L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  485  KGVLTVTASERKAGKKS-LEVTQDSKRLTPADVAAIV  520

>PYAP_16216
Length=564

 Score = 154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/231 (37%), Positives = 126/231 (55%), Gaps = 49/231 (21%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+G+T+ CVGVWQN +V IIANDQG RTTP++V F   E ++GD A N++  +A NT+
Sbjct  5    GIDIGSTHGCVGVWQNGKVNIIANDQGFRTTPAFVCFEGEEVIVGDTAVNKLHSHAANTV  64

Query  71   -------------------------------------TVTFKGESKTFQPEEISSMVLTK  93
                                                      GE+    P +  S+++  
Sbjct  65   FHLKRVLGKNHEEIASRDFVSEWSFELTKGADGLAVAKTARNGEAHEVSPVDFVSILIKN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ V + VI +PA+  +SQ++  + A   AG+NV+  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGETVDSIVINIPAHAGESQKELIRAAATKAGVNVMSYLSEPLAAAIAYGLD  184

Query  154  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
               K       L+FD+GG T DV+LLS+++G+FE VA          SGND
Sbjct  185  ENTKNSHAEYALVFDIGGATHDVTLLSVDKGLFEIVA---------TSGND  226

 Score = 117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 95/155 (61%), Gaps = 2/155 (1%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            E VA GAT++AA +       E       ++VTPL+  +  A G ++ +I R+T +PT  
Sbjct  367  EVVAHGATLEAAAIGDIAALGEPKSAQNDVNVTPLTLSVALANGSVSEVIHRDTVLPTSA  426

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            T+ F+T  DNQ  + IQV+EGER M +DN LL +  + GI P+P+G  +I+VTF I + G
Sbjct  427  TEVFTTSVDNQDSIFIQVYEGERVMAKDNTLLAQLKVTGISPLPKGEAEIEVTFAISSKG  486

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
            +L V+A E S GK+  + + ND  RL+ AD+  ++
Sbjct  487  VLTVTANEASAGKKT-LEVKNDAKRLTAADVAAVI  520

>PYU1_G006940
Length=565

 Score = 154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 125/217 (58%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +AENTI
Sbjct  5    GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLHSHAENTI  64

Query  71   ---------------------TVTFK----------------GESKTFQPEEISSMVLTK  93
                                   +FK                GE     P E  S+++  
Sbjct  65   FHLKRVLGKNHEDVVDHDYIQEWSFKVSKADDGAVHAATSRNGEPHHVTPVEFVSLLIKN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ V + V+++PA+  + Q++  ++A   AG+NVL  I+EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEAVDSVVLSIPAHATEKQKELLQEAADKAGVNVLTFISEPLAAAIAYGLD  184

Query  154  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
               K      VL+FD+GG T DV+L++ ++G+FE VA
Sbjct  185  DSAKSAHPEYVLVFDIGGATHDVTLINADKGLFEIVA  221

 Score = 117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 97/156 (62%), Gaps = 4/156 (3%)

Query  184  EAVAFGATVQAAILS--GNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
            E VA GATV+A++ +   N ++ K     +  VTPL+  +  A G +T LI R T +P  
Sbjct  367  EVVAHGATVEASLRADLANFEAPKKALDNVN-VTPLTLSVALANGSVTELIHRETVLPAT  425

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
             T+TF+T  DNQ  + +Q++EGER M +DN LL    + GI P P+G  +I+VTF ++  
Sbjct  426  ATETFTTSQDNQTAIFLQIYEGERVMAKDNTLLASLAVSGIAPAPKGEAEIEVTFAVNTK  485

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
            G L ++AVE++ GK+  + ++ND  RLS AD+  ++
Sbjct  486  GALTITAVEQTAGKKT-LEVSNDPKRLSAADVAVII  520

>PHYSO_552116
Length=570

 Score = 154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 121/217 (56%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +AENTI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHAENTI  64

Query  71   TVTFK-------------------------------------GESKTFQPEEISSMVLTK  93
                +                                     GE     P E  +++L  
Sbjct  65   FHLKRLLGKAHADVADRDFVKEWPFDITAGADGVAQAETQRNGEKHPVSPVEFMALLLQN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ +++ VI+ PA+ +DS  +    A   AG+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVISKPAHTDDSYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLD  184

Query  154  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            +         VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  185  EAANNAKPEYVLVFDIGGATHDVTLLNADKGLFEVVA  221

 Score = 105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 107/185 (58%), Gaps = 6/185 (3%)

Query  156  GGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQA---AILSGNDQSEKlqdllll  212
            G  R  L+ +L    FD   +  +    EAVA+GAT++    A L G    +   +++  
Sbjct  339  GSTRIPLVQNLVKKFFDGKNVHTQLSPDEAVAYGATIEGSGLAELVGVPAPKNPLNMVN-  397

Query  213  dVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNN  272
             V PL+  +  A G ++ LI R+T +P   T+ F+T  DNQ  V +Q++EG+R M +DN 
Sbjct  398  -VVPLNLSVALANGSVSELIQRDTVLPATATELFTTSEDNQEAVYLQIYEGQRLMAKDNT  456

Query  273  LLGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQAD  332
            L+ + ++ GI P+P+G  +I+VTF +   G+L V+A E+  GK++ + +T D  RL+ AD
Sbjct  457  LVAQLSVAGITPLPKGDAEIEVTFTVSTKGVLTVTASERKAGKKS-LEVTQDSKRLTPAD  515

Query  333  IERMV  337
            +  +V
Sbjct  516  VAAIV  520

>HYAP_01511
Length=206

 Score = 144 bits (363),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 78/90 (87%), Gaps = 3/90 (3%)

Query  214  VTPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNL  273
            VTPLS GLETAGGVMT+LI  N T+ TKK+QTFS   DN PGVLI VF+G+R MTR+NNL
Sbjct  88   VTPLSLGLETAGGVMTILITCNKTMTTKKSQTFS---DNHPGVLIYVFKGKRYMTRNNNL  144

Query  274  LGKFNLDGIPPMPRGVPQIDVTFDIDANGI  303
            LGKFNL+ IPPMPRGVPQ++V+FDIDANGI
Sbjct  145  LGKFNLNDIPPMPRGVPQVNVSFDIDANGI  174

>PPTG_10122
Length=569

 Score = 152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 119/216 (55%), Gaps = 39/216 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A+NTI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   ------------------------------------TVTFKGESKTFQPEEISSMVLTKM  94
                                                     GE     P E  +++L  +
Sbjct  65   FHLKRLLGKAHADVKDRDFVKEWPFDVTQGAEGAQVETQRSGEKHPVTPVEFMAVLLQNL  124

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E++E F G+ +++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD+
Sbjct  125  KELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKKAGVNVLTYLSEPLAAAIAYGLDE  184

Query  155  KGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
                     VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  185  AANNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVA  220

 Score = 113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 111/183 (61%), Gaps = 2/183 (1%)

Query  156  GGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSG-NDQSEKlqdlllldV  214
            G  R  L+ +L    FD   +  +    EAVA+GAT++A+ L+   D  E  + L +++V
Sbjct  338  GSTRIPLVQNLVKKYFDGKNVRTQMSPDEAVAYGATIEASGLAELVDVPEPEKPLNMVNV  397

Query  215  TPLSQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLL  274
             PL+  +  A G ++ LI R+T +P   T+ F+T  DNQ  V +Q++EG+R M +DN L+
Sbjct  398  VPLNLSVALANGSVSELIQRDTILPATATELFTTSEDNQEAVFLQIYEGQRLMAKDNTLV  457

Query  275  GKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIE  334
             + ++ GI P+P+G  +I+V F +   G+L V+A E+  GK++ + +T+D  RL+ AD+ 
Sbjct  458  AQLSVSGITPLPKGDAEIEVIFTVSTKGVLTVTASERKAGKKS-LEVTHDSKRLTPADVA  516

Query  335  RMV  337
             +V
Sbjct  517  AIV  519

>PITG_03546
Length=569

 Score = 151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 119/216 (55%), Gaps = 39/216 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A+NTI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   ------------------------------------TVTFKGESKTFQPEEISSMVLTKM  94
                                                     GE     P E  +++L  +
Sbjct  65   FHLNRILGKAHADIKDRDFVKEWPFDVTQGSEGAQVETQRNGEKHPVTPVEFMAVLLQNL  124

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDK  154
            +E++E F G+ +++ VI+ PA+ +D   +    A   AG+NVL  ++EP AAAIAYGLD+
Sbjct  125  KELAEDFTGEKLEHVVISKPAHTDDKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGLDE  184

Query  155  KGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
                     VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  185  ATSNEKPEYVLVFDIGGATHDVTLLNADKGLFEVVA  220

 Score = 114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 101/155 (65%), Gaps = 2/155 (1%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGAT++A+ L+   D  E  + L +++V PL+  +  A G ++ LI R+T +P   
Sbjct  366  EAVAFGATIEASGLAELVDVPEPEKPLNMVNVVPLNLSVALANGSVSELIQRDTILPATA  425

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            T+ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P P+G  +I+VTF + + G
Sbjct  426  TELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPQPKGDAEIEVTFTVSSKG  485

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
            +L V+A E+  GK++ + +T D  RL+ AD+  +V
Sbjct  486  VLTVTAAERKAGKKS-LEVTQDSKRLTPADVAAIV  519

>PYIW_19165
Length=1124

 Score = 153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 126/217 (58%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+G+T+ CVGV+ N +V IIANDQG RTTP+YV F   E +IGD A N++  +AENTI
Sbjct  585  GIDIGSTHGCVGVFHNGKVNIIANDQGFRTTPAYVTFEGDEVIIGDTAVNKLTSHAENTI  644

Query  71   ---------------------TVTFK----------------GESKTFQPEEISSMVLTK  93
                                   +FK                G++    P E  S+++  
Sbjct  645  FHLKRVLGKNHEEIVDRDYIQEWSFKVAKSDDGAVHAATSRNGDAHHVTPVEFVSLLIKN  704

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ V + V+++PA+  + Q++  + A   AG+NVL  I+EP AAAIAYGLD
Sbjct  705  LKDLAEDFTGETVDDVVLSIPAHATEKQKELLQAAADKAGVNVLTFISEPIAAAIAYGLD  764

Query  154  ---KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
               K     +VL+FD+GG T DV+L++ ++G+FE VA
Sbjct  765  DSAKGSHPESVLVFDIGGATHDVTLINADQGLFEIVA  801

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/156 (31%), Positives = 82/156 (53%), Gaps = 27/156 (17%)

Query  184   EAVAFGATVQAAILS--GNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTK  241
             E VA GAT++A++ +   N +S K     +  VTPL+  +  A G               
Sbjct  947   EVVAHGATIEASLRADIANFESPKKPLNHVN-VTPLTLSVALANG---------------  990

Query  242   KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
                     +DNQ  + +QV+EGER M +DN LL   ++ GI   P+   +I+VTF +   
Sbjct  991   --------SDNQTAIFLQVYEGERVMAKDNTLLASLSVTGIAAAPKSEAEIEVTFTVSTK  1042

Query  302   GILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
             G+L+++AVE++ G +  + + +D  RL+ AD+  ++
Sbjct  1043  GVLSITAVEQAAGTKT-LEVKSDPKRLTAADVAAII  1077

>HYAP_01538
Length=130

 Score = 138 bits (347),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 64/70 (91%), Positives = 68/70 (97%), Gaps = 0/70 (0%)

Query  1   MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
           MAQ+V+G SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTD+ERLIGDAAKN
Sbjct  1   MAQTVSGYSVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN  60

Query  61  QVAMNAENTI  70
           QVAMNA NT+
Sbjct  61  QVAMNAHNTV  70

>HYAP_01993
Length=569

 Score = 149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 119/217 (55%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVWQN +V IIANDQG RTTP+YV F   E ++GD A N++A +A+NTI
Sbjct  5    GIDIGTTHGCVGVWQNGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKLASHADNTI  64

Query  71   TVTFK-------------------------------------GESKTFQPEEISSMVLTK  93
                +                                     GE     P E   ++L  
Sbjct  65   FHLKRLLGKAHADVKDREFVKEWPFGVTEGADGVAQAETQRNGEKHAVDPVEFMMLLLQN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +++++E F G+ +++ VI  PA+ ++   +    A    G+NVL  ++EP AAAIAYGLD
Sbjct  125  LKDLAEDFTGEKLEHVVINKPAHTDEKYTELLDAAAKKVGVNVLTYLSEPLAAAIAYGLD  184

Query  154  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            +         VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  185  EAANNDKPEFVLVFDIGGATHDVTLLNADKGLFEVVA  221

 Score = 117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 104/165 (63%), Gaps = 2/165 (1%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqd-lllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGAT++A+ L+    SE     L +++V PL+  +  A G ++ LI R+T +P   
Sbjct  367  EAVAFGATIEASCLAELLGSEAPAKPLNMVNVVPLTLSVALANGSVSELIQRDTILPASA  426

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            T+ F+T +DNQ    +Q++EG+R M +DN L+ + ++ GI P+P+G  +IDVTF +   G
Sbjct  427  TEVFTTSSDNQEAAFLQIYEGQRLMAKDNTLVAQLSVAGITPLPKGDAEIDVTFTVSTKG  486

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSED  347
            +L V+A E+  G ++ + + +D  RL+ AD+  +V +A+    ED
Sbjct  487  VLTVTASERKAGSKS-LEVMHDSTRLTPADVAAVVKKADDAADED  530

>PHALS_00390
Length=569

 Score = 149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 124/217 (57%), Gaps = 41/217 (19%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A+NTI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADNTI  64

Query  71   T--------------------------------VTFK----GESKTFQPEEISSMVLTKM  94
                                             VT +    GE     P E  +++L  +
Sbjct  65   FHLKRLLGKNHDEIKDRNFVKEWSFSVAQNAEGVTVETQRNGEKHHVTPVEFMALLLQNL  124

Query  95   REVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAI-AGLNVLRIINEPTAAAIAYGLD  153
            +E++E F G+ +++ VI+ PA+  DS+     DA A  AG+NVL  ++EP AAAIAYG D
Sbjct  125  KELAEDFTGEKLEHVVISKPAH-TDSRYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGFD  183

Query  154  KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            +         VL+FD+GG T DV+LL++++G+F+ VA
Sbjct  184  EAVNNEKPEYVLVFDIGGATHDVTLLNVDKGLFQVVA  220

 Score = 114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 101/166 (61%), Gaps = 2/166 (1%)

Query  184  EAVAFGATVQAAIL-SGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGAT++A+ L      S+ ++ + ++++ PL+  L  A G +  LI R T +P   
Sbjct  366  EAVAFGATIEASCLVELVGVSKPIEPVNMVNMVPLNLSLALANGSVAELIHRETILPATV  425

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            T+ F+T  DNQ  V +Q++EG+R M +DN L+ +  + GI P+P+G   I+VTF +   G
Sbjct  426  TEIFTTSCDNQETVYLQIYEGQRIMAKDNTLVAQLKVSGITPLPKGDAAIEVTFTVSTKG  485

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDE  348
            +L V+A E+  G ++ I +T D  RL+ AD+  +V  AE    ED+
Sbjct  486  VLTVTASERMAGTKS-IQVTQDSKRLTPADVAAIVKNAEDAADEDD  530

>H257_07650
Length=563

 Score = 148 bits (373),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 126/217 (58%), Gaps = 37/217 (17%)

Query  8    ASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAE  67
            AS+GIDLGTT++CVGVW N +V +IANDQG RTTP  V+F   + ++GD+A  ++  NA 
Sbjct  2    ASIGIDLGTTHACVGVWANGKVSVIANDQGFRTTPCIVSFASDDVVVGDSAVAKLHNNAA  61

Query  68   NTI----TVTFKGE-------------------------------SKTFQPEEISSMVLT  92
            NT+     V  K                                 S+     E  ++VL 
Sbjct  62   NTVYHLKRVLGKKHKEVHEHDYVKDWSFDLAADTHGAPIAKILDGSRDISSVEFCTIVLR  121

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
            K++ ++E + G  VKNAV+TVP  ++D Q+   ++A   A L+VLR I+EP AAAIAYGL
Sbjct  122  KLKALAEDYTGVVVKNAVLTVPEGYSDEQKALLEEAATAADLSVLRYISEPIAAAIAYGL  181

Query  153  --DKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
              DKK   + V++ D+GG + D++LLSI++G+F  +A
Sbjct  182  DEDKKNESKLVVVVDIGGASTDLTLLSIDKGLFNVIA  218

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 74/126 (59%), Gaps = 1/126 (1%)

Query  184  EAVAFGATVQAAILSGN-DQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAVAFGATV++A LS   D +        ++  PL+  L  A G +  +I R T +P   
Sbjct  365  EAVAFGATVESATLSETADWTLPTDPHNNVEAVPLTLSLGLADGTVYEMIHRGTVLPANV  424

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
             + F+T ADNQ  V +QV+EG+R + +DN LL    L GIPP P+G  +++V+F++   G
Sbjct  425  QEVFTTNADNQDAVYLQVYEGQRVLKKDNTLLANLTLSGIPPAPKGESEVEVSFNVTRKG  484

Query  303  ILNVSA  308
             L V A
Sbjct  485  QLTVKA  490

>PHYCA_532207
Length=1118

 Score = 148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 121/218 (56%), Gaps = 40/218 (18%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID+GTT+ CVGVW N +V +IANDQG RTTP+YV F   E ++GD A N++  +A+NT
Sbjct  552  IGIDIGTTHGCVGVWHNGKVNVIANDQGFRTTPTYVCFEGEEVIVGDTAVNKLPSHADNT  611

Query  70   ITVTFK-------------------------------------GESKTFQPEEISSMVLT  92
            I    +                                     GE     P E  +++L 
Sbjct  612  IFHLKRLLGKAHDEIKDRDFVKEWPFDVTEGAEGVAQAETKRNGEKHPVTPVEFMTLLLQ  671

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
             +++++E F G+ +++ VI+ PA+ ++   +    A   AG+NVL  ++EP AAAIAYGL
Sbjct  672  NLKDLAEDFTGEKLEHVVISKPAHTDEKYTELLDAAAKQAGVNVLTYLSEPLAAAIAYGL  731

Query  153  DKKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            D+         VL+FD+GG T DV+LL+ ++G+FE VA
Sbjct  732  DEAANNDKPEYVLVFDIGGATHDVTLLNADKGLFEVVA  769

 Score = 108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 99/155 (64%), Gaps = 2/155 (1%)

Query  184   EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
             EAVA+GAT++A+ L+   D  E  + L +++V PL+  +  A G ++ LI R+T +P   
Sbjct  915   EAVAYGATIEASGLAELVDVPEPKKPLNMVNVVPLNLSVALANGSVSELIQRDTILPATA  974

Query  243   TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
             T+ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GI P+P+G  +I+VTF +   G
Sbjct  975   TELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVSGITPLPKGDAEIEVTFTVSTKG  1034

Query  303   ILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
             +L V+A E+  G ++ + +  D  RL+ AD+  +V
Sbjct  1035  VLTVTASERKAGNKS-LEVAQDAKRLTPADVAAIV  1068

>SPRG_15695
Length=581

 Score = 145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 122/222 (55%), Gaps = 39/222 (18%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVA  63
            S+  A +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++ 
Sbjct  24   SLNMACIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLH  83

Query  64   MNAENTI-------------------------------------TVTFKGESKTFQPEEI  86
             NA NT+                                      VT K   +     E 
Sbjct  84   NNAANTVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKREISATEF  143

Query  87   SSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            +S+VL K++ ++E + G  VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AA
Sbjct  144  ASLVLGKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAA  203

Query  147  AIAYGLD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            AIAYG D  K    + +++ D+GG + D+SLLS ++G+F  V
Sbjct  204  AIAYGFDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVV  245

 Score = 104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 86/149 (58%), Gaps = 4/149 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldV--TPLSQGLETAGGVMTVLIPRNTTVPTK  241
            E +A+GATV+AA LS   + + L    L  V   PL+  L  A G +  +I RNT +P  
Sbjct  382  EVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVLPAT  441

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
              + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++   
Sbjct  442  TQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNVTRK  501

Query  302  GILNVSAVEKST--GKENKITITNDKGRL  328
             +L V A  ++    K   +T+ +D  R+
Sbjct  502  SVLTVKAHLRNAEGAKSKALTVESDSKRV  530

>PYU1_G002895
Length=561

 Score = 145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 131/228 (57%), Gaps = 47/228 (21%)

Query  7    GASVGIDLGTTYSCVGVWQNDR--VEII--ANDQGNRTTPSYVAFTDS------------  50
            G  +GIDLGTT SC+G+W  +R  V+I+  A D+  RTTPS V F  +            
Sbjct  21   GLCIGIDLGTTNSCIGMWHVERNHVKILKSAKDR-KRTTPSVVRFDPASEHAYEVGHAAI  79

Query  51   --------------ERLIGDAAKNQVAMNAEN----TITVTFKGESKT----------FQ  82
                          +RL+G    ++    A++    T+  T +G +             Q
Sbjct  80   AQETQPVGNTVRSIKRLMGQKYASKAVEVAKSFGTYTVASTKQGNAAVQVVRNEKPALLQ  139

Query  83   PEEISSMVLTKMREVSEAFI-GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  141
            PEE+S+ +L+ ++  +EA+  GK + N VITVPAYF+DSQR+AT  + ++AG  V+R++N
Sbjct  140  PEEVSACILSDLKASAEAYFDGKRIDNVVITVPAYFSDSQRKATITSASMAGFKVIRLMN  199

Query  142  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            EPTAAA+AYGL    G + V++FD GGGT DVSL+SI++G FE +  G
Sbjct  200  EPTAAAMAYGL-FVAGTKIVVVFDFGGGTLDVSLMSIQDGRFEVLGIG  246

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG D+    +D+L++DV PL  GLETA G M V+IP+N  +P   T
Sbjct  391  EVVCEGAAIQAAILSGMDR-RVFRDVLMMDVIPLPIGLETADGRMEVIIPKNARIPVSLT  449

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ DNQ G+ I+V+EGE  + ++N+ +  FN      +PR      G     VTF 
Sbjct  450  KYFQTFEDNQRGLTIEVYEGENEVAKENDHICYFNFT----LPRDKVGKAGEFAHPVTFT  505

Query  298  IDANGILNVSA  308
            ++A+G+L V A
Sbjct  506  MNASGVLQVQA  516

>SDRG_10038
Length=565

 Score = 145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 120/218 (55%), Gaps = 39/218 (18%)

Query  8    ASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAE  67
            A +GIDLGTT++CVGV  N +V IIANDQG RTTP  VAF   + ++GD+A  ++  NA 
Sbjct  2    ACIGIDLGTTHACVGVHFNGKVSIIANDQGFRTTPCVVAFETEDVVVGDSAVAKLHNNAA  61

Query  68   NTI-------------------------------------TVTFKGESKTFQPEEISSMV  90
            NT+                                      VT K   +     E +S+V
Sbjct  62   NTVYHLKRVLGKKHSDVKSLDYIKGWSFDVKADAKGHAVAAVTHKEAKRDVSATEFASLV  121

Query  91   LTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            L K++ ++E + G  VKN V+TVP  F++ Q+    +A   AG++V+R I+EP AAAIAY
Sbjct  122  LGKLKALAEDYTGVQVKNCVLTVPQEFSEEQKTLMNEAAKAAGIDVMRYISEPIAAAIAY  181

Query  151  GLD--KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            G D  K    + +++ D+GG + D+SLLS ++G+F  V
Sbjct  182  GFDETKSIDTKLIVVVDIGGASSDMSLLSADKGLFNVV  219

 Score = 105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 86/149 (58%), Gaps = 4/149 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldV--TPLSQGLETAGGVMTVLIPRNTTVPTK  241
            E +A+GATV+AA LS   + + L    L  V   PL+  L  A G +  +I RNT +P  
Sbjct  366  EVIAYGATVEAATLSETAEWDNLPSDPLNMVEAVPLTLSLGLADGSVYEMIQRNTVLPAT  425

Query  242  KTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN  301
              + F+T+ DNQ  V +Q++EG+R M RDN LL    + GIPPM +G P+I+V+F++   
Sbjct  426  TQEVFTTHVDNQKAVYLQIYEGQRFMARDNTLLANLTISGIPPMEKGSPEIEVSFNVTRK  485

Query  302  GILNVSAVEKST--GKENKITITNDKGRL  328
             +L V A  ++    K   +T+ +D  R+
Sbjct  486  SVLTVKAHLRNAEGAKSKALTVESDSKRV  514

>PITG_15370
Length=474

 Score = 143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/77 (90%), Positives = 72/77 (94%), Gaps = 0/77 (0%)

Query  111  ITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT  170
            +TVPAYFNDSQRQAT  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGE NVLIFDLGGGT
Sbjct  150  VTVPAYFNDSQRQATIYAGAIAGLNVLRIINEPTAAAIAYGLDKKGGEHNVLIFDLGGGT  209

Query  171  FDVSLLSIEEGIFEAVA  187
            FDVSLL+IE+GIFE  A
Sbjct  210  FDVSLLTIEDGIFEVKA  226

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 54/67 (81%), Gaps = 2/67 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRN--TTVPTK  241
            EAVA+GATVQAAILSGN+ S KLQDLLLLDV PLS GLETAGGVMT LIPRN  T   T 
Sbjct  371  EAVAYGATVQAAILSGNESSSKLQDLLLLDVAPLSLGLETAGGVMTKLIPRNNSTLSLTG  430

Query  242  KTQTFST  248
            K ++ ST
Sbjct  431  KYRSLST  437

>PHYKE_64
Length=569

 Score = 144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 119/217 (55%), Gaps = 40/217 (18%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GID+GTT+ CVGVW N +V IIANDQG RTTP+YV F   E ++GD A N++  +A++TI
Sbjct  5    GIDIGTTHGCVGVWHNGKVNIIANDQGFRTTPAYVCFEGEEVIVGDTAVNKLPSHADSTI  64

Query  71   T-------------------------------------VTFKGESKTFQPEEISSMVLTK  93
                                                      GE     P +  +++L  
Sbjct  65   YHLKRLLGKSHADVASRDFVKSWPFDVMEGAKGGAHAETVRNGEKHEVSPVDFMALLLQN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            ++E++E F G+ +++ VI+ PA+ ++  ++    A   AG+ VL  ++EP AAAIAYGLD
Sbjct  125  LKELAEDFTGETLEHVVISKPAHADEKHQELLNAAAEKAGVKVLTYLSEPLAAAIAYGLD  184

Query  154  KKGGE---RNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            +         VL+FD+GG T DV+LL+ ++G+FE ++
Sbjct  185  EAANNPKPEYVLVFDIGGATHDVTLLNADKGLFEVLS  221

 Score = 116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 100/155 (65%), Gaps = 2/155 (1%)

Query  184  EAVAFGATVQAAILSG-NDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            E +A+GAT++A+ L+   D  E  + + +++V PL+  +  A G ++ LI R T +P   
Sbjct  367  EVIAYGATIEASGLAELVDAPEPKKPVNMVNVVPLNLSVALANGSVSELIQRETILPATH  426

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDANG  302
            T+ F+T  DNQ  V +Q++EG+R M +DN L+ + ++ GIPPM +G  +I+VTF +   G
Sbjct  427  TELFTTSEDNQEAVFLQIYEGQRLMAKDNTLVAQLSVAGIPPMSKGDAEIEVTFTVSTKG  486

Query  303  ILNVSAVEKSTGKENKITITNDKGRLSQADIERMV  337
            +L+V+A E+  GK+  + +TND  RLS AD+  +V
Sbjct  487  VLSVTASERKAGKKT-LEVTNDPKRLSTADVAAIV  520

>PHYCA_6458
Length=560

 Score = 144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 126/227 (56%), Gaps = 48/227 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFT----------------  48
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F                 
Sbjct  21   CLGIDLGTTNSCVGMWHVDRHHVKILKNRLDRG-RTTPSVVRFNPQSQSVDVGNVAIGLE  79

Query  49   ----------DSERLIGDA------------AKNQVAMNAENTITV-TFKGESKT-FQPE  84
                        +RL+G              A  +VA   +  +     +G+ K   QPE
Sbjct  80   TSEPVGNTIRSVKRLMGQKFASKATDVARIYASYEVAPTPQGNVAAQVVRGQKKVQVQPE  139

Query  85   EISSMVLTKMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            E+S+ +LT+++  +E +    VK  N VITVPAYF+DSQR+AT  A ++AG   +R++NE
Sbjct  140  EVSACILTELKASAEGYFDGQVKLDNVVITVPAYFSDSQRKATITAASMAGFKAVRLLNE  199

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            PTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FE +  G
Sbjct  200  PTAAAMAYGL-FLSGTKMVTVFDFGGGTLDVSLLSIQDGKFEVLGIG  245

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 80/131 (61%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++PRN  +PT  T
Sbjct  390  EVVCEGAAIQAAILSGIDQ-RVFRDVLMMDVLPLPIGLETADGTMEVILPRNARIPTTVT  448

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F TY D Q G+ ++V+EGE+   ++N+ +  FN      +PR      G     VTF 
Sbjct  449  KYFQTYEDGQRGLTVEVYEGEKENAKENDHICYFNF----ALPRDKIGKAGEFAHPVTFT  504

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  505  MNASGILQVQA  515

>PYIR_13638
Length=543

 Score = 143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 124/205 (60%), Gaps = 25/205 (12%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQGN-RTTPSYVA------FTDSERLIGDAAK  59
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS             +RL+G    
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVETAPVGNTIRSIKRLMGQKYT  82

Query  60   NQVAMNAEN----TITVTFKGESK----------TFQPEEISSMVLTKMREVSEAFI-GK  104
            ++ A  A++     I  T +G +           T +PEE+S+ +L+ ++  +E +   K
Sbjct  83   SKAAEVAKSFGTYKIAATKQGSAAVQVVRAQKLVTVEPEEVSACILSDLKASAEVYFDNK  142

Query  105  DVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIF  164
             + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPTAAA+AYGL    G + V++F
Sbjct  143  RIDNVVITVPAYFNDSQRKATITSASMAGFKAIRLMNEPTAAAMAYGL-FVAGTKMVVVF  201

Query  165  DLGGGTFDVSLLSIEEGIFEAVAFG  189
            D GGGT DVSL+SI++G FE +  G
Sbjct  202  DFGGGTLDVSLMSIQDGRFEVLGIG  226

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 85/144 (59%), Gaps = 11/144 (8%)

Query  171  FDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTV  230
            FD   L +     E V  GA +QAAILSG D+    +D+L++DV PL  GLET  G M V
Sbjct  358  FDGKELCMSVNADEVVCEGAAIQAAILSGMDR-RVFRDVLMMDVIPLPIGLETHDGTMEV  416

Query  231  LIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  287
            +IP+N+ +P   T+ F T+ DNQ G+ ++V+EGE+ + ++N+ +  FN      +PR   
Sbjct  417  IIPKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEQKVAKENDHICYFNF----VLPRDKI  472

Query  288  ---GVPQIDVTFDIDANGILNVSA  308
               G     VTF ++A+G+L V A
Sbjct  473  GRAGEFAHPVTFTMNASGVLQVQA  496

>PYAR_24687
Length=618

 Score = 144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 122/218 (56%), Gaps = 41/218 (19%)

Query  10   VGIDLGTTYSCVGVWQND--RVEIIANDQGNRTTPSYVAF--TDSERLIGDAAKNQVAMN  65
            + ID GT+ +   V +N   +VEII ND+G+  TP+YV +     E ++G  AK Q  + 
Sbjct  40   IAIDFGTSNTRAAVVRNTTGQVEIIPNDKGHSATPTYVTWDSVTGEVIVGRDAKQQALLQ  99

Query  66   AENT------------------------------------ITVTFKGESKTFQPEEISSM  89
             +NT                                    I V  KGE++ F  EE+++M
Sbjct  100  PKNTAFDFKQLLGRSFDSKEVQSAIAQLPYTIIDRDNKPFIQVEMKGETREFSVEEVTAM  159

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            VLT+M++ +EA++G++++NAV+TVPA F D+QR+A K A A+AGL   R++NEPTAA + 
Sbjct  160  VLTRMKQFAEAYLGEEIENAVVTVPASFEDAQREAMKAACAMAGLTTRRVLNEPTAATMG  219

Query  150  YGLDKKG-GERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            +G+  K   ER VL+    GG  D +LL I+EGI E +
Sbjct  220  FGIKPKTQHERKVLVVHFDGGALDATLLEIDEGIVEVL  257

 Score = 100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 80/139 (58%), Gaps = 3/139 (2%)

Query  218  SQGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKF  277
            S G+ETAGGVM  ++ R+   PT+ TQT ST   NQ  + I+VFEGER +T+DN+ +G+ 
Sbjct  435  SLGVETAGGVMLPVLSRHRLTPTRATQTVSTLHANQLDITIRVFEGERLLTKDNHFIGQL  494

Query  278  NLDGIPPMPRGVPQIDVTFDIDANG-ILNVSAVEKSTGKENKITITNDKGRLSQADIERM  336
             L G+ P P+GVP+I+V F+ DA G  L  +A  + T   + +TI   K      +  R 
Sbjct  495  RLSGLAPAPQGVPRIEVEFETDAMGETLFATARVEGTNLADSLTIQVAKHAFEHDEAVRK  554

Query  337  VAEAEKYKSEDEANKIRIE  355
                E  K ED   K RIE
Sbjct  555  A--GEDAKDEDTKVKARIE  571

>PYIW_17320
Length=563

 Score = 143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 126/225 (56%), Gaps = 45/225 (20%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQGN-RTTPSYVAF------------------  47
             +GIDLGTT SC+G+W  +R  V+I+ N +   RTTPS V F                  
Sbjct  23   CIGIDLGTTNSCIGMWHVERNHVKILKNAKDRKRTTPSVVRFDPQSEHAYEVGHAAIAQE  82

Query  48   --------TDSERLIGDAAKNQVAMNAEN----TITVTFKG----------ESKTFQPEE  85
                       +RL+G    ++    A++    TIT T +G          ++   QPEE
Sbjct  83   TQPVGNTIRSVKRLMGQKYTSKAVEVAKSFGTYTITATKQGGAAVQVVRANKTAVVQPEE  142

Query  86   ISSMVLTKMREVSEAFIG-KDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            +++ +L  ++  +EA+   K + N VITVPAYFNDSQR+AT  + ++AG   +R++NEPT
Sbjct  143  VAACILADLKASAEAYFDDKRIDNVVITVPAYFNDSQRKATLTSASMAGFKAVRLLNEPT  202

Query  145  AAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            AAA+AYGL    G + V++FD GGGT DVSL+SI +G FE +  G
Sbjct  203  AAAMAYGL-FVAGTKMVVVFDFGGGTLDVSLMSISDGRFEVLGIG  246

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 83/142 (58%), Gaps = 7/142 (5%)

Query  171  FDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTV  230
            FD   L +     E V  GA +QAAILSG D+    +D+L++DV PL  GLET  G M  
Sbjct  378  FDGKELCMSVNADEVVCEGAAIQAAILSGMDR-RVFRDVLMMDVIPLPIGLETHDGRMET  436

Query  231  LIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  287
            +IP+N+ +P   T+ F T+ DNQ G+ ++V+EGE  + ++N+ +  FN   + P  +   
Sbjct  437  IIPKNSRIPVSLTKYFQTFEDNQRGLTVEVYEGEHEVAKENDHICYFNF--VLPHDKVGK  494

Query  288  -GVPQIDVTFDIDANGILNVSA  308
             G     VTF ++A+G+L V A
Sbjct  495  AGEFAHPVTFTMNASGVLQVQA  516

>PYAR_14579
Length=567

 Score = 143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 130/229 (57%), Gaps = 50/229 (22%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDS--ERLIGDAA----  58
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  S  E L+G+AA    
Sbjct  22   CIGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVHFLPSSHEVLVGNAAIARE  80

Query  59   ----------------------KNQVAMN-AENTITVTFKGESKT-----------FQPE  84
                                    Q+A   A ++I  T +G +              QPE
Sbjct  81   YEPPGNTVRAIKRLMGQRFDSRAVQLASKFATHSIVATAQGNAAVQVQRGGDGVIAVQPE  140

Query  85   EISSMVLTKMREVSEAFI----GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  140
            EI++ VL +++  +EA+      K + N VITVPAYFNDSQR+AT  +  +AG   +R++
Sbjct  141  EIAAEVLRELKASAEAYWEQTHSKRIDNVVITVPAYFNDSQRKATILSAQMAGFKAVRLL  200

Query  141  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            NEPTAAA+AYGL    GE++V++ D GGGT DVSLL+I +G F+ +  G
Sbjct  201  NEPTAAAMAYGL-FVSGEKHVVVVDFGGGTLDVSLLAIHDGKFQVLGIG  248

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 80/131 (61%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG D+    +D+L++DV PL  GLE A G M VL+ +N+ +P   T
Sbjct  396  EVVCEGAAIQAAILSGIDK-RVFRDVLMMDVIPLPIGLEKADGRMEVLLAKNSRIPVSVT  454

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ D Q G+ +QV+EGE+ M ++N+ +  F+     P+PR      G  +  VT  
Sbjct  455  KYFETFEDGQRGLTVQVYEGEKEMAKENDHISDFSF----PLPRDKIGKAGEFRHPVTLT  510

Query  298  IDANGILNVSA  308
            ++A+G+L V A
Sbjct  511  MNASGVLQVQA  521

>PHYRA_79054
Length=563

 Score = 142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 131/228 (57%), Gaps = 49/228 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDS--------------  50
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  S              
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRSDRG-RTTPSVVRFDPSSQAADVGNAAVALE  80

Query  51   ------------ERLIG--------DAAK----NQVAMNAENTITV-TFKGESKTFQ--P  83
                        +RL+G        D A+     +V   A+  + V   +G  +  Q  P
Sbjct  81   TCEPLGNTIRSVKRLMGQKFDSKAADVARIYAGYRVLPTAQGNVAVQVLRGGKRDIQVQP  140

Query  84   EEISSMVLTKMREVSEAFI--GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN  141
            EE+S+ VL +++  +EA+   G+ ++N VITVPAYF+DSQR+AT  + ++AG   +R++N
Sbjct  141  EEVSACVLIELKASAEAYFEDGRRLENVVITVPAYFSDSQRKATITSASMAGFKAVRLLN  200

Query  142  EPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            EPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FE +  G
Sbjct  201  EPTAAAMAYGL-FLSGRKVVTVFDFGGGTLDVSLLSIDDGKFEVLGIG  247

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 82/131 (63%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++PRN  +PT  T
Sbjct  392  EVVCEGAAIQAAILSGMDQ-RVFRDVLMMDVLPLPIGLETADGSMEVILPRNARIPTTVT  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR      G     VTF 
Sbjct  451  KNFQTFEDDQRGLTVEVYEGEKDIAKENDHICYFNF----ALPRDKIGKAGEFAHPVTFT  506

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  507  MNASGILQVQA  517

>PPTG_05819
Length=561

 Score = 142 bits (359),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 127/227 (56%), Gaps = 48/227 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF-----------------  47
             +GIDLGTT SCVG+W  DR  V+I+ N  D+G RTTPS V F                 
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKILKNSLDRG-RTTPSVVRFDPKSQSVDVGNVAVGLE  80

Query  48   ---------TDSERLIGDAAKN------------QVAMNAENTITV-TFKGESKT-FQPE  84
                        +RL+G   +N            +VA  A+  + V   +G  K   QPE
Sbjct  81   TSEPVGNTIRSVKRLMGQRFENKAVDVARIYASYEVAPTAQGNVAVQVVRGHKKVQVQPE  140

Query  85   EISSMVLTKMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            E+S+ VL +++  +EA+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++NE
Sbjct  141  EVSACVLRELKASAEAYFDGQTKLDNVVITVPAYFSDAQRRATITSASMAGFKAVRLLNE  200

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            PTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FE +  G
Sbjct  201  PTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIG  246

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++PRN  +PT  T
Sbjct  391  EVVCEGAAIQAAILSGMDQ-RVFRDVLMMDVLPLPIGLETADGTMEVILPRNARIPTTVT  449

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F TY D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR      G     VTF 
Sbjct  450  KYFQTYEDDQRGLTVEVYEGEKEIAKENDHICYFNF----ALPRDKIGKAGEFAHPVTFT  505

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  506  MNASGILQVQA  516

>PHYSO_493381
Length=562

 Score = 142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 129/230 (56%), Gaps = 53/230 (23%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDS--------------  50
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +              
Sbjct  22   CLGIDLGTTNSCVGMWHVERNHVKILKNRADRG-RTTPSVVRFEPTTQRADVGNAAVQLE  80

Query  51   ------------ERLIGDAAKNQVAMNAENTITVTFK----------------GESKTF-  81
                        +RL+G   +++ A  A   I  T+K                G+ K   
Sbjct  81   TQEPVGNTVRSVKRLMGQKFESKAADVAR--IYATYKVVSTAQGNAAVQVARGGQKKVHV  138

Query  82   QPEEISSMVLTKMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  139
            QPEE+S+ VL +++  +EA+    VK  N VITVPAYF+DSQR+AT  + ++AG   +R+
Sbjct  139  QPEEVSACVLAELKASAEAYFDGSVKLDNVVITVPAYFSDSQRKATITSASMAGFKAVRL  198

Query  140  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            +NEPTAAA+AYGL    G + V +FD GGGT DVSLLSI++G FE +  G
Sbjct  199  LNEPTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIQDGKFEVLGIG  247

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 81/131 (62%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++D  PL  GLETA G M V++PRN  +PT  T
Sbjct  392  EVVCEGAAIQAAILSGMDQ-RVFRDVLMMDALPLPIGLETADGSMEVILPRNARIPTTVT  450

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ D+Q G+ ++V+EGE+ + ++N+ +  FN      +PR      G     VTF 
Sbjct  451  KYFQTFEDDQLGLTVEVYEGEKEIAKENDHICYFNF----ALPRDKIGKAGEFAHPVTFT  506

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  507  MNASGILQVQA  517

>PITG_16528
Length=561

 Score = 141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 126/227 (56%), Gaps = 48/227 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAF-----------------  47
             +GIDLGTT SCVG+W  DR  V+I  N  D+G RTTPS V F                 
Sbjct  22   CLGIDLGTTNSCVGMWYVDRNHVKIFKNHLDRG-RTTPSVVRFDPKSQSVAVGNVAVGLE  80

Query  48   ---------TDSERLIGDA------------AKNQVAMNAENTITV-TFKGESKT-FQPE  84
                        +RL+G              A  +VA  A+  + V   +G+ K   QPE
Sbjct  81   TSEPVENTIRSVKRLMGQKFDSKAVDVARIYASYEVAPTAQGNVAVQVVRGQKKVQVQPE  140

Query  85   EISSMVLTKMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINE  142
            E+S+ VL +++  ++A+     K  N VITVPAYF+D+QR+AT  + ++AG   +R++NE
Sbjct  141  EVSACVLRELKASADAYFDGHTKLDNVVITVPAYFSDTQRKATIASASMAGFKAVRLLNE  200

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            PTAAA+AYGL    G + V +FD GGGT DVSLLSIE+G FE +  G
Sbjct  201  PTAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLSIEDGKFEVLGIG  246

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 80/131 (61%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++ RN  +PT  T
Sbjct  391  EVVCEGAAIQAAILSGMDQ-RVFRDVLMMDVLPLPIGLETADGSMEVILLRNARIPTTVT  449

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F TY D Q G+ ++V+EGE+ + ++N+ +  FN      +PR      G     VTF 
Sbjct  450  KYFQTYEDEQRGLTVEVYEGEKEVAKENDHICYFNF----ALPRDKVGKAGEFAHPVTFT  505

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  506  MNASGILQVQA  516

>PHALS_02692
Length=557

 Score = 138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 122/226 (54%), Gaps = 46/226 (20%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIANDQGN-RTTPSYVAFTDS---------------  50
             +GIDLGTT SCVG+W  DR  V+I  N     RTTPS V F  +               
Sbjct  18   CLGIDLGTTNSCVGMWYVDRNHVKIFKNRLNRGRTTPSVVHFDPTSQSVDVGQAAIDLET  77

Query  51   -----------ERLIGDA------------AKNQVAMNAENTITVTF-KGESKT-FQPEE  85
                       +RL+G              A  +VA  A+  + V   +G  K   QPEE
Sbjct  78   SEPVGNTIRSIKRLMGQKYESKATDVARIYASYEVAPTAQKNVAVQLVRGHKKVQVQPEE  137

Query  86   ISSMVLTKMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            +S+ +LT+++  +EA+     +  N VITVPAYF+D+QR+AT  +  +AG   +R++NEP
Sbjct  138  VSAYILTELKTSAEAYFDGQTRLNNVVITVPAYFSDAQRKATITSALMAGFKAVRLLNEP  197

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            TAAA+AYGL    G + V +FD GGGT DVSLL I++G FE +  G
Sbjct  198  TAAAMAYGL-FLSGTKLVTVFDFGGGTLDVSLLRIQDGKFEVLGIG  242

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++PRN  +PT  T
Sbjct  387  EVVCEGAAIQAAILSGIDQ-RVFRDVLMMDVLPLPIGLETADGTMEVILPRNARIPTTVT  445

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F+TY DNQ G+ I+V+EGE+ + ++N+ +  FN      +PR      G     VTF 
Sbjct  446  KYFTTYEDNQRGITIEVYEGEKDIAKENDHICYFNF----ALPRNKIGKAGEYSHPVTFT  501

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  502  MNASGILQVQA  512

>SPRG_01255
Length=566

 Score = 138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 121/215 (56%), Gaps = 41/215 (19%)

Query  9    SVGIDLGTTYSCVGVW--QNDRVEII---ANDQGNRTTPSYVAFT---------------  48
             +GIDLGTT SCVG W    + V+I+   A D   +T PS V+F                
Sbjct  24   CIGIDLGTTNSCVGYWKLHANHVKIVNHSAGDTKAKTLPSVVSFPPTGAPAVGFAAVAAE  83

Query  49   ----------DSERLIG----DAAKNQVAMNA------ENTITVTFKGESKTFQPEEISS  88
                       ++RL+G    DA+ +Q  ++          +++       +  P E+++
Sbjct  84   ASDADVVTVRSAKRLLGQSLADASPDQKYLSYTLCDGESGHVSIALPARKTSVTPSEVAA  143

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            ++L+K++  +EA + + + N V+TVPAYF + QRQAT +A A+AG + +R++NEPTAAA+
Sbjct  144  LLLSKLKAAAEAKLNERIANCVLTVPAYFTEPQRQATLEAAAMAGFSAVRLLNEPTAAAM  203

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  183
            AYGL   G +R V++FD GGGT DVS+L I +G F
Sbjct  204  AYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTF  237

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +QAAILSG D+ +  QD+L+LDV P+S G+E A G M VLI +N+ +P   T
Sbjct  388  EVVAEGAAIQAAILSGVDK-KVFQDVLMLDVIPMSIGIEKADGAMEVLIQKNSRIPVSVT  446

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G  Q  VT  
Sbjct  447  KYFDTAIDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKVRGKAGAIQHPVTLS  502

Query  298  IDANGILNVSA  308
            ++ANG+L V A
Sbjct  503  MNANGLLQVKA  513

>CCI45261
Length=558

 Score = 134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/229 (35%), Positives = 124/229 (54%), Gaps = 49/229 (21%)

Query  9    SVGIDLGTTYSCVGVWQND--RVEIIANDQGNR---TTPSYVAFTDSE------------  51
            ++GID GTT SCVG+W  D  RV+I+ +D   +     PS V +  ++            
Sbjct  24   AIGIDFGTTNSCVGIWLKDQSRVKILKHDFDTKRYYLLPSVVRYDPTDVSLVSVGQEAVR  83

Query  52   ---------------RLIG------------DAAKNQVAMNAENTI---TVTFKGESKTF  81
                           RL+G             ++ +Q+       +    +T K +    
Sbjct  84   LEATPPCKNTIRCVKRLMGQRYTNDRISYLQSSSTHQIVSTKRGNVGICIITEKNDESIV  143

Query  82   QPEEISSMVLTKMREVSEAFI-GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  140
            +PE++++ +L K++  +EA+   K ++N V+TVPA+FND QR+AT  A ++AG   +R++
Sbjct  144  EPEQVAACILLKLKAKAEAYFDHKIIENVVLTVPAHFNDGQRKATIRAASMAGFRKIRLM  203

Query  141  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            NEPTAAA+AYGL    G + VL+FD GGGT DVSL+ I+EG F+ VA G
Sbjct  204  NEPTAAAMAYGL-FIAGHKQVLVFDFGGGTLDVSLMRIDEGKFKVVAIG  251

 Score = 86.7 bits (213),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 84/131 (64%), Gaps = 15/131 (11%)

Query  186  VAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKTQT  245
            V  GA +QAA+LSG D+ + LQD+L+LDV PLS GLET  G M +++ +N+ +P + T+ 
Sbjct  393  VCEGAAIQAAVLSGMDR-KTLQDVLMLDVIPLSMGLETVDGRMEIILSKNSQIPAEVTKY  451

Query  246  FSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID--------VTFD  297
            F T+ D+Q G+ + V+EGE S+ R+N  + +F+     P+P    +ID        VTF 
Sbjct  452  FQTFEDDQRGISVDVYEGENSIARENEHICRFDF----PIPS--LKIDKAGRIFHPVTFK  505

Query  298  IDANGILNVSA  308
            ++ NG+L VSA
Sbjct  506  MNENGVLQVSA  516

>H257_01680
Length=571

 Score = 133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 117/215 (54%), Gaps = 41/215 (19%)

Query  9    SVGIDLGTTYSCVGVWQN--DRVEII---ANDQGNRTTPSYVAF----------------  47
             +GIDLGTT SCVG W+   +  +II   A D  ++T PS V+F                
Sbjct  21   CIGIDLGTTNSCVGYWKEGANHAKIINHTATDGKHKTVPSVVSFPSQGNPFVGFDAVEHE  80

Query  48   ----------TDSERLIG----DAAKNQ-----VAMNAENTITVTFKGESKTFQPEEISS  88
                        ++RL+G    + A  Q        +A+  + +    +     P E+S+
Sbjct  81   QKYEPDTVTIRSAKRLMGKTLAEMADEQKYLSYTLCDADGHVAIDLPSKESIATPSEVSA  140

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            ++L  +++ +E  +G  V N V+TVPAYFN+SQRQ+T  A  +AG   +R++NEPTAAA+
Sbjct  141  ILLKYIKDTAEDKLGHQVFNCVLTVPAYFNESQRQSTLKAATMAGFQGIRLLNEPTAAAM  200

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  183
            AYGL   G +R V IFD GGGT DVS+LSI+ G F
Sbjct  201  AYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGTF  234

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 91/158 (58%), Gaps = 11/158 (7%)

Query  171  FDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTV  230
            FD  +L       E VA GA +QAAILSG D+    QD+L++DV PLS G+E A G M V
Sbjct  375  FDGKVLCTSVNADEVVASGAAIQAAILSGVDK-RVFQDVLMMDVIPLSIGIEMADGRMEV  433

Query  231  LIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  287
            LIP+N+ +P   T++F TY D+Q G+ ++VFEG+  + RDN  L  FN      +PR   
Sbjct  434  LIPKNSRIPISVTKSFDTYEDHQKGITVEVFEGDHPVARDNVYLTYFNF----TLPRHKL  489

Query  288  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITIT  322
               G  Q  VT  ++ NG+L V A  +    EN+  ++
Sbjct  490  GKAGEFQHAVTLSMNENGVLQVKAGAQHEIDENEAAVS  527

>PYVX_18450
Length=386

 Score = 130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 107/190 (56%), Gaps = 10/190 (5%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSE-RLIGDAAK  59
            A+++    VGIDLGTTYS V + Q + V +I +  G+   PS VAF  D E    G AA 
Sbjct  50   AEAIRVLVVGIDLGTTYSVVAISQRNNVTVIPDSHGHLIIPSMVAFLPDGEVTAAGIAAP  109

Query  60   NQVAM-------NAENTITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKD-VKNAVI  111
             + A+        AE    +   G      P  I S+V+  ++ +++ F+G D + NAVI
Sbjct  110  YEFAIASLEGNTTAEVCFELDVPGHPPCSAPVSIGSIVVRHLKTMAQRFVGHDQITNAVI  169

Query  112  TVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTF  171
             VP  FN+ QR AT +A   AGL V R++ EPTAAAIAYGL +      VL+FD GGGT 
Sbjct  170  AVPVDFNERQRDATVEAFRAAGLVVSRVLEEPTAAAIAYGLHQDPTVNFVLVFDFGGGTL  229

Query  172  DVSLLSIEEG  181
            DVSLL +  G
Sbjct  230  DVSLLFVRAG  239

>CCA20229
Length=583

 Score = 133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/232 (34%), Positives = 120/232 (52%), Gaps = 49/232 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAEN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +AEN
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHAEN  62

Query  69   --------------------------------------TITVTFK-GESKTFQPEEISSM  89
                                                  T+ VT + GE       E  ++
Sbjct  63   IVFHLGRLLGKSHEEVAENAHVNEWFFKVEKDSKNEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +L  ++ +++ + G  +  AVI+   +    Q+Q    A   A LNV+  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVISTSIHCTTEQKQVLAQAAKDAELNVMSYLPDPIAAAIA  182

Query  150  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVAFGAT  191
            YG D       KK  +     +L+ D+GG T  V+LL++++G+FE VA G +
Sbjct  183  YGFDDWKPKNYKKANQSTAQLILVVDIGGATTAVTLLNVDKGLFEIVADGGS  234

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/180 (34%), Positives = 99/180 (55%), Gaps = 8/180 (4%)

Query  184  EAVAFGATVQAAILSGN-DQS---EKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVP  239
            E VA GAT++AA L    D++   + L+    ++  PLS  +  A G +  LI R+  +P
Sbjct  376  EVVANGATIEAATLEKLLDEAIPLDSLEQHANVNAVPLSLSVGLAHGNVHTLIHRDVVLP  435

Query  240  TKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  299
             K  +TF+T+ DNQ   LI+++EGER++   N LL +  + GI P+P+G  +I +   + 
Sbjct  436  AKMMETFTTWEDNQTEALIEIYEGERAIAEKNTLLAQMCISGITPLPKGEAEIIIELQVS  495

Query  300  ANGILNVSAVEKSTGKENK-ITITNDKGRLSQA-DIERMVAEAEKYKSEDEANKIRIEAK  357
            + G+L V A+    G+E K + I  D+ RL+ A  ++ +V  A     ED+     IE K
Sbjct  496  SQGLLTVRAI--LNGEEKKMLEIHTDQARLADAKKLDHIVEAANAAMDEDDTFLTEIENK  553

>PYVX_13615
Length=585

 Score = 133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/237 (40%), Positives = 134/237 (57%), Gaps = 52/237 (22%)

Query  3    QSVTGA-SVGIDLGTTYSC---VGVWQNDR--VEIIAN--DQGNRTTPSYVAF---TDS-  50
            Q   GA  VGIDLGTT SC   VG+W+ +R  V+I+ N  D+G RTTPS V F   +D  
Sbjct  14   QFAAGARCVGIDLGTTNSCATRVGIWKTERNHVKILKNRRDRG-RTTPSVVRFGPESDQV  72

Query  51   ----------------------ERLIG--------DAAKNQVAMNAENT------ITVTF  74
                                  +RL+G        + A    A   E T      I++  
Sbjct  73   LVGNEAIAHELEDPVGNTVRAVKRLMGQPFESKAVEVATKFAAFKLEPTKQGNTAISIDR  132

Query  75   KG-ESKTFQPEEISSMVLTKMREVSEAFI-GKDVKNAVITVPAYFNDSQRQATKDAGAIA  132
             G ++ T  PE++S+ VL++++  +EA+   + + + VITVPAYFNDSQR+AT +A   A
Sbjct  133  SGSKTDTVLPEDVSAAVLSELKASAEAYYQDESIDHVVITVPAYFNDSQRRATLEAATSA  192

Query  133  GLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            G + +R++NEPTAAA+AYGL    G + V++FD GGGT DVSL+ I++G FE +  G
Sbjct  193  GFSAVRLLNEPTAAAMAYGL-FLAGTKLVVVFDFGGGTLDVSLMQIQDGKFEVLGIG  248

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG D  +  +D+L++DV PL  GLETA G M VL+P+N+ +P   T
Sbjct  414  EVVCEGAAIQAAILSGMDH-KVFRDVLMMDVIPLPIGLETADGAMEVLLPKNSRIPVSLT  472

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ D Q G+ ++V+EGE ++ + N+ +  FN      +PR      G  +  VTF 
Sbjct  473  KYFETFEDGQRGLTVEVYEGEHAVAKQNDHICYFNF----ALPRDKIGKAGEFRHPVTFT  528

Query  298  IDANGILNVSA  308
            +  +G+L V A
Sbjct  529  MTPSGVLQVQA  539

>CCI47582
Length=582

 Score = 132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 120/230 (52%), Gaps = 49/230 (21%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAEN  68
            ++GID+GTT+ CVGVW N +V IIANDQG RTTP+Y+ F D E ++GD A+N++  +A+N
Sbjct  3    ALGIDIGTTHGCVGVWYNGKVTIIANDQGFRTTPAYICFEDDEIIVGDTAQNKLHTHADN  62

Query  69   --------------------------------------TITVTFK-GESKTFQPEEISSM  89
                                                  T+ VT + GE       E  ++
Sbjct  63   IVFHLRRLLGKKYEEIAENPHVNEWFFKVEKDGKDEAQTVAVTKRNGEVYKIAAVEFVTL  122

Query  90   VLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +L  ++ +++ + G  +  AV+T   +  D Q+Q    A   A L+++  + +P AAAIA
Sbjct  123  LLRNLKTLAQDYTGLTIDKAVLTTSIHCTDRQQQLLTQAAKEAQLDIMSYLPDPIAAAIA  182

Query  150  YGLD-------KKGGERN---VLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            YG D       KK  +     +L+ D+GG T  ++LLS+++G+FE VA G
Sbjct  183  YGFDDWKPNNYKKANQCQADLILVVDIGGATTAITLLSVDKGLFEIVADG  232

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 100/180 (56%), Gaps = 8/180 (4%)

Query  184  EAVAFGATVQAAILSGN-DQS---EKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVP  239
            E VA GAT++AA L    D++   + L   + ++  PLS  +    G +  LI R+  +P
Sbjct  376  EVVANGATIEAATLEKLLDEAIPLDSLDQHVNVNAVPLSLSVGLVHGNVHTLIHRDAILP  435

Query  240  TKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID  299
             K T+TF+T+ DNQ  VLI+++EGER++   N LL +  + GI P+P+G  +I +   + 
Sbjct  436  AKMTETFTTWEDNQTEVLIEIYEGERAIAEKNTLLARMCVSGIAPLPKGEAEIILQVQVS  495

Query  300  ANGILNVSAVEKSTGKENKIT-ITNDKGRLS-QADIERMVAEAEKYKSEDEANKIRIEAK  357
            + G+L V A     G+E KI  I  D+ RL+ +  ++++V  A     ED+     IE K
Sbjct  496  SKGVLTVKA--SMNGEEKKILEIHTDEARLADKKQLDQIVEAANDAIDEDDTFLTEIENK  553

>CCA22305
Length=561

 Score = 130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 122/234 (52%), Gaps = 51/234 (22%)

Query  6    TGASVGIDLGTTYSCVGVWQND--RVEIIAN---DQGNRTTPSYVAFTDSE---------  51
            T  ++GID GTT SCVGVW  D  RV+I  +    + +   PS V +   +         
Sbjct  21   TTIAIGIDFGTTNSCVGVWLKDQNRVKIFKHGIETKWSHLLPSVVRYDPVDISLVLVGKE  80

Query  52   ------------------RLIGDAAKNQVAMNAENT----ITVTFKGESK----------  79
                              RL+G    N      +++    I  T +G +           
Sbjct  81   AIELESKPPCKNTIRCVKRLMGQKYVNDRIAYLQSSSIYEIVSTQRGNAAIQIDGDHGDD  140

Query  80   ---TFQPEEISSMVLTKMREVSEAFI-GKDVKNAVITVPAYFNDSQRQATKDAGAIAGLN  135
               + +PEE+++ +L K++  +EA+   K ++N V+TVPA+FND QR+AT  A ++AG  
Sbjct  141  KRTSVEPEEVAAHILIKLKARAEAYFDHKAIENVVLTVPAHFNDGQRKATIRAASMAGFK  200

Query  136  VLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
             +R++NEPTAAA+AYGL    G++ VL+FD GGGT DVSL+ I EG F  VA G
Sbjct  201  KIRLLNEPTAAAMAYGL-FIAGKKQVLVFDFGGGTLDVSLMQIHEGRFRVVAIG  253

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 87/133 (65%), Gaps = 15/133 (11%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            + V  GA +QAA+LSG D+ + LQD+L+LDV PLS GLETA G M V++P+N+ +P + T
Sbjct  394  QVVCEGAAIQAAVLSGMDR-KVLQDVLMLDVIPLSMGLETADGRMEVILPKNSQIPAQVT  452

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQID--------VT  295
            + F T+ D+Q G+ + V+EGE  + R+N  + +F+     P+P    +ID        VT
Sbjct  453  KYFQTFEDDQRGISVDVYEGEHPIARENEHICRFDF----PIP--TSKIDTAGRIFHPVT  506

Query  296  FDIDANGILNVSA  308
            F ++ NG+L+V+A
Sbjct  507  FRMNENGVLHVTA  519

>H310_03911
Length=570

 Score = 129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 118/233 (51%), Gaps = 44/233 (19%)

Query  9    SVGIDLGTTYSCVGVWQNDR-----VEIIANDQGNRTTPSYVAF----------------  47
             +GIDLGTT SCVG W+        V  +  D  ++T PS V+F                
Sbjct  21   CIGIDLGTTNSCVGYWKEGANFAKIVNHVGKDGKHKTVPSVVSFPPQGNPFVGFDAVEHE  80

Query  48   ----------TDSERL-------IGDAAK--NQVAMNAENTITVTFKGESKTFQPEEISS  88
                        ++RL       +GD  K  +    +  + + +    +     P E+S+
Sbjct  81   QKLEPDTVTIRSAKRLMGKTLAEVGDEQKYLSYSLCDDGDHVAIDLPSKKTVVAPSEVSA  140

Query  89   MVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            ++L  +++ +E  +G  V N V+TVPA+FN+SQRQAT  A A+AG   +R++NEPTAAA+
Sbjct  141  ILLKYIKDTTEEKLGHQVVNCVLTVPAHFNESQRQATLKAAAMAGFQGIRLLNEPTAAAM  200

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGND  201
            AYGL   G +R V IFD GGGT DVS+LSI+ G F     G       L G D
Sbjct  201  AYGLFIAGKKR-VAIFDFGGGTLDVSILSIDSGKFAVDGVGGNTH---LGGED  249

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 90/146 (62%), Gaps = 11/146 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +QAAILSG ++   LQD+L+LDV PLS G+E A G M VLIP+N+ +P   T
Sbjct  385  EVVASGAAIQAAILSGVNK-RVLQDVLMLDVIPLSIGIEKADGTMEVLIPKNSRIPIAVT  443

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T  D+Q G+ ++VFEGE+ + RDN  L  FN      +PR      G  Q  VT  
Sbjct  444  KHFETLDDDQRGITVEVFEGEKPVARDNVFLTYFNF----TLPRHKAGKAGEFQHAVTLS  499

Query  298  IDANGILNVSAVEKSTGKENKITITN  323
            +DANGIL V A  +    +N++ I+N
Sbjct  500  MDANGILQVKAGAQHDIDDNEVAISN  525

>SPRG_06720
Length=425

 Score = 126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 112/218 (51%), Gaps = 40/218 (18%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAE  67
            SVGIDLGTTYS V V Q D V +I +  G    PS VAF D  E L+G +A+   + +  
Sbjct  32   SVGIDLGTTYSVVAVNQKDNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDPR  91

Query  68   NTI---------------------------------TVTFK-----GESKTFQPEEISSM  89
            +TI                                  V F        ++   P ++ + 
Sbjct  92   HTIFNAKRFIGRAFDATVETEEAPHYEFGLGRDEAHRVCFPLSVTGHATRCVSPVDVGAH  151

Query  90   VLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAI  148
            ++++++  +  ++G D + +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA+
Sbjct  152  IVSQLKTSAMRYLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAAL  211

Query  149  AYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            AYGLD+K     VL+FD GGGT DVSLL ++ G FE +
Sbjct  212  AYGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVI  249

>PYVX_17692
Length=551

 Score = 123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 113/214 (53%), Gaps = 48/214 (22%)

Query  11   GIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            GIDLG+T+ CVGVW N +V IIANDQG RTTP++V F   E ++GD A +++  +A++T+
Sbjct  5    GIDLGSTHGCVGVWHNGKVNIIANDQGFRTTPAFVCFEGDEVIVGDTAVHKLPAHADSTV  64

Query  71   -------------------------------------TVTFKGESKTFQPEEISSMVLTK  93
                                                 T    G +    P +  +++L  
Sbjct  65   FHLKRVLGKSQADVASRPFVQDWPFDVAAGEGGAAVATTQKNGAAHQVAPVDFLALLLRN  124

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD  153
            +R++++ F G+ V++ V++VP + +++ R   +DA A A +NVL  I EPT         
Sbjct  125  LRDLAQDFTGETVEHVVLSVPPHADEAHRALIRDAAAAAEVNVLAYIPEPTPEP------  178

Query  154  KKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
                 + VL+FD+GG T DV+LL+ ++G+F+  A
Sbjct  179  -----QYVLVFDIGGATHDVTLLTADKGLFDVTA  207

 Score = 113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 122/228 (54%), Gaps = 21/228 (9%)

Query  136  VLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGT------------FDVSLLSIEEGIF  183
            V + ++E  A   A  LDK+  +  VLI   GG T            FD     +     
Sbjct  296  VKKALDEVEALLEAQELDKEDIDHVVLI---GGSTRIPLVQSSVKSFFDGKRTHLHLSPD  352

Query  184  EAVAFGATVQAA---ILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPT  240
            E VA GAT++AA    L G    +K  + +    TPL+  +  A G ++ L+ R+T +P 
Sbjct  353  EVVAHGATIEAAGRGDLVGVPDPKKPANQVN--ATPLTLSVALANGSVSELVHRDTVLPA  410

Query  241  KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  300
              T+TF+T AD+Q  V +Q++EGER M +DN LL +  + GI  +P+G  +IDVTF +  
Sbjct  411  SATETFTTSADDQTAVFLQIYEGERLMAKDNTLLAQLAVTGITALPKGEAEIDVTFTVST  470

Query  301  NGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDE  348
             G+L V+A E+S GK+  + + +D  RL+ AD+  +V + +    ED+
Sbjct  471  KGVLTVTAEERSAGKKT-LEVKHDDKRLTAADVAAIVQKGKDAAEEDD  517

>PYAP_19903
Length=527

 Score = 123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 118/211 (56%), Gaps = 45/211 (21%)

Query  23   VWQNDR--VEIIAN-DQGNRTTPSYVAFT-DSE------------------------RLI  54
            +W  +R  V+I+ N D   RTTPS V F  DS+                        RL+
Sbjct  1    MWHVERNHVKILKNRDDRGRTTPSVVHFKPDSQEVVVGNAAIAREYDPPGNTVRTIKRLM  60

Query  55   G---DAAKNQVAMN-AENTITVTFKGESKT-----------FQPEEISSMVLTKMREVSE  99
            G   D+   +VA   A ++I  T +G +              QPEE+SS VL +++  +E
Sbjct  61   GQRFDSDAVRVAKRFATHSIVETKQGNAAVSVKRSGQDAVDVQPEEVSSHVLMELKASAE  120

Query  100  AFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGE  158
            A+   + V N VITVPAYFNDSQR+AT  +  +AG   +R++NEPTAAA+AYGL    G+
Sbjct  121  AYWDDERVDNVVITVPAYFNDSQRKATILSAQMAGFKAIRLLNEPTAAAMAYGL-FLSGQ  179

Query  159  RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
            ++V++FD GGGT DVSLLSI +G FE +  G
Sbjct  180  KHVVVFDFGGGTLDVSLLSINDGRFEVLGIG  210

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 95/159 (60%), Gaps = 11/159 (7%)

Query  171  FDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTV  230
            FD   L +     E V  GA +QAAILSG D+    +D+L++DV PL  GLE A G M +
Sbjct  343  FDNKELCLSVNADEVVCEGAAIQAAILSGLDK-RIFRDVLMMDVLPLPIGLEKADGEMEI  401

Query  231  LIPRNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR---  287
            L+P+N+ +P   T+ F T+ D+Q G+ +QV+EGE ++ ++N+ +  FN     P+PR   
Sbjct  402  LLPKNSRIPVTMTKYFETFEDDQRGLTVQVYEGENAVAQENDHICDFNF----PIPRDKI  457

Query  288  ---GVPQIDVTFDIDANGILNVSAVEKSTGKENKITITN  323
               G  +  VTF ++A+G+L V+A      +E  +++T+
Sbjct  458  GKAGEFKHPVTFTMNASGVLQVTAGIHHDSEETPMSLTS  496

>H257_04453
Length=423

 Score = 120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 111/217 (51%), Gaps = 40/217 (18%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V V ++  V ++ +  GN   PS VAF      L+G  A++   ++ ++
Sbjct  34   VGIDLGTTYSVVAVNRHGNVTVMPDANGNLLLPSIVAFKPHGGVLVGRDARHHRRVDPKH  93

Query  69   TIT--------------------------------------VTFKGESKTFQPEEISSMV  90
            TI+                                      ++  G      P +I   V
Sbjct  94   TISNAKRFIGRKFDATIEADASLYDFPLLGNTTGDHHVCFGLSVPGHPSCVSPVDIGYFV  153

Query  91   LTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +  ++E + A++G D +  AVI +PA F+ +QR+AT  A   AGL V  ++ EPTAAA+A
Sbjct  154  VKTLKETAMAYLGHDQIYGAVIAIPAGFDANQRKATVAAFERAGLKVRNVLVEPTAAALA  213

Query  150  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            YGL  K    NVL+FD GGGT DVSLL +++G F+ +
Sbjct  214  YGLHTKPNVHNVLVFDFGGGTLDVSLLYLQKGSFQVM  250

>SDRG_16559
Length=461

 Score = 120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 78/217 (36%), Positives = 110/217 (51%), Gaps = 39/217 (18%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAE  67
            SVGIDLGTTYS V V Q   V +I +  G    PS VAF D  E L+G +A+   + +  
Sbjct  69   SVGIDLGTTYSVVAVNQKGNVSVIPDASGYTLLPSIVAFKDGGEVLVGRSARQYRSQDPR  128

Query  68   NTI--------------------------------TVTFK-----GESKTFQPEEISSMV  90
            +TI                                 V F        ++   P ++ + +
Sbjct  129  HTIFNAKRFIGRAFDAAVETEASHYEFGLDRDEANRVCFPLSVTGHATRCASPIDVGAHI  188

Query  91   LTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +++++  +   +G D + +AVI VPA F+  QR AT  A   AGL V  ++ EPTAAA+A
Sbjct  189  VSQLKASAMRHLGHDQIYSAVIAVPASFDTDQRLATVAAFKAAGLKVANVLVEPTAAALA  248

Query  150  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            YGLD+K     VL+FD GGGT DVSLL ++ G FE +
Sbjct  249  YGLDRKPNVHYVLVFDFGGGTLDVSLLYLQNGSFEVI  285

>PHYSO_339667
Length=160

 Score = 113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 85/152 (56%), Gaps = 37/152 (24%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            VGIDLGTT S  GVW+N+ VEII N  G  +TPSYVAFTD+  L G+AAK Q   NAENT
Sbjct  8    VGIDLGTTCSRDGVWRNEDVEIIPNGDGAYSTPSYVAFTDTALLTGNAAKRQPTRNAENT  67

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 + V +KGE+K FQP EI +++L 
Sbjct  68   VFNIHQLIGRKFSDPALQLSIRYWPFKVECGPKDTAQVVVQYKGETKRFQPIEIVAILLC  127

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQA  124
            +MR+++E ++ ++V  AV+TVP  FN  QRQA
Sbjct  128  EMRKMAEIYLDQEVTKAVLTVPGSFNYFQRQA  159

>PYIW_19676
Length=664

 Score = 121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 130/541 (24%), Positives = 220/541 (41%), Gaps = 133/541 (25%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    + +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  93   KMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            KM+ ++ A    +V    AV++VP Y+ D QR+A  +A  IA LN LR+INE TA A+AY
Sbjct  124  KMQAIAAA-ANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAY  182

Query  151  GLDKKGGERNV---------LIFDLGGGTFDVSL-------LSIEEGIFEAVAFG-----  189
            G+ K    RN+         +  DLG  ++ VS+       L ++   F+    G     
Sbjct  183  GIYKSA--RNMFHESEPQYTMFIDLGHASYTVSVVAFVQGKLQVKSAAFDRFLGGRDFDY  240

Query  190  ---------------------ATVQAAILSGNDQSEKlqdlllldVTPLS----------  218
                                 A  +  +LS  ++S+K      +  T L+          
Sbjct  241  ALAKDAARQFQEKYKIDPLADAKARIKLLSACEKSKKNLSPQGVSATYLNIECLADDRDY  300

Query  219  QGLETAGGVMTVLIPRNTTVPTKKTQTFSTYADNQPGVLIQVFE--GERSMTRDNNL-LG  275
                T      ++  R    P  K  TF     ++   +  V++   +  +  D  L +G
Sbjct  301  HSQVTLEHNSIIIFGRQDDYPKTKRITFRR---DKAFSIDAVYDESAKTYLPADYGLTIG  357

Query  276  KFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE----------KSTGKENK-----  318
            KF + GIP + +G  +P+I V    D NG+ +V++ +             GKE +     
Sbjct  358  KFTVSGIPTLEKGAELPKIRVNVQQDVNGLFSVASSQLMQEIKEEEKADEGKEGETKDDK  417

Query  319  -------------ITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAY  365
                         + +  + G L+ AD+     +  K   +D   +     +N LE++ Y
Sbjct  418  PAEPKKKRFRKVDLKVVAEVGGLTTADVTVATEQELKMAHQDRIIEETFNKRNELESFVY  477

Query  366  NLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKELEGIANP  423
             +RN + D KL   I E ++ AI+DK+ E+ +WL + +   S K  ++AK  EL    +P
Sbjct  478  EMRNQVGD-KLVEFITESEKSAIEDKLNEVEDWLYSDEGFDSTKSVYQAKLDELRKTTSP  536

Query  424  I  424
            I
Sbjct  537  I  537

>H310_12260
Length=424

 Score = 118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 110/217 (51%), Gaps = 40/217 (18%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAF-TDSERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V V ++  V ++ +  G+   PS VAF  +   L+G  A++   ++ ++
Sbjct  34   VGIDLGTTYSVVAVNRHGNVTVMPDVHGHFLLPSVVAFKPNGGVLVGRDARHYRRVDPKH  93

Query  69   TIT----------------------------------VTF----KGESKTFQPEEISSMV  90
            TI+                                  V F     G      P +I   V
Sbjct  94   TISNAKRFIGRQFDESIAAEAALYDFPLLANTTGDSHVCFGLNLPGHPSCISPVDIGYYV  153

Query  91   LTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
            +  ++E + AF+G D +  AVI +PA F+ SQR+AT  A   AGL V  ++ EPTAAA+A
Sbjct  154  VKALKETAMAFLGHDQIYGAVIAIPAGFDASQRKATVAAFERAGLKVRNVLVEPTAAALA  213

Query  150  YGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            YGL  K     VL+FD GGGT DVSLL ++ G F+ +
Sbjct  214  YGLHTKPNVHYVLVFDFGGGTLDVSLLYLQNGSFQVM  250

>PYU1_G006843
Length=481

 Score = 118 bits (296),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 107/214 (50%), Gaps = 42/214 (20%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT---------------------  48
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF                      
Sbjct  80   VGIDLGTTYSVVAISQKNNVTVIPDVLGHVLIPSMVAFVPGGKVLVGRDARAHRTKDPAH  139

Query  49   ---DSERLIG----------DAAKNQVAMN-AENTIT------VTFKGESKTFQPEEISS  88
               +++R IG          DAA  + A++ A N +       V   G  K   P  I +
Sbjct  140  TIFNAKRFIGRTYEDVVQSKDAASYEFAVSKAPNDVHHGVCFPVNVPGHRKCVSPIAIGA  199

Query  89   MVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA  147
             ++  +R ++ AF+G + +  AVI VP  F+  QR AT+ A   AGL+V RI+ EPTAAA
Sbjct  200  TIVGHLRAMAHAFVGHNQITKAVIAVPVDFDGVQRAATQKAFFAAGLHVSRILEEPTAAA  259

Query  148  IAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            IAYGL +      +L+FD GGGT DVSLL    G
Sbjct  260  IAYGLHQDPSVNFILVFDFGGGTLDVSLLFTRAG  293

>HYAP_01856
Length=289

 Score = 113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 82/123 (67%), Gaps = 3/123 (2%)

Query  69   TITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGK--DVKNAVITVPAYFNDSQRQATK  126
             + V   G+    QPEE+ + VL +++  +EA+      + N VITVPAYF+DSQR+AT 
Sbjct  79   VLQVVRGGKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSDSQRKATL  138

Query  127  DAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
             + ++AG   +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE+G FE +
Sbjct  139  TSASMAGFKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIEDGKFEVL  197

Query  187  AFG  189
              G
Sbjct  198  GIG  200

>PHALS_09281
Length=465

 Score = 116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 109/220 (50%), Gaps = 43/220 (20%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V ++Q + V  IA+++G+   PS VA+  D   LIG  A+    ++ ++
Sbjct  70   VGIDLGTTYSVVAIFQKNNVTAIADNEGHVLVPSTVAYLPDGGVLIGREARTHRTIDPQH  129

Query  69   TI--------------------TVTFKGESKTFQ---------------------PEEIS  87
            TI                    T+ ++   K  Q                     P EI 
Sbjct  130  TIFNAKRFIGQSYDDVIKSENGTMPYEFNIKPLQRNEYDGICFALNLPNHPECVTPVEIG  189

Query  88   SMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAA  146
            + ++  +  ++  ++G + V  AV+ VP  FN+ QR ATK A   AGL V R++ EPTAA
Sbjct  190  TAIVRHLHFMAHRYVGHNQVTKAVVAVPVDFNEKQRNATKAAFRAAGLEVSRVLEEPTAA  249

Query  147  AIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            AIAYGL +      +L+FD GGGT DVSLL    G    V
Sbjct  250  AIAYGLHQDQNINFMLVFDFGGGTLDVSLLFARNGAITVV  289

>PPTG_17083
Length=304

 Score = 113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            EISSMV+ +M+E++EAF+G+ +  AV+T PAYFN+ QRQ+TKD  +I GL++ RI NE +
Sbjct  23   EISSMVVLRMKEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSITGLDLQRINNETS  82

Query  145  AAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSI  178
             AA+AYGLD   G      NV IF LGGGT DVS+LSI
Sbjct  83   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSI  120

 Score = 37.4 bits (85),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)

Query  214  VTPLSQGLETAGGVMTVLIPRNTTV  238
            VTPLSQG+ET G  M+VLI R T V
Sbjct  273  VTPLSQGIETVGKFMSVLIKRKTHV  297

>PPTG_04054
Length=324

 Score = 113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 73/98 (74%), Gaps = 4/98 (4%)

Query  85   EISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPT  144
            EISSMV+ +M E++EAF+G+ +  AV+T PAYFN+ QRQ+TKD  +IAGL++ RI NE +
Sbjct  29   EISSMVVLRMSEMAEAFLGQRISQAVVTAPAYFNNQQRQSTKDVVSIAGLDLQRINNETS  88

Query  145  AAAIAYGLDKKGG----ERNVLIFDLGGGTFDVSLLSI  178
             AA+AYGLD   G      NV IF LGGGT DVS+LSI
Sbjct  89   VAALAYGLDTNAGTDGKACNVQIFVLGGGTVDVSILSI  126

>PYAR_24704
Length=525

 Score = 116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 104/201 (52%), Gaps = 40/201 (20%)

Query  26   NDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI---------------  70
            N +V IIANDQG RTTP+YV F   E ++GD A N+V  +A NTI               
Sbjct  1    NGKVNIIANDQGFRTTPAYVCFEGDEVIVGDTAVNKVHSHAANTIFHLKRVLGKNHEDVA  60

Query  71   ----------------------TVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKN  108
                                    +  G      P E  S++L  ++ ++E F G+ V +
Sbjct  61   ASDFVSEWSFDVAKGADGAVVAKTSRNGADHEVTPVEFLSILLKNLKNLAEDFTGETVDS  120

Query  109  AVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLD---KKGGERNVLIFD  165
             VI++ A+  ++Q++    A A AG+NVL  ++EP AAAIAYGLD   K       ++ D
Sbjct  121  VVISLSAHGGENQKELISAAAAKAGVNVLSYLSEPLAAAIAYGLDENTKNSHAEYAVVVD  180

Query  166  LGGGTFDVSLLSIEEGIFEAV  186
            +GG T DV+L+SI++G+FE V
Sbjct  181  IGGATHDVTLVSIDKGLFEIV  201

 Score = 108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 93/149 (62%), Gaps = 11/149 (7%)

Query  184  EAVAFGATVQAAILS---GNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPT  240
            E VA GAT++AA +S     D +E  Q+ +   VTPL+  +  A G ++      T +PT
Sbjct  348  EVVAHGATLEAAAISELANFDPAESEQNNVA--VTPLTLSVALANGSVS-----ETVLPT  400

Query  241  KKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDA  300
              T+ F+T ADNQ  + IQV+EGER+M +DN LL +  +DGI P+P+G  +I+VTF + +
Sbjct  401  SATEVFTTSADNQDAIFIQVYEGERAMAKDNTLLAQLRVDGISPLPKGEAEIEVTFAVSS  460

Query  301  NGILNVSAVEKSTGKENKITITNDKGRLS  329
             G+L V+A E + GK+  + + ND  RL+
Sbjct  461  KGVLTVTANEAAAGKKT-LEVKNDGARLT  488

>PHYCA_120845
Length=444

 Score = 115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 105/216 (49%), Gaps = 44/216 (20%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V + + + V  IA+ +G+   PS VAF  D   L+G  A+     + ++
Sbjct  52   VGIDLGTTYSVVAISRKNNVTAIADSEGHVLVPSTVAFLPDGGVLVGREARVHRTTDPQH  111

Query  69   TI------------------------------------------TVTFKGESKTFQPEEI  86
            TI                                          +++ +G+     P +I
Sbjct  112  TIFNAKRFIGQSYVMTSETNEKGVTPYEFVVKQMHRDEHDGICFSLSLQGQPDCVTPVQI  171

Query  87   SSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  145
             + V+  +R ++  F+G D +  AVI VP  FN  QR+AT  A   AGL V R++ EPTA
Sbjct  172  GTSVVKHLRLMAHQFVGHDQITKAVIAVPVDFNQKQREATVAAFRGAGLEVSRVLEEPTA  231

Query  146  AAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            AAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  232  AAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNG  267

>PYIW_19956
Length=459

 Score = 115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 105/215 (49%), Gaps = 38/215 (18%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK-------NQV  62
            VGIDLGTTYS V + Q + V +I +  G+   PS VAF   E L+G  A+          
Sbjct  63   VGIDLGTTYSVVAIAQKNNVSVIPDAFGHVIIPSIVAFLPGEVLVGRQARAHRTRDPKHT  122

Query  63   AMNAENTITVTFK------------------------------GESKTFQPEEISSMVLT  92
              NA+  I  T+K                              G  K   P  I S +++
Sbjct  123  IFNAKRFIGRTYKDVVQSKDDASYEYTVARTPEGGVCFQLSVAGHPKCVTPVAIGSAIVS  182

Query  93   KMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
             +R ++  F+G D +  AVI VP  F+  QR AT+ A A AGL V R+++EPTAAAIAYG
Sbjct  183  HLRAMAHRFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRVLDEPTAAAIAYG  242

Query  152  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            L +      +L+FD GGGT DVSLL    G    V
Sbjct  243  LHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVV  277

>PHYRA_53570
Length=395

 Score = 114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 102/218 (47%), Gaps = 46/218 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V + Q + V  IA+D+G    PS VAF    E L+G  A+     + ++
Sbjct  1    VGIDLGTTYSVVAISQKNNVTAIADDEGYILVPSTVAFLPHGEMLVGREARAHRTTDPQH  60

Query  69   TI--------------------------------------------TVTFKGESKTFQPE  84
            TI                                            ++    +     P 
Sbjct  61   TIFNAKRFIGRKYDEVVRSEADSNGITPYEFVVKPAQGNVHGGVCFSLDLPEQPDCVTPV  120

Query  85   EISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            +I S V++ +R ++  F+G D +  AVI VP  F+  QR AT  A   AGL V R++ EP
Sbjct  121  QIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVEFDAQQRDATVAAFREAGLEVSRVLEEP  180

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            TAAAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  181  TAAAIAYGLHQDPNVSFLLVFDFGGGTLDVSLLFARNG  218

>SDRG_16621
Length=531

 Score = 115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 82/114 (72%), Gaps = 1/114 (1%)

Query  70   ITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAG  129
            +++       +  P E+++++L+++++ +EA + + + N V+TVPAYF + QRQAT +A 
Sbjct  84   VSIALPARKTSVTPSEVAALLLSELKKAAEAKLNERIANCVLTVPAYFTEPQRQATLEAA  143

Query  130  AIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIF  183
            A+AG + +R++NEPTAAA+AYGL   G +R V++FD GGGT DVS+L I +G F
Sbjct  144  AMAGFSAVRLLNEPTAAAMAYGLFVAGTKR-VVVFDFGGGTLDVSVLHIADGTF  196

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 80/131 (61%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E VA GA +QAAILSG D+ +  QD+L+LDV P+S G+E A G M VLIP+N+ +P   T
Sbjct  347  EVVAEGAAIQAAILSGVDK-KVFQDVLMLDVIPMSIGIEKADGAMEVLIPKNSRIPVSVT  405

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T  D+Q G  I+VFEGE  + R+N  L  F+      +PR      G  Q  VT  
Sbjct  406  KYFDTAVDDQAGFTIEVFEGESPVARENTYLTYFDF----VLPRKTRGKAGSIQHPVTLS  461

Query  298  IDANGILNVSA  308
            ++ANG+L V A
Sbjct  462  MNANGLLQVKA  472

>PPTG_09003
Length=449

 Score = 114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/218 (37%), Positives = 104/218 (48%), Gaps = 46/218 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT---------------------  48
            VGIDLGTTYS V + Q + V  I + +G    PS VAF                      
Sbjct  51   VGIDLGTTYSVVAISQKNNVTAIKDKEGYVLVPSTVAFLPHGGVLVGREARAHRTLDPQH  110

Query  49   ---DSERLIGDAAKNQVAMNA-ENTIT----------------VTF----KGESKTFQPE  84
               +++R IG +  + +A  A EN +T                V F     G+     P 
Sbjct  111  TVFNAKRFIGQSYGDVLASEADENGVTPYEFGVKMLQDNKHDGVCFTLDLSGQPGCVTPV  170

Query  85   EISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EI + V+  +R ++  F+G D +  AVI VP  FN  QR AT  A   AGL V R++ EP
Sbjct  171  EIGTAVVRHLRSMAHNFVGHDQITKAVIAVPVDFNARQRDATVAAFRAAGLEVSRVLEEP  230

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            TAAAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  231  TAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNG  268

>PHYKE_7077
Length=631

 Score = 115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 118/220 (54%), Gaps = 51/220 (23%)

Query  9    SVGIDLGTTYSCVGVWQNDR--VEIIAN--DQGNRTTPSYVAFTDS--------------  50
             +GIDLGTT SCVG+W  +R  V+I+ N  D+G RTTPS V F  +              
Sbjct  155  CLGIDLGTTNSCVGMWHVERNHVKILKNKEDRG-RTTPSVVRFDPTSQSVKTGNAAVALE  213

Query  51   ------------ERLIGDAAKNQVA----MNAENTITVTFKG-----------ESKTFQP  83
                        +RL+G   +++      M A   +  T  G           ++   QP
Sbjct  214  TSEPVENTVRSVKRLMGQKFESKAVDVARMYATYKVAPTIHGNVAIQVERGGKKAVVIQP  273

Query  84   EEISSMVLTKMREVSEAFI--GKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRII  140
            EE+S+ VL +++  +EA+   GK  + N VITVPAYF+DSQR+AT  + ++AG   +R++
Sbjct  274  EEVSACVLAELKASAEAYFEDGKTRLDNVVITVPAYFSDSQRKATITSASMAGFKAIRLL  333

Query  141  NEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEE  180
            NEPTAAA+AYGL    G + V +FD GG    + LLS EE
Sbjct  334  NEPTAAAMAYGL-FLSGTKLVTVFDFGGEKAKI-LLSSEE  371

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAILSG DQ    +D+L++DV PL  GLETA G M V++PRN  +PT  T
Sbjct  460  EVVCEGAAIQAAILSGMDQ-RVFRDVLMMDVLPLPIGLETADGTMEVILPRNARIPTTVT  518

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F T+ D+Q G+ ++V+EGE  + ++N+ +  FN      +PR      G     VTF 
Sbjct  519  KHFQTFEDDQRGLTVEVYEGENEIAKENDHISYFNF----ALPRDKIGKAGEFAHPVTFT  574

Query  298  IDANGILNVSA  308
            ++A+GIL V A
Sbjct  575  MNASGILQVQA  585

>PYAR_22140
Length=353

 Score = 112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 114/197 (58%), Gaps = 8/197 (4%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EAV  GA + A ILSG  + +   ++ ++ +T LS G+ETAGGVM  + PRN+    KK 
Sbjct  130  EAVVHGAAILAGILSGQVE-DGAGEMCIMPLTFLSLGMETAGGVMHRIFPRNSIYLAKK-  187

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDIDAN-G  302
            +T ST   NQ  + I+VFEGER +T++N+ LG+  L G+ P P GVP+I+V F+ID +  
Sbjct  188  RTVSTLRANQTELTIRVFEGERILTKNNHFLGQLKLKGLSPAPPGVPRIEVQFEIDVDYD  247

Query  303  ILNVSAVEKSTGKENKITI-----TNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAK  357
            ++ +SA    +     +TI     +    R+   + + ++ EAE+ K ED   K RIE  
Sbjct  248  MMVISAQAMGSTLSENVTIRLVENSLAYKRMKSEEYDTLLEEAERAKDEDTKAKSRIEQY  307

Query  358  NGLENYAYNLRNTLNDE  374
              + ++A +  +  +DE
Sbjct  308  LAIRDHALHGPSEQDDE  324

>PITG_17383
Length=438

 Score = 112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/218 (35%), Positives = 101/218 (46%), Gaps = 46/218 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQVAMNAEN  68
            VGIDLGTTYS V + Q + V  IA+  G+   PS VAF  S   L+G  A+     + ++
Sbjct  38   VGIDLGTTYSVVAISQKNNVTAIADKNGHVLVPSTVAFLPSGAVLVGREARAHRTTDPQH  97

Query  69   TI--------------------------------------------TVTFKGESKTFQPE  84
            TI                                            T+  +   K   P 
Sbjct  98   TIFNAKRFIGQSYEDVLTSEADENGGTPYEFSVKMLRDNEHDGVCFTLDLQDHPKCVTPV  157

Query  85   EISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
             I + V+  +R ++  F+G + +  AVI VP  FN+ QR AT  A   AGL V R++ EP
Sbjct  158  NIGTAVVQHLRSMAHQFVGHEQITKAVIAVPVDFNNRQRDATVAAFRAAGLAVSRVLEEP  217

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            TAAAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  218  TAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARNG  255

>HYAP_01857
Length=492

 Score = 113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 82/116 (71%), Gaps = 3/116 (3%)

Query  76   GESKTFQPEEISSMVLTKMREVSEAFI-GK-DVKNAVITVPAYFNDSQRQATKDAGAIAG  133
            G+    QPEE+ + VL +++  +EA+  G+  + N VITVPAYF+DSQR+AT  + ++AG
Sbjct  76   GKRVQVQPEEVVASVLAELKASAEAYFDGQLSIDNVVITVPAYFSDSQRKATLTSASMAG  135

Query  134  LNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFG  189
               +R++NEPTAAA+AYGL    G++ V +FD GGGT DVSLL IE+G FE +  G
Sbjct  136  FKAVRLLNEPTAAAMAYGL-FLSGKKLVTVFDFGGGTLDVSLLRIEDGKFEVLGIG  190

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 79/131 (60%), Gaps = 11/131 (8%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            E V  GA +QAAIL G DQ    +D+L++DV PL  GLETA G M V++P+N  +PT  T
Sbjct  334  EVVCEGAAIQAAILCGVDQ-RVFRDVLMMDVLPLPIGLETADGSMEVILPKNARIPTTMT  392

Query  244  QTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPR------GVPQIDVTFD  297
            + F TY DNQ G+ ++V+EGE  + ++ + +  FN      +PR      G     VTF 
Sbjct  393  KYFQTYEDNQRGLTVEVYEGENKIAKECDHICYFNF----VLPRDKIGKAGEFAHPVTFT  448

Query  298  IDANGILNVSA  308
            ++ANGIL V A
Sbjct  449  MNANGILQVRA  459

>PYIR_21692
Length=468

 Score = 109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/227 (35%), Positives = 106/227 (47%), Gaps = 43/227 (19%)

Query  3    QSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDS-ERLIGDAAKNQ  61
            Q    A VGIDLGTTYS V + Q + V +I +  G+   PS VAF    + L+G  A+  
Sbjct  60   QCTYMALVGIDLGTTYSVVAISQKNNVSVIPDAFGHVIIPSIVAFLPGGDVLVGRQARAH  119

Query  62   VAMNAENTI-----------------------------------------TVTFKGESKT  80
               + E+TI                                          ++  G  K 
Sbjct  120  RTKDPEHTIFNAKRFIGRIYDDVKQSKDDESYEYTVARASLSEPESGVCFQLSLPGHPKC  179

Query  81   FQPEEISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRI  139
              P  + S ++  +R ++ +F+G D +  AVI VP  F+  QR AT+ A A AGL V RI
Sbjct  180  VTPVSVGSAIVRHLRAMAHSFVGHDQITKAVIAVPVDFDAKQRAATQQAFAAAGLQVSRI  239

Query  140  INEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            + EPTAAAIAYGL +      +L+FD GGGT DVSLL    G    V
Sbjct  240  LEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFTRSGSISVV  286

>PYAP_21865
Length=481

 Score = 109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 109/231 (47%), Gaps = 59/231 (26%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT--------------------  48
            +VGIDLGTTYS V + QN+ V +I ++ G+  TPS VA+                     
Sbjct  72   TVGIDLGTTYSVVAISQNNSVTVIPDEHGHLITPSIVAYLPNGRREARAYRTKDPRHTIF  131

Query  49   DSERLIGDAAKNQVAMNAENT---------------ITVTFK----GESKTFQPEEISSM  89
            +++R IG + ++ V+ +A  T                TV F+    G      P ++ + 
Sbjct  132  NAKRFIGRSFRD-VSDDASTTWPYEFTIKRYGEHDNATVCFELETVGHPNCISPVDVGTR  190

Query  90   VLTKMREVSEAFIGKD-------------------VKNAVITVPAYFNDSQRQATKDAGA  130
            ++  ++ ++  F+G +                   +  AVI VP  F+  QR AT  A  
Sbjct  191  IVQHLKTLAWRFVGHNQMGMIDNLLSGLTHNYCGQINRAVIAVPVDFDSKQRSATVAAFN  250

Query  131  IAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
             AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  251  AAGLKVSRVLEEPTAAAIAYGLHQDASVNFILVFDFGGGTLDVSLLFARSG  301

>CCA27145
Length=463

 Score = 108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 103/223 (46%), Gaps = 46/223 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFT---------------------  48
            +GIDLGTTYS V + Q++ V II +   +   PS V F                      
Sbjct  59   IGIDLGTTYSVVAISQHNNVTIIPDRHHHTLIPSIVTFLPEGALLVGRQARAYRTKDPRH  118

Query  49   ---DSERLIG-----------------DAAKNQVAMNAEN----TITVTFKGESKTFQPE  84
               +++R IG                 +  +N+ A   E+      +++  G      P 
Sbjct  119  TIYNAKRFIGRSYNESIQAAEPYGFSIEPFRNESASEPESLPGPCFSLSVSGHPACVTPI  178

Query  85   EISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EI S+++  +  ++  F+  + +   VI VP  F  +QR+AT  A   AGL V R++ EP
Sbjct  179  EIGSLIIRHLHLMAHEFVKHNQLDRVVIAVPVDFKPAQRRATVQAYEKAGLKVARVLEEP  238

Query  144  TAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAV  186
            TAAAIAYGL +      +L+FD GGGT DVSLL +  G    V
Sbjct  239  TAAAIAYGLHQAPNVNFILVFDFGGGTLDVSLLFVRSGSISVV  281

>PHYRA_42335
Length=88

 Score = 97.4 bits (241),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 61/94 (65%), Gaps = 6/94 (6%)

Query  289  VPQIDVTFDIDANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDE  348
            +P+      IDAN IL+VS VEKSTGKENKIT   D G       +RMV E EKY SEDE
Sbjct  1    LPKPRAELQIDANEILDVSVVEKSTGKENKITTIADSGX------DRMVLEPEKYTSEDE  54

Query  349  ANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPE  382
             N +RIEAK  L NYAY +RN+LND  L+  I E
Sbjct  55   TNMVRIEAKTALTNYAYEMRNSLNDTLLEPSISE  88

>SDRG_01067
Length=611

 Score = 105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 71/216 (33%), Positives = 102/216 (47%), Gaps = 38/216 (18%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK-------NQ  61
             V ID+GT+   VGVW+N RV ++A D G  + P+ VAFTD+  L G  AK         
Sbjct  7    CVAIDIGTSRVRVGVWRNGRVHVLALD-GAESLPAVVAFTDTLTLFGHQAKAYAQDHPTN  65

Query  62   VAMNAENT------------------------------ITVTFKGESKTFQPEEISSMVL  91
            V  NA                                 I V  +  + T+ P+EI +M+L
Sbjct  66   VVSNALQLLGRRMNDPIVQAAVAGAPFRIRASSDKTPLICVQHQRSACTYYPQEIIAMLL  125

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
              +R  +E  +G  + +AV+TVPA +  SQRQA  DA  +AG  V R+++  TAAAIA  
Sbjct  126  EHVRTSAECHLGSCLDHAVVTVPATYTTSQRQAIVDAATMAGWTVDRLLSATTAAAIAQV  185

Query  152  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
                  +R +L+ D G      S+++ E   F A A
Sbjct  186  HATGADKRRLLVVDAGASAVTASVVTAEYDTFTAHA  221

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 94/191 (49%), Gaps = 9/191 (5%)

Query  238  VPTKKTQTFSTYADNQPG-VLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTF  296
            VP        T+  N  G  ++ ++EG+   +  ++L G+++++ +    R    IDV F
Sbjct  415  VPVLSGTATHTFQSNGSGPFVLLMYEGDVGFSDSSHLQGRWHIETL----RSTRFIDVAF  470

Query  297  DID-ANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIE  355
             ID   G+L V+A +KST  +  +++ N     S+  ++ + A+A           +   
Sbjct  471  VIDEGTGVLRVAAFDKST--QEGLSVVNSDSATSRRKLQHLCAQAMARHHIARQKVLLAR  528

Query  356  AKNGLENYAYNLRNTLN-DEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQ  414
            AK    ++ Y+LR+T + DE  + ++ +  R  +DD +   I WL  +  +  EE++  +
Sbjct  529  AKAAANDFTYSLRSTWHSDEASRHRVGDPSRDELDDALAAAIKWLLLNPNATIEEYDDVR  588

Query  415  KELEGIANPIL  425
             +LE ++  +L
Sbjct  589  VQLETVSRRVL  599

>SDRG_01068
Length=621

 Score = 103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 113/238 (47%), Gaps = 49/238 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQ-GNRTTPSYVAFTDSERLIG-------------  55
            + ID+GT+   VGVW+NDRVE++A D  G    P+YVAFTD+ RL+G             
Sbjct  5    IAIDIGTSNLRVGVWRNDRVELLALDSDGATALPAYVAFTDAGRLVGRRAKAYAATDAAN  64

Query  56   ----------------------DAAKNQVAMNAENT--ITVTFKGESKTFQPEEISSMVL  91
                                  D    QV  ++++   + VT  G+  TF  EE    VL
Sbjct  65   VVFRMTRFLGRSMRDRGVRADCDKVPFQVVASSDDKPQVRVTLNGQPSTFDLEE----VL  120

Query  92   TKMREVSEAFIGKD--VKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIA  149
              + E ++A + +   V    +TVPA F  +QR A  DA AIAGLNV +++N PTAA + 
Sbjct  121  ATLLEHTKAMVDEQLTVGYVTLTVPAAFTTTQRHAVLDAAAIAGLNVRKLLNAPTAALVT  180

Query  150  Y--GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEK  205
            Y     +   ER VL    G G+  V++   E  +  AV   AT   A L G D  E+
Sbjct  181  YMNMHPRMREERTVLTVTAGAGSLGVAITVDESALSTAV---ATSGNAHLGGLDIDER  235

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 89/192 (46%), Gaps = 16/192 (8%)

Query  246  FSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ---IDVTFDI-DAN  301
            F+T A NQP + + V+EG       ++L GK+    + P+P G+P+   + V F I  A 
Sbjct  425  FTTQA-NQPDITLLVYEGLLGQRDTSHLQGKWR---VGPLPNGIPRGATVQVGFQICHAT  480

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            G L +SA    T  +  I  TN+    ++  + R++ EA   +  D    I         
Sbjct  481  GTLQISA----TVDDKPIPATNELAPTTRGRMCRLIQEAATRRQVDGRQHIHAARAAAKA  536

Query  362  ---NYAYNLRNTLNDEKL-QSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKEL  417
                Y   LR   + + + ++++ E  R  +DD +   + WL  H  +   E+E  + +L
Sbjct  537  AATEYTMRLREAWHGDAISRNRVSEVTRDELDDALALALKWLILHPNANTVEYEVVRFKL  596

Query  418  EGIANPILQKMY  429
            E + + +++ +Y
Sbjct  597  EAVGSRVVEALY  608

>SPRG_00183
Length=609

 Score = 102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/249 (29%), Positives = 113/249 (45%), Gaps = 41/249 (16%)

Query  9    SVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAK-------NQ  61
             + ID+G +   VGVW+N R  ++A D  N   P+ VAFTD+  L G+ AK         
Sbjct  7    CIAIDIGASTIRVGVWRNGRATVLALDGAN-GLPAVVAFTDTTTLFGNQAKAIAQNDPTN  65

Query  62   VAMNAENT------------------------------ITVTFKGESKTFQPEEISSMVL  91
            V  N  +                               I V  +  + T+ P+EI  M+L
Sbjct  66   VVFNVLHLLGRRMNDPTVQAMVTSAPFRIIASSDKTPLIHVQHRRSACTYYPQEIVGMLL  125

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
               ++++E  +G  + +AV+TVPA +  SQRQA  DA  +AGL V R+++  TA  IA+ 
Sbjct  126  EHAKKLAEDHLGACLDHAVVTVPATYTTSQRQAVLDAATMAGLTVDRLLSATTAVGIAHT  185

Query  152  LDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAAILSGNDQSEKlqdlll  211
                  +R +L+ D G  +   S+++ E   F A A  +  Q   L G     +L    +
Sbjct  186  QATGASKRKLLVVDAGASSVTASVVTAEHDTFTAHASASDTQ---LGGFAMDARLAAHCM  242

Query  212  ldVTPLSQG  220
               TP ++G
Sbjct  243  STWTPSTRG  251

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/247 (24%), Positives = 120/247 (49%), Gaps = 14/247 (6%)

Query  184  EAVAFGATVQ-AAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKK  242
            EAV  GA +  A+  + +D + +   +     TP+      A G     + R+  + +  
Sbjct  364  EAVVAGAALYIASTTASSDATVRPFAIHDALSTPI---WAAAAGHHWTTVFRSPALSSMA  420

Query  243  TQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQIDVTFDID-AN  301
            T TF +   + P VL+ V+EG+      ++L G+++++ +P        IDV F +D   
Sbjct  421  THTFVS-TGSSPFVLL-VYEGDVGFPASSHLQGQWHIESLP----HTRFIDVAFVVDECT  474

Query  302  GILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
            G+L V+A +KS+ K   + +TN     S+ +++ + A+A           +   AK    
Sbjct  475  GVLRVTASDKSSQK--ALPVTNTDCATSRRELQHLCAQATARYHTTRQTVLLARAKAAAN  532

Query  362  NYAYNLRNTLN-DEKLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQKELEGI  420
            ++ Y+LR+T + DE  + ++ +  R  +DD +   I WL  H  +  ++++  + +LE +
Sbjct  533  DFTYSLRSTWHSDEASRRRVGDAARDELDDALAAAIKWLLLHPQATIDQYDDVRVQLEAV  592

Query  421  ANPILQK  427
            +  +L +
Sbjct  593  SRRVLAR  599

>HYAP_04460
Length=818

 Score = 101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 107/226 (47%), Gaps = 47/226 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSMARMHYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I +T+  E  TF  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFKHPEVQQELQQLAFTCVELSSGDVGIVLTYNDEPVTFSCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G      V++ P Y+ D QRQA  +A  IAGLN LR++NE TA A+AYG
Sbjct  124  KMQHIAAAANEGVTPAYCVLSCPGYYTDVQRQALLNASKIAGLNCLRLMNEHTAIALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEG--IFEAVAF  188
            + K           ++V+  D+G  ++ V++++  +G    ++VAF
Sbjct  184  IYKSARNLFHETEPQHVMFIDVGHASYTVAVVAFVQGRLTVKSVAF  229

 Score = 42.4 bits (98),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 80/197 (41%), Gaps = 47/197 (24%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  310
            +GK+ + G+P    G  VP+I V    D NG+ +V++ +                     
Sbjct  492  IGKYTILGMPAQEAGAEVPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPADTEGDEKMD  551

Query  311  ---------------------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEA  349
                                 K   ++ ++ + +  G LS  D+     +  K   +D  
Sbjct  552  EKKEDESKKDDKKEDKVAGPKKKRFRKVELIVQSQVGGLSTTDVSSATEQELKMAQQDRV  611

Query  350  NKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEK  407
             +     +N LE++ Y +RN + D KL + I  D++  ++ K+ +  +WL   +   S K
Sbjct  612  IEDTFNKRNELESFVYEMRNQITD-KLAAFITSDEKSNLEKKLVDTEDWLYTDEGFDSTK  670

Query  408  EEFEAKQKELEGIANPI  424
              ++ K  ++  +++P+
Sbjct  671  SVYQQKLDDMRKLSSPV  687

>PHYSO_285382
Length=379

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/181 (36%), Positives = 94/181 (52%), Gaps = 26/181 (14%)

Query  26   NDRVEIIAND--QGNRTT-PSYVAFTDSERLIG----DAAKNQVAMNAENTITVT-----  73
            +D  E+I     + +RTT P++  F +++R IG    D  +++V  N  +    T     
Sbjct  19   DDGAEVIVGRKARAHRTTDPTHTIF-NAKRFIGRSFDDVGESEVDSNGVSPYEFTVKPVL  77

Query  74   ------------FKGESKTFQPEEISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDS  120
                        F G+     P +I S V++ +R ++  F+G D +  AVI VP  FN  
Sbjct  78   DNAHDGVCFALGFPGQQDCVTPVQIGSAVVSHLRSMAHRFVGHDQITKAVIAVPVDFNAR  137

Query  121  QRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEE  180
            QR AT  A  +AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    
Sbjct  138  QRDATVAAFRVAGLEVSRVLEEPTAAAIAYGLHQDPNVSFMLVFDFGGGTLDVSLLFARN  197

Query  181  G  181
            G
Sbjct  198  G  198

>PHALS_04095
Length=803

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 102/217 (47%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E++ +M+L 
Sbjct  64   ATDLKRLIGRKFKHPEVQKEIAQLAYTCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  93   KMREV-SEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ + S A  G +    V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIASAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEG  181
            + K           ++V+  DLG  ++ VS+++  +G
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQG  220

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 39/187 (21%), Positives = 78/187 (42%), Gaps = 37/187 (20%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  310
            +GK+ + G+P    G  +P+I V    D NG+ +VS+ +                     
Sbjct  488  IGKYTISGMPSQEAGTEIPKIRVNVQQDMNGLFSVSSSQLMQEILEEEKPAVADGAEVEG  547

Query  311  -----------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNG  359
                       K   ++ ++++      LS  D+     +  K   +D   +     +N 
Sbjct  548  EKKDDKPVEPKKKRFRKVELSVHAAVSGLSAGDVAAATEQELKMAQQDRVIEETFNKRNE  607

Query  360  LENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWL--DAHQASEKEEFEAKQKEL  417
            LE++ Y +RN + D KL   I   ++  ++ K+TE  +WL  D    S K  ++ K  ++
Sbjct  608  LESFVYEMRNQITD-KLAGFITSGEKSNLESKLTETEDWLYTDEGFDSTKSVYQQKLDDM  666

Query  418  EGIANPI  424
              +++P+
Sbjct  667  RKLSSPV  673

>SPRG_00182
Length=615

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 99/205 (48%), Gaps = 43/205 (21%)

Query  12   IDLGTTYSCVGVWQNDRVEIIAND-QGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENTI  70
            +D+GT+   VGV +N+RVE++A D  G    P+YVAFTDS RL G  AK   A   EN I
Sbjct  7    LDIGTSSLRVGVKRNNRVELLALDGDGATAMPAYVAFTDSGRLFGRRAKAYAASAPENVI  66

Query  71   -------------------------------------TVTFKGESKTFQPEEISSMVLTK  93
                                                  VT  G+  TF  EE+ +M+L  
Sbjct  67   FRMLRFLGGSMRDLNVRADCDKVPFRVVASSDDKPQVRVTVNGQPSTFDLEEVMAMLLEH  126

Query  94   MREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL-  152
             + + +  +   V++  +TVPA F  +QR+A  DA AIAGL V +++N PTAA +AY   
Sbjct  127  TKAMVDEQLA--VRHVTLTVPASFTTTQRRAVLDAAAIAGLTVRKLLNAPTAALVAYMAT  184

Query  153  --DKKGGERNVLIFDLGGGTFDVSL  175
               +   +R V+    G G+  V++
Sbjct  185  HPSRMHQDRTVVTVTAGAGSLGVAI  209

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 96/204 (47%), Gaps = 15/204 (7%)

Query  234  RNTTVPTKKTQTFSTYADNQPGVLIQVFEGERSMTRDNNLLGKFNLDGIPPMPRGVPQ--  291
            R +T     T+ F T  + Q  + + V+EG       ++L GK+    + P+P+ +P+  
Sbjct  406  RGSTEYFSTTEDFYTTQNKQSDITLLVYEGLVGQRETSHLQGKWR---VGPLPKSIPRGA  462

Query  292  -IDVTFDI-DANGILNVSAVEKSTGKENKITITNDKGRLSQADIERMVAEAEKYKSED--  347
             + V+F I DA G L+VSA     GKE  I   N+    ++  + R++ EA   +  D  
Sbjct  463  SVQVSFQILDATGTLDVSATVD--GKE--IPTANELAPTTRGRMRRLIEEAATRRRVDGG  518

Query  348  -EANKIRIEAKNGLENYAYNLRNTLN-DEKLQSQIPEDDRKAIDDKVTEIINWLDAHQAS  405
               N  R  AK     Y   LR   + D   ++++ E  R  +DD +   + WL  +  +
Sbjct  519  QVVNAARAAAKAATTEYTMRLREAWHGDAVSRNRVSEATRDELDDALAVALKWLILNPNA  578

Query  406  EKEEFEAKQKELEGIANPILQKMY  429
               E+ A + +LE + + +++ ++
Sbjct  579  TIVEYNAVRFQLEAVGSRVIEGLW  602

>PPTG_19375
Length=809

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 102/217 (47%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYKCVELASGDVGIVLNYNDEPVTFSCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G +    V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEG  181
            + K           ++V+  DLG  ++ VS+++  +G
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQG  220

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 80/188 (43%), Gaps = 38/188 (20%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAV--------------------EK  311
            +GKF + G+P    G  +P+I V    D NG+ +VS+                     E 
Sbjct  491  IGKFTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEAEGEQKEG  550

Query  312  STGKENK-------------ITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKN  358
               KE+K             +T+    G LS AD+     +  K   +D   +     +N
Sbjct  551  EDKKEDKPAEPKKKRFRKIELTVQAQVGGLSVADVTTATEQELKMAQQDRVIEETFNKRN  610

Query  359  GLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKE  416
             LE++ Y +RN + D KL   I  D++  ++ K+ E  +WL   +   S K  ++ K  +
Sbjct  611  ELESFVYEMRNQITD-KLAGFITSDEKNTLESKLMETEDWLYTDEGFDSTKSVYQQKLDD  669

Query  417  LEGIANPI  424
            +  +++P+
Sbjct  670  MRKLSSPV  677

>HYAP_01510
Length=138

 Score = 90.9 bits (224),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 0/61 (0%)

Query  70   ITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAG  129
            ITV FK ES TFQP EISSMVL KMRE++EA+IGK VKNAV+TVPAYFND QR  +  A 
Sbjct  65   ITVQFKRESNTFQPGEISSMVLIKMREIAEAYIGKQVKNAVMTVPAYFNDLQRTLSSLAQ  124

Query  130  A  130
            A
Sbjct  125  A  125

>PHYKE_6664
Length=804

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 111/241 (46%), Gaps = 56/241 (23%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I +++  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIAQLAYECVELASGDVGIVLSYNDEPVTFSCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G +    V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALMNATKIAGLNCLRLINEHTAIALAFG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAA----ILSGN  200
            + K           ++V+  DLG  ++ VS+++  +G         TVQ+A     L G 
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSIVAFVQGRL-------TVQSAAFDRFLGGR  236

Query  201  D  201
            D
Sbjct  237  D  237

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/184 (20%), Positives = 81/184 (44%), Gaps = 34/184 (18%)

Query  274  LGKFNLDGIPPMPRGV--PQIDVTFDIDANGILNVSAVE---------------------  310
            +GK+ + G+P    G   P+I V    D NG+ +VS+ +                     
Sbjct  491  VGKYTISGMPAQDAGAEAPKIRVNVQQDMNGLFSVSSSQLMQEIKEEEKPAEEKEGEEKV  550

Query  311  --------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLEN  362
                    K + ++ ++T+    G L+ AD+     +  K   +D   +     +N LE+
Sbjct  551  EDKPAEPKKKSFRKIELTVQAQVGGLTTADVSAATEQELKMAQQDRVIEDTFNKRNELES  610

Query  363  YAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKELEGI  420
            + Y +RN ++D +L   I  +++  +++++ E  +WL   +   S K  ++ K   +  +
Sbjct  611  FVYEMRNQISD-RLAGFITAEEKSKLEEQLMETEDWLYTDEGFDSTKSVYQTKLDGMRKL  669

Query  421  ANPI  424
            ++P+
Sbjct  670  SSPV  673

>PYVX_13288
Length=810

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 105/225 (47%), Gaps = 49/225 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAISVARMHYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E+I +MVL 
Sbjct  64   ATDIKRLIGRKFKHPEVQREIAQLAYPCVELANGDVGIVLQYNDEPVTFSCEQIVAMVLN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G +   AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVNPAYAVLSCPGFYTDVQRRAVLNASKIAGVNCLRLLNEHTAVALAYG  183

Query  152  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            + K    RN         V+  D+G  ++ VS+++  +G  +  A
Sbjct  184  IYKSA--RNLFHESEPQYVMFIDIGHASYTVSIIAFVQGKLQVKA  226

>PHYCA_111740
Length=810

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 110/241 (46%), Gaps = 56/241 (23%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   IT-------------------------------------VTFKGESKTFQPEEISSMVLT  92
             T                                     + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQEIKQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G +    V++ P ++ D QR+A  +A  IAGLN LR+INE T+ A+AYG
Sbjct  124  KMQSIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTSIALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEAVAFGATVQAA----ILSGN  200
            + K           ++V+  DLG  ++ VS+++  +G         TVQ+A     L G 
Sbjct  184  IYKSARNLFHESEPQHVMFIDLGHASYTVSIVAFVQGRL-------TVQSAAFDRFLGGR  236

Query  201  D  201
            D
Sbjct  237  D  237

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/191 (21%), Positives = 80/191 (42%), Gaps = 41/191 (21%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  310
            +GK+ + G+P    G  +P+I V    D NG+ +V++ +                     
Sbjct  490  IGKYTISGMPAQEAGAEIPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAEAEGDKKEG  549

Query  311  ---------------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIE  355
                           K   ++ ++T+    G LS AD+     +  K   +D   +    
Sbjct  550  EEKDEKKDDKPAEPKKKRFRKIELTVQAQVGGLSPADVSTATEQELKMAQQDRVIEETFN  609

Query  356  AKNGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAK  413
             +N LE++ Y +RN + D KL   I  D++  ++ K+ E  +WL   +   S K  ++ K
Sbjct  610  KRNELESFVYEMRNQITD-KLAGFITGDEKSNLETKLMETEDWLYTDEGFDSTKSVYQQK  668

Query  414  QKELEGIANPI  424
              ++  +++P+
Sbjct  669  LDDMRKLSSPV  679

>PYAR_15468
Length=769

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 104/217 (48%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G T   +G  +   ++II N+  NR  P+ V F   +R IG+AA +    + +NT
Sbjct  4    IGLDFGNTDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   IT-------------------------------------VTFKGESKTFQPEEISSMVLT  92
             T                                     + +  E+ TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAFPCVELPNGDVGVVLRYNDEAVTFTCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQNIAAAANEGVRPAYAVLSCPGFYTDVQRRALLNAAKIAGVNCLRLLNEHTAVALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEG  181
            + K           ++V+  D+G  ++ VS+++  +G
Sbjct  184  IYKSARNLFAESEPQHVMFIDMGHASYTVSVVAFVQG  220

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 38/188 (20%)

Query  274  LGKFNLDGIPPMPRGVPQIDVTFDIDANGILNVSAVE----------------------K  311
            LGK+ + GIP     +P+I V    D NGI +V++ +                      K
Sbjct  454  LGKYTISGIPKTGDEIPKIRVNVQQDLNGIFSVASSQLMQEIKEEEKSAEEAKEGADEAK  513

Query  312  STGKENK-------------ITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKN  358
                E+K             + +  D   LS  +I     +      +D   +     +N
Sbjct  514  DKAAEDKPAEPKKKRFRKVELKVDADVPGLSPQEISSATEQELAMAHQDRVIEETFNKRN  573

Query  359  GLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKE  416
             LE++ Y++RN +  E+L   I E ++ +++DK+TE  +WL + +   S K  ++ K  E
Sbjct  574  ELESFVYDMRNHIT-ERLAEYISESEKASLEDKLTEAEDWLYSDEGFDSTKSVYQGKLDE  632

Query  417  LEGIANPI  424
            L  +++P+
Sbjct  633  LRKLSSPV  640

>PHYRA_82545
Length=806

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 102/217 (47%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +   M+ +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISMARMHYKNT  63

Query  70   IT-------------------------------------VTFKGESKTFQPEEISSMVLT  92
             T                                     + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQQELAQLAYKCVELASGDVGVVLNYNDEPVTFSCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G +    V++ P ++ D QR+A  +A  IAGLN LR+INE TA A+A+G
Sbjct  124  KMQNIAAAANEGVNPAYCVLSCPGFYTDVQRRALLNATKIAGLNCLRLINEHTAIALAFG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEG  181
            + K           ++V+  DLG  ++ VS+++  +G
Sbjct  184  IYKSARNLFHETEPQHVMFIDLGHASYTVSVVAFVQG  220

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/189 (23%), Positives = 81/189 (43%), Gaps = 39/189 (21%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSA-----------------------  308
            +GK+ + G+P    G  VP+I V    D NG+ +V++                       
Sbjct  490  VGKYTISGMPAQEAGAEVPKIRVNVQQDMNGLFSVASSQLMQEIKEEEKPAETEGEEKKE  549

Query  309  ---------VEKSTGKENKI--TITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAK  357
                     VE    +  KI  T+ +  G LS AD+     +  K   +D   +     +
Sbjct  550  GEEKKEDKPVEPKKKRFRKIELTVQSQVGGLSTADVSTASEQELKMAQQDRVIEETFNKR  609

Query  358  NGLENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWL--DAHQASEKEEFEAKQK  415
            N LE++ Y +RN ++D KL   I  +++  ++ K+ +  +WL  D    S K  ++ K  
Sbjct  610  NELESFVYEMRNQISD-KLAGFITSEEKGNLETKLNDTEDWLYTDEGFDSTKSVYQQKLD  668

Query  416  ELEGIANPI  424
            ++  +++P+
Sbjct  669  DMRKLSSPV  677

>PYU1_G008851
Length=795

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/219 (30%), Positives = 102/219 (47%), Gaps = 49/219 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    + +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAVSVARAHFKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E+I +MVL 
Sbjct  64   ATDVKRLIGRKFKHPEVQQEIAQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQIVAMVLN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G     AV++VP Y+ D QR+A  +A  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQAIAAAANDGVQPGYAVVSVPGYYTDVQRRALLNASKIAGLNTLRLINEHTAIALAYG  183

Query  152  LDKKGGERNV---------LIFDLGGGTFDVSLLSIEEG  181
            + K    RN+         +  D+G  ++ VS+++  +G
Sbjct  184  IYKSA--RNMFHESEPQYTMFIDIGHASYTVSIVAFVQG  220

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 85/185 (46%), Gaps = 32/185 (17%)

Query  271  NNLLGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------------  310
            N  +GKF + GIP + +G  +P+I V    D NG+  V++ +                  
Sbjct  486  NTTIGKFTVSGIPELEKGAELPKIRVNVQQDINGLFAVASSQLMQEIKEEEKPAEEGKEG  545

Query  311  ---------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLE  361
                     K   ++  + +T + G LS +D+     +  K   +D   +     +N LE
Sbjct  546  EAEKPTEPKKKRFRKVDLKVTAEVGGLSSSDVLAATEQELKMAHQDRIIEETFNKRNELE  605

Query  362  NYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKELEG  419
             + Y +RN ++D KL   + + ++ A++DK+ E+ +WL + +   + K  ++AK  EL  
Sbjct  606  TFVYEMRNQVSD-KLAEFVTDSEKAALEDKLNEMEDWLYSDEGFDTTKSVYQAKLDELRQ  664

Query  420  IANPI  424
              +P+
Sbjct  665  STSPL  669

>PYAP_18643
Length=804

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 60/223 (27%), Positives = 104/223 (47%), Gaps = 45/223 (20%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V F   +R IG+AA +    + +NT
Sbjct  4    IGLDFGNVDCVIGQAKRGGIDIILNENSNRKNPNLVCFQGKQRFIGEAAVSVARAHFKNT  63

Query  70   IT-------------------------------------VTFKGESKTFQPEEISSMVLT  92
             T                                     + +  E  TF  E++ +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQKEIAQLAYKCVELPNGDVGVVLNYNDEPVTFTCEQVVAMILN  123

Query  93   KMREVSEAF-IGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++ A   G     AV++ P ++ D QR+A  +A  IAG+N LR++NE TA A+AYG
Sbjct  124  KMQAIAAAANEGVRPAYAVMSCPGFYTDVQRRALLNATKIAGMNCLRLLNEHTAIALAYG  183

Query  152  LDKKGGE-------RNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            + K           ++V+  D+G  ++ VS+++  +G  +  A
Sbjct  184  IYKSARNLFHESEPQHVMFIDMGHASYTVSIVAFVQGKLQVKA  226

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 82/186 (44%), Gaps = 36/186 (19%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE---------------------  310
            LGK+ + G+P   +G  VP+I V    D NGI +V++ +                     
Sbjct  490  LGKYTISGLPAGEKGAEVPKIRVNVSQDINGIFSVASSQLMQEIKEEEKPAEEAKEGEAK  549

Query  311  ----------KSTGKENKITITNDKGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGL  360
                      K   ++ ++ +  +   LS  +I     +      +D   +     +N L
Sbjct  550  EAEEKPAEPKKKRFRKVELKVEANVPGLSPTEITSATEQELAMAHQDRVIEETFNKRNEL  609

Query  361  ENYAYNLRNTLNDEKLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKELE  418
            E++ Y++R  + D +L   I  D++ A++DK+ E+ +WL + +   S K  +++K  E+ 
Sbjct  610  ESFVYDMRAQVTD-RLAEYISSDEKNALEDKLNEVEDWLYSDEGFDSTKSVYQSKLDEMR  668

Query  419  GIANPI  424
             I +P+
Sbjct  669  KITSPV  674

>PHYSO_249902
Length=130

 Score = 86.7 bits (213),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 70/132 (53%), Gaps = 39/132 (30%)

Query  1    MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
            MA S  G   GIDLG+ YS V VW NDRVEI+ +  G+R TP+ VAFT++E LIG+ A +
Sbjct  1    MAASRRGT--GIDLGSKYSRVAVWLNDRVEIVPSKSGDRFTPTIVAFTETEVLIGEPATH  58

Query  61   QVAMNAENTI-------------------------------------TVTFKGESKTFQP  83
            Q+  NA+NTI                                      VTFKG SK+F+ 
Sbjct  59   QLLQNAQNTIFDITRLIGRKFSDPEIQEGIKLWPFKVVCGPDDKPLVVVTFKGASKSFEA  118

Query  84   EEISSMVLTKMR  95
             EI +M+L+++R
Sbjct  119  VEILAMLLSELR  130

>HYAP_10418
Length=315

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 1/114 (1%)

Query  69   TITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKD-VKNAVITVPAYFNDSQRQATKD  127
               +   G      P EI S ++  +R+++  F+G D +  AVI VP  F+  QR  T  
Sbjct  19   CFAINLDGHPDCITPVEIGSKIVRHLRDMAHRFVGHDQITKAVIAVPVDFDAKQRDDTVA  78

Query  128  AGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            +   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DVSLL    G
Sbjct  79   SFRAAGLEVSRVLEEPTAAAIAYGLHQDPSVSFLLVFDFGGGTLDVSLLFARNG  132

>CCA15913
Length=857

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 105/228 (46%), Gaps = 51/228 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  43   IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  102

Query  70   IT---------------------VTFKGESK----------------TFQPEEISSMVLT  92
             T                     ++FK +                  TF  E+I +M+L 
Sbjct  103  ATDIKRLIGRKFKHPEVQAEIAQLSFKCDEMANGDVGIVLKYNDADVTFSCEQIIAMILN  162

Query  93   KMREV-SEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ + + A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  163  KMQIIATSANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  222

Query  152  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFE--AVAF  188
            + K    RN         V+  D+G  ++ V+++S   G  +  +VAF
Sbjct  223  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVSFVLGKLQVRSVAF  268

 Score = 38.9 bits (89),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 98/237 (41%), Gaps = 62/237 (26%)

Query  248  TYADNQPGVLIQVFEGERSMTRDNNL---------------LGKFNLDGIPPMPRG--VP  290
            T+AD  P      F  E S + D                  +GKF + G+P + +G  +P
Sbjct  488  THADEYPKTKRITFRREDSFSVDAKYDESAKALLPPDYDLGIGKFTISGLPEIEKGGEIP  547

Query  291  QIDVTFDIDANGILNVSAV-------EKSTGKENKITITN-------------------D  324
            +I V    D NG++ +S+        E+    E K T  N                    
Sbjct  548  KIRVNIQHDLNGLVGISSSQLMQELKEEKPADEAKETQENEENKEKKEGGKADEKAPEPK  607

Query  325  KGRLSQADIERMVAEAEKYK-SE-DEANKIRIEA-------------KNGLENYAYNLRN  369
            K R  + ++ ++ AE +    SE ++A +I +E              +N LE++ Y +RN
Sbjct  608  KKRFRKVEL-KIEAETKGLNVSEVNKATEIELEMAHQDRVIEETCNKRNELESFVYEMRN  666

Query  370  TLNDEKLQSQIPEDDRKAIDDKVTEIINWL--DAHQASEKEEFEAKQKELEGIANPI  424
             ++D +L+  I E+++  ++  + E+  WL  D    S K  ++ K   L  ++ PI
Sbjct  667  QISD-RLRDFITEEEKSKLESSLAEVEEWLYTDEGFDSVKSVYQTKLDGLRKLSAPI  722

>CCI11769
Length=372

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 5/133 (4%)

Query  59   KNQVAMNAEN----TITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKD-VKNAVITV  113
            +N+ A  +E+      ++   G      P +I S+++  +  ++  F+  + +   VI V
Sbjct  58   RNESATTSESLPGPCFSLNVSGHPSCVSPIDIGSLIIRHLHSMAREFVKHNQLDRVVIAV  117

Query  114  PAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDV  173
            P  F  +QR+AT  A   AGL V R++ EPTAAAIAYGL +      +L+FD GGGT DV
Sbjct  118  PVDFKAAQRRATVQAYEKAGLKVARVLEEPTAAAIAYGLHQTPNVNFILVFDFGGGTLDV  177

Query  174  SLLSIEEGIFEAV  186
            SLL +  G    V
Sbjct  178  SLLFVRSGSISVV  190

>PITG_15111
Length=186

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)

Query  143  PTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEAVA  187
            PTAAAIAYGLDKKGGE NVLIFDLGGGTFDVSLL+IE+GIFE  A
Sbjct  7    PTAAAIAYGLDKKGGEHNVLIFDLGGGTFDVSLLTIEDGIFEVKA  51

>H310_06229
Length=800

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 105/227 (46%), Gaps = 49/227 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N +NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIKNYGFKCVELPSGQVGIVLNYNDNPVTYTCEQVVAMMLN  123

Query  93   KMREVSEAFIGKDVKNA--VITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            K++ ++ A   ++V+ A  V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ Y
Sbjct  124  KLQNIA-AVANENVRPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGY  182

Query  151  GLDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFE--AVAF  188
            G+ K       +    +V+  D+G   + VS+++  +G  +  AVA+
Sbjct  183  GIYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAY  229

>CCI46709
Length=819

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/228 (29%), Positives = 105/228 (46%), Gaps = 51/228 (22%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     +   +   ++II N+  NR  P+ V     +R IG+AA +   M+  NT
Sbjct  4    IGIDFGNVDCVIAQAKRGGIDIILNENSNRKNPNMVCIQGKQRFIGEAAVSVARMHFRNT  63

Query  70   IT---------------------VTFKGESK----------------TFQPEEISSMVLT  92
             T                     ++F+ E                  TF  E+I +M+L 
Sbjct  64   ATDIKRLIGRKFKHPEVQAEIAQLSFRCEEMANGDVGIVLKYNDADVTFSCEQIIAMILN  123

Query  93   KMREV-SEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ + + A  G      V++ P Y+ D QR+A  ++  IAGLN LR+INE TA A+AYG
Sbjct  124  KMQIIATTANEGVAPAFCVVSCPGYYTDQQRRALLNSCQIAGLNCLRLINEHTAVALAYG  183

Query  152  LDKKGGERN---------VLIFDLGGGTFDVSLLSIEEGIFE--AVAF  188
            + K    RN         V+  D+G  ++ V++++   G  +  +VAF
Sbjct  184  IYKSA--RNMFHASEPQYVMFVDIGHASYTVAIVAFVLGKLQVKSVAF  229

>PHYCA_504114
Length=887

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 103/216 (48%), Gaps = 44/216 (20%)

Query  4    SVTGASV-GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAK-  59
            SV  A V G+DLG  +  +  V      EI+ N    R T + VAF   ERL G DAA  
Sbjct  20   SVVDAIVAGVDLGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATV  79

Query  60   -----------------------------------NQVAMNAENTITVTFK-GESKTFQP  83
                                                ++  NA    T++ K G+S+TF  
Sbjct  80   GVRRPQTAYAQIRRLLGTRLSDPQVSSLLDEEHFPYELVQNATRGGTISLKHGKSQTFHA  139

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+ +MV    R++++ F    VK+ V+TVP++F+ +QRQA  DA  I+G+ VL +INE 
Sbjct  140  EELVAMVFAHARQITDTFAEAAVKDWVLTVPSFFSQAQRQALLDAAEISGVRVLSLINEN  199

Query  144  TAAAIAYGL----DKKGGERNVLIFDLGGGTFDVSL  175
            TAAA+   +    D +   + +L +++G  +  VS+
Sbjct  200  TAAALQLAVHASYDPEDKPKKILFYNMGSTSLQVSI  235

 Score = 34.3 bits (77),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 10/96 (10%)

Query  335  RMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPE----DDRKAIDD  390
            RM+ E EK  ++  AN   +EAKN LE + Y   + L+ +  +SQI E    +  +++  
Sbjct  643  RMLNEMEKTDNKRRAN---LEAKNSLETFIYKAHDALSAQ--ESQIKEVTVPEQVESLQR  697

Query  391  KVTEIINWL-DAHQASEKEEFEAKQKELEGIANPIL  425
            K+ E   WL D     E  E++ K  EL    + IL
Sbjct  698  KLEETEEWLYDDGDKVEAAEYKKKMDELNKDLSAIL  733

>PHYSO_249932
Length=232

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 57/75 (76%), Gaps = 1/75 (1%)

Query  113  VPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFD  172
            +P +FN SQRQA K+AGA+AGLNV+R I   TAA+I YG +K  G R +L+FD+GG   D
Sbjct  2    MPLHFNQSQRQAIKNAGALAGLNVVRSIAGSTAASIGYGFEKT-GLRAILVFDMGGSALD  60

Query  173  VSLLSIEEGIFEAVA  187
            +SL++I++ I+E +A
Sbjct  61   LSLVTIDDDIYEVLA  75

>PYIR_18381
Length=747

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 101/220 (46%), Gaps = 51/220 (23%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +G+D G     +G  +   ++II N+  NR  P+ V     +R IG+AA +    + +NT
Sbjct  4    IGVDFGNVDCVIGQAKRGGIDIILNENSNRKNPNMVCVQGKQRFIGEAAISVARAHFKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +  E  TF  E++ +MV  
Sbjct  64   ATDVKRLIGRKFKHPEVQQEISQLAYKCVELPSGDVGIVLKYNDEDVTFSCEQVVAMVFN  123

Query  93   KMREVSEAFIGKDVK--NAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAY  150
            KM+ ++ A    +V    AV++VP Y+ D QR+A  +A  IA LN LR+INE TA A+AY
Sbjct  124  KMQAIAAA-ANDNVSPAYAVVSVPGYYTDVQRRALLNAAKIANLNCLRLINEHTAIALAY  182

Query  151  GLDKKGGERNV---------LIFDLGGGTFDVSLLSIEEG  181
            G+ K    RN+         +  D+G  ++ VS+++  +G
Sbjct  183  GIYKSA--RNMFHESEPQYTMFIDIGHASYTVSVVAFVQG  220

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 85/172 (49%), Gaps = 23/172 (13%)

Query  274  LGKFNLDGIPPMPRG--VPQIDVTFDIDANGILNVSAVE------------KSTGKENKI  319
            +GKF + GIP + +G  +P+I V    D NG+ +VS+ +               GKE + 
Sbjct  469  IGKFTVSGIPELEKGAELPKIRVNVQQDVNGLFSVSSSQLMQEIKEEEKPAAEEGKEGEA  528

Query  320  TITND-----KGRLSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDE  374
               +      K R  + D+ ++ AE  K   +D   +     +N LE++ Y +RN ++D 
Sbjct  529  KADDKPAEPKKKRFRKVDL-KIHAEELKMAHQDRIIEETFNKRNELESFVYEMRNQVSD-  586

Query  375  KLQSQIPEDDRKAIDDKVTEIINWLDAHQA--SEKEEFEAKQKELEGIANPI  424
            KL   I + ++ AI+DK+ E+ +WL + +   S K  ++ K  E+    +PI
Sbjct  587  KLAEFITDAEKAAIEDKLNEVEDWLYSDEGFDSTKSVYQNKLDEMRENTSPI  638

>SPRG_06288
Length=869

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 107/215 (50%), Gaps = 42/215 (20%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDSERLIGDAAKN--  60
            +V+ +  G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  61   ----QVAMN------------------AEN-----TIT-------VTFKGESK-TFQPEE  85
                QVA +                   EN     T+T       V  +  S+ TF  EE
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLTRGSVALQHSSEHTFHAEE  136

Query  86   ISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  145
            +++MV    ++++  F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E TA
Sbjct  137  LAAMVFGHAKQITNDFAEGPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDENTA  196

Query  146  AAIAYGLDKKGGERN----VLIFDLGGGTFDVSLL  176
            AA+ +G+D +  E N    ++++++G  +  VS++
Sbjct  197  AALHHGVDYEAPEPNTPERIMLYNMGSTSLQVSIV  231

>H257_16484
Length=795

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/226 (27%), Positives = 102/226 (45%), Gaps = 47/226 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     V   +   ++II N+  NR  P+ V     +R IG+AA +    N +NT
Sbjct  4    IGIDFGNVECVVAQAKRGGIDIILNENSNRKNPNMVCMAGKQRYIGEAAVSMARTNYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +     T+  E++ +M+L 
Sbjct  64   ATDVKRLIGRKFSAPDVQEEIQNYGFKCVELPSGQVGIVLNYNDNPVTYSCEQVVAMMLN  123

Query  93   KMREVSE-AFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            K++ ++  A  G +    V++ P YF D QR+A  +A  IAGLN LR++NE TA A+ YG
Sbjct  124  KLQNIAAVANDGVNPAYGVLSCPGYFTDVQRRAMLNASKIAGLNCLRLMNEHTAVALGYG  183

Query  152  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEGIFE--AVAF  188
            + K       +    +V+  D+G   + VS+++  +G  +  AVA+
Sbjct  184  IYKSVRNLFHETNPEHVMFIDMGHSGYTVSIVNFVQGKLQVKAVAY  229

 Score = 43.9 bits (102),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 3/99 (3%)

Query  328  LSQADIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQIPEDDRKA  387
            L+ AD+ R   E      +D   +     +N LE + Y+ RN L+D K    +   DR A
Sbjct  571  LTAADVNRASEEELTMAQQDRVIEETANKRNELETFVYDNRNHLSD-KYSEFVSTSDRDA  629

Query  388  IDDKVTEIINWLDAHQA--SEKEEFEAKQKELEGIANPI  424
             D K+ ++ +WL + +   S K  F+ K  EL  +  P+
Sbjct  630  FDAKLNDMEDWLYSDEGFDSTKSVFQTKLDELRALLKPV  668

>PPTG_13159
Length=197

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 48/66 (73%), Gaps = 0/66 (0%)

Query  122  RQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGGERNVLIFDLGGGTFDVSLLSIEEG  181
            R+ATKDAG IAGLNV R  +E T A IAYG DKK GE  VL+FDL G TF+ SLL IE G
Sbjct  10   RKATKDAGDIAGLNVPRTFSESTIAVIAYGQDKKDGESKVLVFDLSGRTFNESLLPIEAG  69

Query  182  IFEAVA  187
            IFE  A
Sbjct  70   IFEVKA  75

 Score = 35.0 bits (79),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)

Query  185  AVAFGATVQAAILSGNDQSEK  205
            AV +GATVQAAILS ND SEK
Sbjct  176  AVTYGATVQAAILSRNDSSEK  196

>SDRG_17122
Length=361

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 6/122 (5%)

Query  70   ITVTFKGESKTFQPEEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAG  129
            I V  KG++K   PEE+ + ++ K+++   A+    +++A++TVP  FN  QRQA +DA 
Sbjct  27   IRVIEKGDAKELHPEEVLAELVVKLKDDVAAYTNARIEHAIVTVPTGFNLLQRQAVRDAC  86

Query  130  AIAGLNVLRIINEPTAAAIAY----GLDKKGGERNVLIFDLGGGTFDVSLLSIEEGIFEA  185
            AIAGL   RI +  T AA+ +    G+ ++ G    ++ DLGGG   V LL IE GIFE 
Sbjct  87   AIAGLTNYRIKDVSTTAAVGHTSIKGMPRREGHD--MVVDLGGGHLSVPLLMIENGIFEV  144

Query  186  VA  187
             A
Sbjct  145  EA  146

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query  184  EAVAFGATVQAAILSGNDQSEKlqdlllldVTPLSQGLETAGGVMTVLIPRNTTVPTKKT  243
            EA A GATV AA + G  ++      L+LD    S G+ET GGV+T LI RNTT+P KK+
Sbjct  297  EAAAHGATVMAAAVYG--ETWPDSRFLVLDAVSDSVGIETDGGVLTSLISRNTTIPAKKS  354

Query  244  QTFSTY  249
            + F  +
Sbjct  355  KKFEIF  360

>SDRG_01828
Length=866

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 42/215 (20%)

Query  4    SVTGASVGIDLGTTYSCVGVWQNDR-VEIIANDQGNRTTPSYVAFTDSERLIGDAAKN--  60
            +V+ +  G+D G  +  + + +  R  EI+ N    R T + V+F   ER+ G  A N  
Sbjct  17   TVSASVAGVDFGGEFFKIALVKPGRPFEIVTNVHSKRKTETIVSFNGDERVYGADAMNIE  76

Query  61   ----QVAMN------------------AEN-----TIT-------VTFKGESK-TFQPEE  85
                QVA +                   EN     T+T       V  +  S+ TF  EE
Sbjct  77   VRRPQVAYSQIRRFLGATVDHPLVSSLTENEYFPYTLTKNLTRGSVALQHSSEHTFHAEE  136

Query  86   ISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  145
            +++MV    ++++  F    VK+ VITVP YF + QRQA  DA  IAG+ VL +I+E TA
Sbjct  137  LAAMVFGHAKQITNDFAEAPVKDWVITVPMYFAEPQRQAIIDAAEIAGIRVLSLIDENTA  196

Query  146  AAIAYGLDKKGGERN----VLIFDLGGGTFDVSLL  176
            AA+ + +D +  E N    ++++++G  +  VS++
Sbjct  197  AALHHAVDYEAAEPNTPERIMLYNMGSTSLQVSIV  231

>PPTG_18280
Length=384

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 98/208 (47%), Gaps = 43/208 (21%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAK---------  59
            G+D G  +  V + +     EI+ N    R T + VAF   ERL G DAA          
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  60   ---------------------------NQVAMNAENTITVTFK-GESKTFQPEEISSMVL  91
                                        ++  NA    T++ K G+ +TF  EE+ +MV 
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELVQNATRGGTISLKHGKDQTFHAEELVAMVF  147

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
               R++++ F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+   
Sbjct  148  AHARQITDTFAEAAVKDWVLTVPAFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQLA  207

Query  152  L----DKKGGERNVLIFDLGGGTFDVSL  175
            +    D +   + +L +++G  +  VS+
Sbjct  208  VHASYDPEDKPKKILFYNMGSTSLQVSI  235

>PITG_15771
Length=883

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 98/208 (47%), Gaps = 43/208 (21%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-----KNQVA  63
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA     + Q A
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  87

Query  64   M-------------------------------NAENTITVTFK-GESKTFQPEEISSMVL  91
                                            NA    T++ K G+ +T+  EE+ +MV 
Sbjct  88   YAQIRRLLGTTLSDPQVSSLLDEEHFPYELIQNATRGGTISLKHGKEQTYHAEELVAMVF  147

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            T  R++++ F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+   
Sbjct  148  THARQITDTFAEAPVKDWVLTVPTFFSQAQRQAMLDAAEISGVRVLSLINENTAAALQLA  207

Query  152  L----DKKGGERNVLIFDLGGGTFDVSL  175
            +    D +   + +L F++G  +  VS+
Sbjct  208  VHASYDPEDKPKKILFFNMGSTSLQVSI  235

>PYU1_G003764
Length=910

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 101/213 (47%), Gaps = 39/213 (18%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-  58
            A  V     G+D G  +  + + +     EI+ N    R T + VAF   ERL G DAA 
Sbjct  22   ASLVDAIVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT  81

Query  59   ----KNQVA------------------------------MNAENTITVTFKGESK-TFQP  83
                + Q A                              +  E   T++ + ++K  F  
Sbjct  82   VSVRRPQTAYSQIRRFLGATPDSPEVVSLLQEEYFPYTLLKNETRGTISLEHDNKQVFHA  141

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+ +MV +  R++++AF    VK+ VITVP +F+ +QRQA  DA  I+G+ VL +INE 
Sbjct  142  EELVAMVFSHARQITDAFAEAPVKDWVITVPTFFSQAQRQAMLDAAEISGVRVLSLINEN  201

Query  144  TAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSL  175
            TAAA+ + +     E R +L +++G  +  VS+
Sbjct  202  TAAALQHAVHSTFTEPRRILFYNMGSTSLQVSI  234

 Score = 37.4 bits (85),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query  347  DEANKIRIEAKNGLENYAYNLRNTLN---DEKLQSQIPEDDRKAIDDKVTEIINWL-DAH  402
            D   K  +EAKN LE Y YN R+TLN   D   Q   PE   + +  K+ E   WL D  
Sbjct  664  DNQRKANLEAKNRLETYVYNARDTLNAKADAIEQVTQPE-QLEQLQTKLEETEEWLYDDG  722

Query  403  QASEKEEFEAKQKELEGIANPIL  425
            +  E  E+  K K+L+   + IL
Sbjct  723  EKVEAAEYNKKIKDLDKDLSAIL  745

 Score = 33.1 bits (74),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 26/47 (55%), Gaps = 7/47 (15%)

Query  271  NNLLGKFNLDGIPPMPR-------GVPQIDVTFDIDANGILNVSAVE  310
            N  +GKFN+ GI            G P++ ++F++D+NGI  ++  E
Sbjct  513  NAHIGKFNITGIKAFAESMKDKNLGEPKVTLSFELDSNGIAKIAKAE  559

>PHALS_08498
Length=895

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/208 (32%), Positives = 95/208 (46%), Gaps = 43/208 (21%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-----KNQVA  63
            G+D G  Y  V  V      EI+ N    R T + VAF   ERL G DAA     + Q A
Sbjct  27   GVDFGGEYFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVGVRRPQTA  86

Query  64   M-------------------------------NAENTITVTFK-GESKTFQPEEISSMVL  91
                                            NA    TV  + G+ + F  EE+ +MV 
Sbjct  87   YMQIRRLLGTKLSDPQVIALRDEEHLPYELIQNATRGGTVMLQHGKKQFFHAEELVAMVF  146

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            T  R++++ F    VK+ V+TVP YF+ +QRQA  DA  I+G+ VL +INE TAAA+   
Sbjct  147  THARQITDTFAEASVKDWVLTVPTYFSQAQRQAMLDAADISGVRVLSLINENTAAALQLA  206

Query  152  ----LDKKGGERNVLIFDLGGGTFDVSL  175
                 D +   + +L +++G  +  VS+
Sbjct  207  VHSSFDPEEKPKKILFYNMGSTSLQVSI  234

 Score = 35.0 bits (79),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query  335  RMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQ---IPEDDRKAIDDK  391
            RM+ E E   ++D   +  +EAKN LE + Y   + L+ ++ Q +   IPE   +++  K
Sbjct  642  RMLREME---NDDNKRRADLEAKNNLETFIYTAHDALSAQESQIKLVTIPE-QLESLQKK  697

Query  392  VTEIINWL--DAHQASEKEEFEAKQKELEGIANPIL  425
            +TE   WL  D   A E  E++ + +EL+   + IL
Sbjct  698  LTETEEWLYNDGEHA-EAAEYKTRMEELKLELDSIL  732

>SDRG_03266
Length=792

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 94/217 (43%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +      +NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFSCEQVVGMFLN  123

Query  93   KMREVSE-AFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++  A  G +    VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSASKIAGMNCLRLMNEHTAVALSYG  183

Query  152  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEG  181
            + K       +    +V+  D+G   + VS+++  +G
Sbjct  184  IYKSLRNLFHESEPEHVMFIDIGHSGYTVSVVAFVQG  220

>PYIR_24220
Length=908

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 99/213 (46%), Gaps = 39/213 (18%)

Query  2    AQSVTGASVGIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-  58
            A  V     G+D G  +  + + +     EI+ N    R T + VAF   ERL G DAA 
Sbjct  22   ASLVEAIVAGVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAAT  81

Query  59   ----KNQVAMNA----------------------------ENTITVTFKGES---KTFQP  83
                + Q A +                             +N    T   E    K F  
Sbjct  82   VAVRRPQTAYSQIRRFLGATPDHPQVVSLLQEEYFPYTLLQNATRGTISLEHDNKKVFHA  141

Query  84   EEISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEP  143
            EE+ +MV +  R++++AF    VK+ VITVP++F+ +QRQA  DA  I+G+ VL +INE 
Sbjct  142  EELVAMVFSHARQITDAFAEAPVKDWVITVPSFFSQAQRQAMLDAAEISGVRVLSLINEN  201

Query  144  TAAAIAYGLDKKGGE-RNVLIFDLGGGTFDVSL  175
            TAAA+ + +     E R +L +++G  +  VS+
Sbjct  202  TAAALQHAVHSTFTEPRKILFYNMGSTSLQVSI  234

 Score = 38.5 bits (88),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 6/94 (6%)

Query  335  RMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQ-SQIPEDDR-KAIDDKV  392
            R++ E E+  ++ +AN   +EAKN LE + YN R+TL+ ++ Q +Q+ E ++ + +  K+
Sbjct  656  RILREMEQADNQRKAN---LEAKNRLETFVYNARDTLSSKQEQMAQVAEPEQLEKLQSKL  712

Query  393  TEIINWL-DAHQASEKEEFEAKQKELEGIANPIL  425
             E   WL D  +  +  E+  K K+L+   + IL
Sbjct  713  EETEEWLYDDGEKVDAAEYNKKVKDLDKDLSAIL  746

 Score = 33.5 bits (75),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 37/71 (52%), Gaps = 9/71 (13%)

Query  356  AKNGLENYAYNLRNTLNDE-KLQSQIPEDDRKAIDDKVTEIINWLDAHQASEKEEFEAKQ  414
            A N  E YA++ R  + +  + + Q+ ED+RK + +KV E+  WL + Q         KQ
Sbjct  758  AINTAEEYAFSTRELMTEWVESKPQVTEDERKDVLEKVEELEAWLVSSQ--------KKQ  809

Query  415  KELEGIANPIL  425
            K    + +P++
Sbjct  810  KAASAVEDPVV  820

>HYAP_07918
Length=897

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 95/217 (44%), Gaps = 43/217 (20%)

Query  5    VTGASVGIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAAK---  59
            V     G+DLG+ +  V  V      EI+ N    R T + VAF   ERL G DAA    
Sbjct  23   VDAVVAGVDLGSEFFKVALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGV  82

Query  60   ---------------------------------NQVAMNAENTITVTFK-GESKTFQPEE  85
                                              Q+  NA     +  K     TF  EE
Sbjct  83   RKPQTAYAQIRRLLGTKLSDPQVVSLLTDEHFPYQLVSNATRGGAIALKHANDATFHAEE  142

Query  86   ISSMVLTKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA  145
            + +MVLT  R+++  F    VK+ V+TVP +F+ +QRQA  DA  IAG+ VL +IN+ TA
Sbjct  143  LVAMVLTHARQITNTFAEVPVKDYVLTVPTFFSQAQRQALLDAAEIAGVRVLSLINDNTA  202

Query  146  AAIAYGL----DKKGGERNVLIFDLGGGTFDVSLLSI  178
            AA+   +    D     + VL ++LG     VS+ ++
Sbjct  203  AALQLAVHTSYDPTEAPKRVLFYNLGSTALQVSIAAM  239

 Score = 33.5 bits (75),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 29/95 (31%), Positives = 47/95 (49%), Gaps = 8/95 (8%)

Query  335  RMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLN---DEKLQSQIPEDDRKAIDDK  391
            +M+ E E   ++  AN   +EAKN LE + Y   + ++   DE  Q  +PE   +A+  K
Sbjct  649  QMLTEMENADNKRHAN---LEAKNSLETFIYKTHDAISAHEDEMKQVTVPE-QIEALKKK  704

Query  392  VTEIINWL-DAHQASEKEEFEAKQKELEGIANPIL  425
            + E   WL D  +  E  E++ K   L+   + IL
Sbjct  705  LEETEEWLYDDGERVEAVEYKKKMDALDSDLSAIL  739

>SPRG_17185
Length=83

 Score = 78.6 bits (192),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 0/70 (0%)

Query  1   MAQSVTGASVGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN  60
           MA       +GIDLGTT   VGVW++ +VE++ ND GN +TPS VAFTD+ RL+GD AK+
Sbjct  1   MAGGSQSVVIGIDLGTTTCSVGVWRHGQVEMVRNDNGNLSTPSCVAFTDAGRLVGDFAKS  60

Query  61  QVAMNAENTI  70
           Q   NA NT+
Sbjct  61  QAPRNAPNTV  70

>SPRG_08060
Length=793

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/217 (27%), Positives = 94/217 (43%), Gaps = 45/217 (21%)

Query  10   VGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMNAENT  69
            +GID G     +G  +   ++II N+  NR  P  V  +  +R IG+ A +      +NT
Sbjct  4    IGIDYGNVECVIGQAKRGGIDIILNENSNRKNPCMVCVSGKQRYIGEGAVSMARTQYKNT  63

Query  70   -------------------------------------ITVTFKGESKTFQPEEISSMVLT  92
                                                 I + +     TF  E++  M L 
Sbjct  64   ATDVKRLIGRKFAAADVQEEIALYGFKCVELPNGQVGIVLNYNDTPTTFTCEQVVGMFLN  123

Query  93   KMREVSE-AFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            KM+ ++  A  G +    VI+ P YF D QR+A   A  IAG+N LR++NE TA A++YG
Sbjct  124  KMQAIAAVANEGVNPAYCVISCPGYFTDMQRRAMLSAAKIAGMNCLRLMNEHTAVALSYG  183

Query  152  LDK-------KGGERNVLIFDLGGGTFDVSLLSIEEG  181
            + K       +    +V+  D+G   + VS+++  +G
Sbjct  184  IYKSLRNLFHESEPEHVMFVDIGHSGYTVSVVAFVQG  220

>PHYRA_73661
Length=884

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 96/208 (46%), Gaps = 43/208 (21%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-----KNQVA  63
            G+D G  +  +  V      EI+ N    R T + VAF   ERL G DAA     + Q A
Sbjct  27   GVDFGGEFFKIALVKPGTPFEIVTNVHSKRKTETMVAFDGDERLYGADAATVGVRRPQTA  86

Query  64   M-------------------------------NAENTITVTFK-GESKTFQPEEISSMVL  91
                                            NA    T++ K G+ + FQ EE+ +MV 
Sbjct  87   YSQIRRLLGTTLSDPQVSALLDEEHFPYDLVQNASRGGTISLKHGKDQAFQAEELVAMVF  146

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
               R+++  F    VK+ V+TVP +F+ +QRQA  DA  I+G+ VL +INE TAAA+   
Sbjct  147  AHARQITNTFAEAPVKDWVLTVPTFFSQAQRQALLDAAEISGVRVLSLINENTAAALQLA  206

Query  152  L----DKKGGERNVLIFDLGGGTFDVSL  175
            +    D +   + +L ++LG  +  VS+
Sbjct  207  VHASYDPEDKPKKILFYNLGSTSLQVSI  234

 Score = 32.7 bits (73),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (54%), Gaps = 7/71 (10%)

Query  332  DIERMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQ---IPEDDRKAI  388
            D  RM+ E EK  ++  AN   +EAKN LE + Y   + L+ ++ Q +   +PE   +++
Sbjct  643  DSMRMLTEMEKADNKRSAN---LEAKNSLETFIYKAHDALSAQESQIKQVTVPE-QVESL  698

Query  389  DDKVTEIINWL  399
              K+ E   WL
Sbjct  699  QSKLEETEEWL  709

>PHYKE_9011
Length=902

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 96/208 (46%), Gaps = 43/208 (21%)

Query  11   GIDLGTTYSCVG-VWQNDRVEIIANDQGNRTTPSYVAFTDSERLIG-DAA-----KNQVA  63
            G+D G  +  V  V      EI+ N    R T + VAF   ERL G DAA     + Q A
Sbjct  28   GVDFGGEFFKVALVKPGTPFEIVTNVHSKRKTETIVAFDGDERLYGADAATVGVRRPQTA  87

Query  64   M-------------------------------NAENTITVTFKG-ESKTFQPEEISSMVL  91
                                            N     TV+ K  +   +Q EE+ +MV 
Sbjct  88   YQQIRRLLGTKLENPQVKALLEEEHFPYNLLQNVTRGGTVSLKHRDGHIYQAEELVAMVF  147

Query  92   TKMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYG  151
            T  R++++ F    VK+ V+TVPA+F+ +QRQA  DA  I+G+ VL +INE TAAA+   
Sbjct  148  THARQITDTFAEAAVKDWVVTVPAFFSQAQRQALLDAAEISGVRVLSLINENTAAALQLA  207

Query  152  L----DKKGGERNVLIFDLGGGTFDVSL  175
            +    D +   R +L +++G  +  VS+
Sbjct  208  VHASYDPEDKPRRILFYNMGSTSLQVSI  235

 Score = 32.3 bits (72),  Expect = 8.6, Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 54/99 (55%), Gaps = 10/99 (10%)

Query  335  RMVAEAEKYKSEDEANKIRIEAKNGLENYAYNLRNTLNDEKLQSQ---IPEDDRKAIDDK  391
            RM+ E EK  ++ +AN   +EAKN LE + Y   + L+ ++ + +   +PE   +++  K
Sbjct  648  RMLKEMEKADNKRKAN---LEAKNSLETFIYKAHDALSAQESEIKKVTVPE-QVESLQTK  703

Query  392  VTEIINWL--DAHQASEKEEFEAKQKELEGIANPILQKM  428
            + E   WL  D  +A +  E++ K  +L+   + IL ++
Sbjct  704  LEETEEWLYEDGDKA-DAAEYKKKMSDLDSDLSAILSRV  741

>H310_01496
Length=904

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 97/208 (47%), Gaps = 42/208 (20%)

Query  11   GIDLGTTYSCVGVWQ-NDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN---------  60
            G+D G  +  + + +   + EI+ N    R T + V+F   ERL G  A N         
Sbjct  29   GVDFGGEFFKIALVKPGKQFEIVTNVHSKRKTETIVSFNGEERLFGADAMNIEVRRPQMA  88

Query  61   --QVAMNAENTIT-------------------------VTFKGESK-TFQPEEISSMVLT  92
              Q+      T+T                         V  K + + TF  EE+ +MV T
Sbjct  89   YSQIRRLLGTTVTHPVVESMVKSEYFPYTLTHNDTRGSVALKHDDQFTFHAEELVAMVFT  148

Query  93   KMREVSEAFIGKDVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGL  152
              + ++  F    V++ V+TVP+YF ++QRQA  DA  IAG+ VL +I+E TAAA+ + L
Sbjct  149  HAKTITNEFAESPVRDWVVTVPSYFVEAQRQAVIDAAEIAGIRVLSLIDENTAAALQHAL  208

Query  153  ----DKKGGERNVLIFDLGGGTFDVSLL  176
                 + G    VL++++G  +  VSL+
Sbjct  209  AIETPQAGKPTRVLLYNMGSTSLQVSLV  236

Lambda      K        H        a         alpha
   0.311    0.130    0.355    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 33945257016

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40