Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_135811475773073033730.0
PYAP_177461475711694199385e-111
PYIR_134531475711863408661e-100
PYU1_G001734147578003478241e-97
PYIW_18793147579973018308e-97
PHYSO_3211571475711803027712e-87
PHYRA_959011475710753877514e-85
PPTG_171281475711773027202e-80
PHYCA_34475147576922946799e-78
PITG_184571475711703026963e-77
PHALS_064771475711662996551e-71
SPRG_06354147578844296311e-69
SDRG_017641475710924316282e-68
H310_092121475711133166152e-66
H257_063051475710994196072e-65
CCI451221475711052935115e-53
CCA188981475711473134406e-44
PHYKE_839414757428701030.002
PPTG_128797103129884940.033
PYIR_191029926149893830.73
PITG_0279624501597120764.3
PHYCA_5475087103102442764.8
PYU1_G008807104789177695.7
PHYCA_102977118212033707.1
PITG_0036032970383739.5
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_13581

Length=730
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR_13581                                                            1303       0.0   
PYAP_17746                                                            365        5e-111
PYIR_13453                                                            338        1e-100
PYU1_G001734                                                          322        1e-97 
PYIW_18793                                                            324        8e-97 
PHYSO_321157                                                          301        2e-87 
PHYRA_95901                                                           293        4e-85 
PPTG_17128                                                            281        2e-80 
PHYCA_34475                                                           266        9e-78 
PITG_18457                                                            272        3e-77 
PHALS_06477                                                           256        1e-71 
SPRG_06354                                                            247        1e-69 
SDRG_01764                                                            246        2e-68 
H310_09212                                                            241        2e-66 
H257_06305                                                            238        2e-65 
CCI45122                                                              201        5e-53 
CCA18898                                                              174        6e-44 
PHYKE_8394                                                            44.3       0.002 
PPTG_12879                                                            40.8       0.033 
PYIR_19102                                                            36.6       0.73  
PITG_02796                                                            33.9       4.3   
PHYCA_547508                                                          33.9       4.8   
PYU1_G008807                                                          31.2       5.7   
PHYCA_102977                                                          31.6       7.1   
PITG_00360                                                            32.7       9.5   

>PYAR_13581
Length=730

 Score = 1303 bits (3373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 730/730 (100%), Positives = 730/730 (100%), Gaps = 0/730 (0%)

Query  1    NGAVRLYRREEQPVRAVPDISprppppQQLNTVTISFTDGESPPQQSTDEPEMDESPPQL  60
            NGAVRLYRREEQPVRAVPDISPRPPPPQQLNTVTISFTDGESPPQQSTDEPEMDESPPQL
Sbjct  1    NGAVRLYRREEQPVRAVPDISPRPPPPQQLNTVTISFTDGESPPQQSTDEPEMDESPPQL  60

Query  61   DTEHAQHIddadasesdanamddLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF  120
            DTEHAQHIDDADASESDANAMDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF
Sbjct  61   DTEHAQHIDDADASESDANAMDDLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF  120

Query  121  QSFKRVGQEIWGAVDEVIRALEALLTRYFMASFPTSVLLSCVVNEDQVASLLRRPGQRYK  180
            QSFKRVGQEIWGAVDEVIRALEALLTRYFMASFPTSVLLSCVVNEDQVASLLRRPGQRYK
Sbjct  121  QSFKRVGQEIWGAVDEVIRALEALLTRYFMASFPTSVLLSCVVNEDQVASLLRRPGQRYK  180

Query  181  GKDRKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRA  240
            GKDRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRA
Sbjct  181  GKDRKRRAATTLQAFFRMLFHRNRFRRVCRRGASATRIQTTWRKFAAQQSLRRELTLRRA  240

Query  241  EQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaav  300
            EQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAV
Sbjct  241  EQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLAAV  300

Query  301  vdatveyvvyvSPFELPTDLSHGVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTL  360
            VDATVEYVVYVSPFELPTDLSHGVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTL
Sbjct  301  VDATVEYVVYVSPFELPTDLSHGVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTL  360

Query  361  EKLGRCSRALAPSACSSRPTSTCPRARTALLDVSALTTLREIRRAHKPPAYWKQPGIRDT  420
            EKLGRCSRALAPSACSSRPTSTCPRARTALLDVSALTTLREIRRAHKPPAYWKQPGIRDT
Sbjct  361  EKLGRCSRALAPSACSSRPTSTCPRARTALLDVSALTTLREIRRAHKPPAYWKQPGIRDT  420

Query  421  VARALLQELERAIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVT  480
            VARALLQELERAIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVT
Sbjct  421  VARALLQELERAIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVT  480

Query  481  PASSDHDADVPVVSTQEALRASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFC  540
            PASSDHDADVPVVSTQEALRASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFC
Sbjct  481  PASSDHDADVPVVSTQEALRASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFC  540

Query  541  GYASVDLQLCRDETSGLYLLPSPAVDTSAPLSPATPLVLQEAHllarssrplaspsaspr  600
            GYASVDLQLCRDETSGLYLLPSPAVDTSAPLSPATPLVLQEAHLLARSSRPLASPSASPR
Sbjct  541  GYASVDLQLCRDETSGLYLLPSPAVDTSAPLSPATPLVLQEAHLLARSSRPLASPSASPR  600

Query  601  CFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRRAMQYLRTAFEVLAREVGSSTPSS  660
            CFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRRAMQYLRTAFEVLAREVGSSTPSS
Sbjct  601  CFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRRAMQYLRTAFEVLAREVGSSTPSS  660

Query  661  DGNFGDVLALLRHRVGVEKEREKEAASVRSQQpppppaiaettpatGAVVTPLLRVGKAD  720
            DGNFGDVLALLRHRVGVEKEREKEAASVRSQQPPPPPAIAETTPATGAVVTPLLRVGKAD
Sbjct  661  DGNFGDVLALLRHRVGVEKEREKEAASVRSQQPPPPPAIAETTPATGAVVTPLLRVGKAD  720

Query  721  TLRRLRRGSQ  730
            TLRRLRRGSQ
Sbjct  721  TLRRLRRGSQ  730

>PYAP_17746
Length=1169

 Score = 365 bits (938),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 275/419 (66%), Gaps = 63/419 (15%)

Query  1    NGAVRLYRREEQPVRAV--------------------------------PDISprppppQ  28
            NG+V+L+RREEQPVRA                                 P       P +
Sbjct  234  NGSVKLHRREEQPVRATAYSSPGNFNLATLKFDMAAVNTVTAAENRSIEPHDESEALPLR  293

Query  29   QLNTVTISFTDG--ESPPQQSTDEPEMD-ESPPQLDTEHAQHIddadasesdanamddLR  85
             + TVTISF +G  ES P+ +  E E D       DT   +  D    ++  AN+M+DLR
Sbjct  294  AMKTVTISFHNGKSESSPRNNARESEHDGRREDGNDTAPLEREDLDVTADEAANSMEDLR  353

Query  86   KNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALL  145
             NVEKIRGYNELLD YSLHQFIIHKGRA+R+TPEFQSFKRV QEIWG+++EVI+ALE LL
Sbjct  354  NNVEKIRGYNELLDAYSLHQFIIHKGRALRDTPEFQSFKRVAQEIWGSIEEVIQALEILL  413

Query  146  TRYF------------------MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRR  187
            TRYF                  MA   T  LL+CVVNEDQVASL+RRPGQRYKGKDRKRR
Sbjct  414  TRYFVPLAYIDGQRLMTLASMEMAKLSTCELLTCVVNEDQVASLIRRPGQRYKGKDRKRR  473

Query  188  AATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQ  247
            AATTLQAFFRM+ HRNRFR++ R G+SA  IQ TWR +A QQSLRR L   R E+L  W+
Sbjct  474  AATTLQAFFRMVLHRNRFRKIRRNGSSAMLIQKTWRSYACQQSLRRRLAHVREERLGEWK  533

Query  248  LQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatvey  307
             ++ R+RSQWR+I  QRRVV+HV S+S+DE  R+S+++F+V+QNLQL+RL A +      
Sbjct  534  AKVRRMRSQWRDIRQQRRVVIHVASISVDERTRLSMENFSVKQNLQLSRL-AGLVDQNVE  592

Query  308  vvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357
            +VYV+PFEL T++S          G+ANA  RV++V PEHAA FP HFSLAT L+YSP+
Sbjct  593  IVYVTPFELSTEVSQYFIKLLQLSGIANAHTRVRLVFPEHAAQFPQHFSLATHLIYSPN  651

 Score = 282 bits (722),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 180/417 (43%), Positives = 229/417 (55%), Gaps = 80/417 (19%)

Query  388   TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447
             TA+LDVS +TTLR+IRR  +PP YWKQPGIRDT+ARALLQELER IG+L KP H E F  
Sbjct  759   TAILDVSLMTTLRDIRREKRPPEYWKQPGIRDTIARALLQELEREIGSLLKPSHPEIFAS  818

Query  448   WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAG---  504
             W+ FA AI   GVV+EALP  V GV+R+NIF+ P+      DV V+ST + L  +     
Sbjct  819   WKEFASAIPEFGVVVEALPFHVAGVIRMNIFIEPS-----GDVHVMSTNDVLSGNGTTLS  873

Query  505   ---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDETS------  555
                R P AF  PQTLVPH+A+VGA+ A+GR+L E++AFCGYASVDLQL ++E+       
Sbjct  874   QRQRRPAAFVFPQTLVPHEAIVGASSAVGRVLYEEHAFCGYASVDLQLSQEESLTSPHKA  933

Query  556   ----GLYLLPSPAVDTSAP-----------LSPAT---PLVLQEA------Hllarssrp  591
                  + L P    D++A            L+PAT    L  +E+        L  S   
Sbjct  934   ERLWAVSLFPY-LTDSAATFAAFHALHRGVLNPATGRYNLTARESTPPESDSALVSSVIG  992

Query  592   laspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR---------------  636
                   +PR +   ++  HPN+  M   AFF  CR  GVCFDV R               
Sbjct  993   TLDRIGAPRSYAVAEYVFHPNVSIMSYNAFFHTCRLHGVCFDVERCVGSVFLLADSLTAG  1052

Query  637   ------------RAMQYLRTAFEVLAREVGS-STPSSD----------GNFGDVLALLRH  673
                         +A+QYLRTAFEV+ REVG+ S  S D          GNF ++L LLRH
Sbjct  1053  IFGVLSSGESATQALQYLRTAFEVIGREVGTQSMVSGDSDIGSSVQLSGNFAEILGLLRH  1112

Query  674   RVGVEKEREKEAASVRSQQpppppaiaettpatGAVVTPLLRVGKADTLRRLRRGSQ  730
             R+ +EKE+EK   +           +  TT     + TP LRVGK D +RRLRR SQ
Sbjct  1113  RLSLEKEKEKRDRATAIASSSTASPVPSTTHEQTPMATPTLRVGKVDQIRRLRRTSQ  1169

>PYIR_13453
Length=1186

 Score = 338 bits (866),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 192/340 (56%), Positives = 236/340 (69%), Gaps = 30/340 (9%)

Query  47   STDEPEMDESPP-QLDTE-HAQHIddadasesdanamddLRKNVEKIRGYNELLDTYSLH  104
            STD+ +  ESP   LD E ++   D+AD    D +AMD+LRKNVEKIRGYNELLDTYSLH
Sbjct  343  STDQSQEAESPETNLDDEVNSGGNDNADDDNDDTSAMDELRKNVEKIRGYNELLDTYSLH  402

Query  105  QFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYF---------------  149
            QFIIHKGRAMRETPEF SFKRV QE+WG+V+EVIRALEALLTRYF               
Sbjct  403  QFIIHKGRAMRETPEFVSFKRVAQEVWGSVEEVIRALEALLTRYFVPLAYIDGQRLMTVA  462

Query  150  ---MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHrnrfr  206
               MA+F    LLSC+VNEDQV SL+RRPGQRYKGKDRKRRAA T+Q FFRM +++ ++ 
Sbjct  463  AMEMAAFSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRKRRAAITIQNFFRMWWNQKKYT  522

Query  207  rvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRV  266
            R     AS   IQ  WR FA+ +SL+R+L  +RA+Q   W+ +M RL+  W  I   RRV
Sbjct  523  RFRHHLASVVTIQRVWRAFASHESLKRKLKFQRAQQHEQWEAKMQRLKRDWTHIKGNRRV  582

Query  267  VVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatveyvvyvSPFELPTDLSH----  322
            V+HVPSLS+DE +R+S D+F+V+QN+QL+RL   +      +VYVSPFEL  D++     
Sbjct  583  VIHVPSLSIDERSRISADNFSVKQNIQLSRL-CGLIDPNVDIVYVSPFELTADVAQYSMK  641

Query  323  -----GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357
                 G+A+   RVK+V PE AA FP HFSL T LLYSPH
Sbjct  642  LLQLGGIADPVARVKLVYPEQAARFPAHFSLTTLLLYSPH  681

 Score = 177 bits (449),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/393 (33%), Positives = 179/393 (46%), Gaps = 113/393 (29%)

Query  388   TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447
             TALLDVS +T LREIRR  K P YWKQP  RD  ARA++ ELER +  L  P H E +P 
Sbjct  788   TALLDVSTMTVLREIRREKKSPEYWKQPSTRDNAARAIIAELERTLAHLVTPLHPEVYPS  847

Query  448   WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGRA-  506
             W+ F  AI + GVV+EA P+ V G VR N+F+ P+   H     V STQ+ +  S+  + 
Sbjct  848   WQEFVDAISQFGVVVEAAPSAVIGHVRANLFIEPSGEVH-----VSSTQDIITTSSNSSS  902

Query  507   ---------------PLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVD-LQLC  550
                             + +A PQT  P++A+ GA+ AIG+LL ++  F GY+S+D L   
Sbjct  903   SGGGAGKKAGAYRSKTVGYAFPQTAAPYEAIRGASTAIGKLLADECVF-GYSSIDYLVFQ  961

Query  551   RDET---------------------SGLYLLPSPAVDTSAPL------------------  571
              D+T                     +  +LL   A++ S+ L                  
Sbjct  962   EDKTHAARLWAMALHPYLTDSASTFATFHLLNRGALNASSGLYHLPPVAASPSSSSTKSL  1021

Query  572   ------------SPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTA  619
                         + A  LV+QEA     S       + + R +V  ++  HPN+ TM  +
Sbjct  1022  KPSHSRAAGATGTSAADLVMQEA---THSGLVSLEKAGAQRTYVVSEYIFHPNVSTMQYS  1078

Query  620   AFFLACRRRGVCFDVTR---------------------------RAMQYLRTAFEVLARE  652
             AFF  CR  GVCFDV R                            A+ +LRTA EV+ RE
Sbjct  1079  AFFHTCRLHGVCFDVERCVGSVFLLADSLTAGVFGIMCCSDSASGALGFLRTALEVIGRE  1138

Query  653   VGSST---------PSSDGNFGDVLALLRHRVG  676
             VG+            S  GNF DVLA++R   G
Sbjct  1139  VGTQALMDEFMGGGESETGNFADVLAVIRALTG  1171

>PYU1_G001734
Length=800

 Score = 322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 222/347 (64%), Gaps = 33/347 (10%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            LRKNVEKIRGYNELLDTYSLHQFIIHKG+AMRETPEF SFKRV QEIWG V+EVI+ALE 
Sbjct  4    LRKNVEKIRGYNELLDTYSLHQFIIHKGKAMRETPEFVSFKRVAQEIWGGVEEVIKALET  63

Query  144  LLTRYF------------------MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LLTRYF                  MASF    LLSC+VNEDQV SL+RRPGQRYKGKDRK
Sbjct  64   LLTRYFVPLAYVDGQRLMTVASMEMASFSKQDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  123

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
            RRAA T+Q  FRM  ++ ++ R  R  +S   IQ  WR +A+ + LRR+L  +R +Q   
Sbjct  124  RRAAITIQNVFRMWSNQKKYSRYRRHLSSVVLIQQVWRAYASHEDLRRKLKAQRQQQHEQ  183

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatv  305
            W+ +M RL+ +W  I   RRV++HVPSLS+DE  R+  D+FAV+QNLQL+RL   +    
Sbjct  184  WEARMQRLQREWPRIKANRRVIIHVPSLSIDERFRIRADNFAVKQNLQLSRL-CGIIDAN  242

Query  306  eyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSP  356
              +VYVSPFEL +++           G+A+   RVK+V PE A  FP HFSL T LLYSP
Sbjct  243  VDIVYVSPFELTSEVGQYFMKLLQLGGIADPVTRVKLVFPEQATRFPAHFSLTTVLLYSP  302

Query  357  HLTLEKLGRCSRALAPSACSSRPTSTCPRARTAL----LDVSALTTL  399
            H  L ++ RC +       +  P     R   AL    L +  L TL
Sbjct  303  H-CLRRIRRCVKGKEAYLVTGMPGQEDKRLAMALNVPILGMDPLATL  348

 Score = 188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/384 (33%), Positives = 178/384 (46%), Gaps = 104/384 (27%)

Query  388  TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447
            TA++D S +T LREIRR  K P YW+QPG RD  AR ++ ELER IG L  P H E +P 
Sbjct  410  TAIVDASVVTALREIRREKKSPEYWRQPGTRDNAARMIIAELERTIGKLVTPLHPEVYPT  469

Query  448  WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAG---  504
            W+ FA AI + GVVIEA P+ + G +R N+FV P+   H     V STQ+ + ++A    
Sbjct  470  WQEFADAIAQFGVVIEAAPSAIVGYIRANLFVEPSGEVH-----VSSTQDVILSTASIHK  524

Query  505  RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDET----------  554
            R    +A PQT  P++A+ GA+ AIG++L +D  F GY+SVD  + R++           
Sbjct  525  RKVAGYAFPQTTAPYEAIRGASMAIGKVLVDDSVF-GYSSVDYLVFREDKTHVPRLWAMA  583

Query  555  --------------------------SGLYLLPSPAVDT--------------------S  568
                                      +G Y LP+PA                       +
Sbjct  584  LHPYLTDSASTFAVFHLLNRGALNIHTGQYHLPAPAASGVPSSSTASSVSLKLNASSTRA  643

Query  569  APLSPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRR  628
            A  + +  LVLQEA             + + R +   ++  HPN+ TM  ++FF  CR  
Sbjct  644  AGSATSANLVLQEA---THLGLVSLEKAGAQRTYAVNEYIFHPNVSTMQYSSFFHTCRLH  700

Query  629  GVCFDVTR---------------------------RAMQYLRTAFEVLAREVGSSTPSSD  661
            GVCFDV R                            A+ +LRTA EV+ REVG+   + D
Sbjct  701  GVCFDVERCFGTIFMLADSLTAGVFGIICCGDTASAALGFLRTALEVIGREVGTQALTDD  760

Query  662  ---------GNFGDVLALLRHRVG  676
                     GNF +VL ++R   G
Sbjct  761  LRGGGDCESGNFAEVLTVVRTLTG  784

>PYIW_18793
Length=997

 Score = 324 bits (830),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 173/301 (57%), Positives = 208/301 (69%), Gaps = 28/301 (9%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEF SFKRV QE+WG+VDEVI+ALEA
Sbjct  202  LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFVSFKRVAQEVWGSVDEVIKALEA  261

Query  144  LLTRYF------------------MASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LLTRYF                  MAS+    LLSC+VNEDQV SL+RRPGQRYKGKDRK
Sbjct  262  LLTRYFVPLAYVDGQRLMTVAAMEMASYSKRDLLSCIVNEDQVGSLIRRPGQRYKGKDRK  321

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
            RRAA T+Q FFRM +++ ++ R     AS   IQ  WR +A+   L+R +  +R +Q   
Sbjct  322  RRAAVTIQNFFRMWWNQKKYSRFRHHLASVVAIQRVWRVYASHDDLKRRIKSQRDQQHAQ  381

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatv  305
            W+ +M RL+  W  I   RRVV+HVPS S+DE  R+S D+F+V+QNLQL+RL   +  + 
Sbjct  382  WEAKMQRLKRDWIRIKGNRRVVIHVPSFSVDERLRLSADNFSVKQNLQLSRL-CGLVDSN  440

Query  306  eyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSP  356
              +VYVSPFEL TD+           G+A+   RVK+V PEHA  FP HFSL T LLYSP
Sbjct  441  VDIVYVSPFELTTDVVQYSMKLLQLGGIADPVARVKLVFPEHAPRFPTHFSLTTLLLYSP  500

Query  357  H  357
            H
Sbjct  501  H  501

 Score = 191 bits (486),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 136/385 (35%), Positives = 178/385 (46%), Gaps = 106/385 (28%)

Query  388  TALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPD  447
            TALLDVS +  LREIRR  + P YW+QPG RD  AR ++ ELER +G L  P H E +P 
Sbjct  608  TALLDVSTMVALREIRREKRSPEYWRQPGTRDNAARVIIAELERTLGNLVTPLHPELYPS  667

Query  448  WRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL--------  499
            W+ +A AI + GVV+EA P+ V G VR N+FV P+      +V V STQ+ L        
Sbjct  668  WQDYADAIVQFGVVVEAAPSAVVGHVRANLFVEPS-----GEVHVSSTQDILLSSSGGCG  722

Query  500  ---RASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE---  553
                 +     + +A PQT  P++A+ GA+ AIG+LL ED  F GYAS+D  + +++   
Sbjct  723  GKPGGAYRHKSVGYAFPQTAAPYEAIRGASTAIGKLLAEDNVF-GYASIDFLVFQEDKSH  781

Query  554  ---------------------------------TSGLYLLPSPAVDTSAPL---------  571
                                             TSGLY LP+  V TSA L         
Sbjct  782  TARLWAMALRPYLTDSAATFTTFHLLNRGALNTTSGLYYLPAATV-TSASLVQLQSSSAA  840

Query  572  ----SPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRR  627
                + A  LVL EA     S         +   +V  ++  HPN+ TM  +AFF  CR 
Sbjct  841  FASGASAADLVLHEA---THSGLVSLEKVGAQHTYVVSEYIFHPNVSTMQYSAFFHTCRL  897

Query  628  RGVCFDVTR---------------------------RAMQYLRTAFEVLAREVG------  654
             GVCFDV R                            A+ +LRTA EV+ REVG      
Sbjct  898  HGVCFDVERCVGSVFLLADSLTAGVFGLMCCSDTASGALGFLRTALEVVGREVGTQALTD  957

Query  655  ---SSTPSSDGNFGDVLALLRHRVG  676
               S   +  GNF DVLA +R   G
Sbjct  958  EFTSGGEAETGNFADVLAAIRALTG  982

>PHYSO_321157
Length=1180

 Score = 301 bits (771),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 215/302 (71%), Gaps = 28/302 (9%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RALE 
Sbjct  384  LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFVSFRRVAQELWGSVEEALRALET  443

Query  144  LLTRYF-------------MAS-----FPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LLT+YF             +AS     F    LLSC+VNE+QV ++LRRPGQRYKG+DRK
Sbjct  444  LLTQYFVPLAYADGQRLLSLASTGQPRFSKRELLSCIVNEEQVMAVLRRPGQRYKGRDRK  503

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
            RRAATT+QA  RM   R R+ R      SAT+IQ  WR F+   +L+  L   R EQL  
Sbjct  504  RRAATTIQACVRMWSIRRRYVRSRASDFSATKIQLAWRAFSCHAALKARLRELRREQLDN  563

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-aavvdat  304
            W+ +M  L++QW +I+ +RRVVVHVPSLSLDEH+R+S ++FAVQQNLQL R+ AA +D+ 
Sbjct  564  WEAKMNDLKTQWHQIAGRRRVVVHVPSLSLDEHSRLSAENFAVQQNLQLTRICAAALDSN  623

Query  305  veyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYS  355
            V+ +VYV+PFEL  D+SH         G+A++  RVK+V PE AA FP HFSL++ LLYS
Sbjct  624  VDLLVYVAPFELTADVSHYFLKLLQLGGLADSRPRVKLVFPEQAARFPAHFSLSSVLLYS  683

Query  356  PH  357
            PH
Sbjct  684  PH  685

 Score = 160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 125/388 (32%), Positives = 174/388 (45%), Gaps = 109/388 (28%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
             A++D+S +  +RE+RR  K P YW+QPG RD  ++ +L ELER   +  LA P H+E FP
Sbjct  793   AVVDLSGMQAMRELRREKKTPEYWRQPGPRDAASKLVLAELERPGVLARLATPMHTEIFP  852

Query  447   DWRAFAQAIGRDGVVIEALP------------ARVR-GVVRVNIFVTPASSDHDADVPVV  493
              WR + +AI   G V+EA+P            + V    VR N+F+ P     D  V + 
Sbjct  853   SWREYTEAISHFGCVVEAVPPTSFVASPETASSSVEPAYVRANLFIDP-----DGTVHIT  907

Query  494   STQEALRASAG--RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCR  551
             STQ  L +  G  R  +AF  PQT+ PH+AV GA  A G+LL E   + GY S+D  + +
Sbjct  908   STQNVLASGGGLNRKTVAFTFPQTVAPHEAVKGACTAAGKLLVETNVW-GYVSLDFVVFQ  966

Query  552   DETSG-----------------------LYLLPSPAVDTSA-------------------  569
             D+ SG                        +LL    +D S+                   
Sbjct  967   DDKSGGAPRLWALAVHPFLTDSAASFACFHLLARGVLDASSGGYRMAAANSTLAAVNSGR  1026

Query  570   -PLSPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRR  628
                   T L+L+EA      S    + + +PRC+V   +  HP++ TM   AFF ACR  
Sbjct  1027  SGGGGTTDLLLREA------SLAKGAQAGTPRCYVVCSYVFHPHVTTMQYTAFFHACRLH  1080

Query  629   GVCFDVTRR---------------------------AMQYLRTAFEVLAREVGS------  655
             GVCFDV R                            A+ ++RTA EV+ RE G+      
Sbjct  1081  GVCFDVERTLGTLFLLTDSLTAGVFGVLSVGETTDGALAFMRTALEVIGREAGATVEMAT  1140

Query  656   --STPSS--DGNFGDVLALLRHRVGVEK  679
               S P S   GNF  VL+ +R   G  K
Sbjct  1141  SPSRPGSARSGNFAQVLSAVRASTGGGK  1168

>PHYRA_95901
Length=1075

 Score = 293 bits (751),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 190/387 (49%), Positives = 249/387 (64%), Gaps = 39/387 (10%)

Query  3    AVRLYRREEQPVRAVPDISprppppQQLNTVTISF---TDGESPPQQSTDEPEMDESPPQ  59
            A R+Y R EQP RA P            N   + F   + G     +S D+  M+ +   
Sbjct  217  ATRIYDRSEQPARATP-----FTQSTGYNLAALKFDLRSTGTGKNDRSNDD--MEGNREH  269

Query  60   LDTEHA-QHIddadasesdanamddLRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETP  118
            +D E + +    AD  + +   M++L  NV+KIRGYN+LLD YSLHQF+IHKGR+MR+TP
Sbjct  270  IDGEISDEDQGGADNDKDEEAEMEELGANVDKIRGYNDLLDAYSLHQFLIHKGRSMRDTP  329

Query  119  EFQSFKRVGQEIWGAVDEVIRALEALLTRYFM------------------ASFPTSVLLS  160
            EF SF+RV QE+WG+V+E +RALE LLT+YF+                    F  S LL+
Sbjct  330  EFVSFRRVAQELWGSVEEALRALETLLTQYFVPLAYVDGQRLLSLAATGQPRFSKSELLA  389

Query  161  CVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQT  220
            C+VNE+QV S+LRRPGQRYKG+DRKRRAATT+QA  RM   R R+ R      SATRIQ 
Sbjct  390  CIVNEEQVMSVLRRPGQRYKGRDRKRRAATTIQACVRMWSIRRRYVRSRASDISATRIQL  449

Query  221  TWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHAR  280
             WR ++   +L+  L   R EQL  W+ +M  LR+QW +I+ +RRVVVHVPSLSLDEH+R
Sbjct  450  AWRSYSCHAALKTRLREVRREQLERWEARMQDLRTQWPQIAGRRRVVVHVPSLSLDEHSR  509

Query  281  VSLDHFAVQQNLQLARL-aavvdatveyvvyvSPFELPTDLSH---------GVANAAHR  330
            +S ++FAVQQNLQL R+ AA +D+ V+ +VYVSPFEL  D+S          G+A++  R
Sbjct  510  LSAENFAVQQNLQLTRICAAALDSHVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPR  569

Query  331  VKIVVPEHAATFPGHFSLATQLLYSPH  357
            VK+V PE AA FP HFSL++ LLYSPH
Sbjct  570  VKLVFPEQAARFPDHFSLSSLLLYSPH  596

 Score = 162 bits (409),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 131/376 (35%), Positives = 175/376 (47%), Gaps = 101/376 (27%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P H+E FP
Sbjct  704   AVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLAELERPGVLARLATPMHTEIFP  763

Query  447   DWRAFAQAIGRDGVVIEAL-PARVRGV------------VRVNIFVTPASSDHDADVPVV  493
              WR F +AIG  G VIEA+ PA +               VR N+FV P     D    + 
Sbjct  764   AWRDFTEAIGHFGCVIEAVPPAGIAATPESSSLLVEPAYVRANLFVYP-----DGKNVLA  818

Query  494   STQEALRASAGRAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE  553
             S+   L     R  +AF  PQT  PH+AV GA  A G+LL E   + GY S+D  + +DE
Sbjct  819   SSGGGL----NRKTVAFTFPQTAAPHEAVQGACDATGKLLVETSVW-GYVSLDFVVFQDE  873

Query  554   TSG-----------------------LYLLPSPA--VDTSAPLSPATP----------LV  578
              +G                        +LL   A  V  S  +  A P          L+
Sbjct  874   KNGGSPRLWALAVHPFLTDSAASFACFHLLARGAYRVAASNSMVNANPGRSGSGGAADLL  933

Query  579   LQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTRR-  637
             L+EA      S   A+ + +PRCFV   +  HP++ TM  +AFF ACR  GVCFDV R  
Sbjct  934   LREA------SLTKAALAGAPRCFVVCSYVFHPHVTTMQYSAFFHACRLHGVCFDVERTL  987

Query  638   --------------------------AMQYLRTAFEVLAREVG------SSTPSS--DGN  663
                                       A+ +LRTA EV+ REVG      +S P S  +GN
Sbjct  988   GTLFLLADSLTAGVFGILSVGETTEGALAFLRTALEVIGREVGATIEMATSRPVSTRNGN  1047

Query  664   FGDVLALLRHRVGVEK  679
             F  VL+ +R   G  K
Sbjct  1048  FAQVLSAVRASTGGGK  1063

>PPTG_17128
Length=1177

 Score = 281 bits (720),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 207/302 (69%), Gaps = 28/302 (9%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RALEA
Sbjct  383  LGANVDKIRGYNELLDAYSLHQFLIHKGRTMRDTPEFISFRRVAQELWGSVEEALRALEA  442

Query  144  LLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LLT+YF+                    F    LLSC+VNEDQ+ S+LRRPGQRYKG+DRK
Sbjct  443  LLTQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQIMSVLRRPGQRYKGRDRK  502

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
            RRAATT+QA  RM   R R+ R      +AT+IQ  WR ++   +L+  L   R E+L  
Sbjct  503  RRAATTVQACIRMWLVRRRYARSRASDINATKIQLAWRAYSCHTALKTRLREVRREKLEK  562

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-aavvdat  304
            W+ +M  L+SQW +I+ +RRVVVHVPSLSLDEH R+S ++FAVQQNLQL R+ A  +D+ 
Sbjct  563  WEKRMCTLKSQWSQIAARRRVVVHVPSLSLDEHYRLSAENFAVQQNLQLTRVCAVALDSN  622

Query  305  veyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYS  355
            V+ +VYVSPFEL  D+           G+ ++  RVK V PE +  FP HFSL++ LLYS
Sbjct  623  VDLLVYVSPFELTADVLQYFLKLLQLGGLVDSGPRVKFVFPEQSTRFPAHFSLSSLLLYS  682

Query  356  PH  357
            PH
Sbjct  683  PH  684

 Score = 168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 173/386 (45%), Gaps = 107/386 (28%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P HSE FP
Sbjct  792   AVVDLSNIQAMRELRREKRTPEYWRQPGPRDAAAKMILAELERPGMLARLAAPMHSEMFP  851

Query  447   DWRAFAQAIGRDGVVIEALP------------ARVR-GVVRVNIFVTPASSDHDADVPVV  493
              WR +  A+G  G VIEA+P            A V    VR N+FV P     D  V V 
Sbjct  852   TWRDYIDAVGHFGCVIEAVPPTAIAASPEASTALVEPAYVRANLFVDP-----DGSVHVT  906

Query  494   STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550
             STQ  L    G   R  +AF  PQT  PH+A+ GA  A G+LL E   + GY S+D  + 
Sbjct  907   STQNVLATGGGGLNRKTVAFTFPQTAAPHEAIKGACNAAGKLLVETNVW-GYVSLDFVVF  965

Query  551   RDETSG-----------------------LYLLPSPAVDTSAPL----------------  571
             +DE S                         +LL    +DT++                  
Sbjct  966   QDEKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDTNSGAYRVASKSLTTVTGRNG  1025

Query  572   -SPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGV  630
                 T L+L+EA      S    S + +PRCFV   +  HP++ TM   AFF ACR  GV
Sbjct  1026  SGCTTDLLLREA------SLAKDSLAGAPRCFVVCSYVFHPHVTTMQYTAFFHACRLHGV  1079

Query  631   CFDVTRR---------------------------AMQYLRTAFEVLAREVGS-----STP  658
             CFDV R                            A+ +LRTA EV+ RE GS     S+P
Sbjct  1080  CFDVERTLGTLFLLADSLTAGVFGVLSIGETMEGALAFLRTALEVIGREAGSTINMVSSP  1139

Query  659   S-----SDGNFGDVLALLRHRVGVEK  679
             S       GNF  VL+ +R   G  K
Sbjct  1140  SRPVSGRSGNFAQVLSAVRASTGGGK  1165

>PHYCA_34475
Length=692

 Score = 266 bits (679),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 162/294 (55%), Positives = 205/294 (70%), Gaps = 28/294 (10%)

Query  92   RGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFM-  150
            RGYNELLD YSLHQF+IHKGR MR+TPEF SF RV QE+WG+V+E +RALE LLT YF+ 
Sbjct  1    RGYNELLDAYSLHQFLIHKGRTMRDTPEFISFHRVAQELWGSVEEALRALETLLTHYFVP  60

Query  151  -----------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQ  193
                               F    LLSC+VNE+QV + LRRPGQRYKG+DRKRRAATT+Q
Sbjct  61   LAYVDGQRLLSLAATGQPRFSKRELLSCIVNEEQVMAALRRPGQRYKGRDRKRRAATTIQ  120

Query  194  AFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARL  253
            AF RM   R R+ R   R  +ATRIQ  WR ++   +L+  L   R EQL  W+ +M RL
Sbjct  121  AFVRMWAARRRYARSRARDINATRIQLAWRAYSCHAALKARLREVRREQLEKWEARMHRL  180

Query  254  RSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-aavvdatveyvvyvS  312
            +SQW +I++ RRVVVHVPSLSLDE++R+S ++ AV+QNLQL R+ AA +D+ V+ +VYVS
Sbjct  181  KSQWAQIASHRRVVVHVPSLSLDEYSRLSAENLAVRQNLQLTRICAAALDSRVDLLVYVS  240

Query  313  PFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357
            PFEL TD+S          G+A++  RVK++ PE A  FP HFSL++ LLYSPH
Sbjct  241  PFELTTDVSQYFIKLLQLGGLADSRPRVKLLFPEQATRFPAHFSLSSLLLYSPH  294

 Score = 155 bits (393),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 140/270 (52%), Gaps = 28/270 (10%)

Query  389  ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
            A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  LA P H + FP
Sbjct  402  AVVDLSGMQAMRELRREKRTPEYWRQPGPRDAAAKLVLTELERPGTLARLAMPVHKDIFP  461

Query  447  DWRAFAQAIGRDGVVIEALPARVRGV-------------VRVNIFVTPASSDHDADVPVV  493
             W  FA+AIG  G VIEA+P     V             +R N+FV P     D  V V 
Sbjct  462  SWLEFAEAIGHFGCVIEAVPLTAIAVTPETSTALLEPAYIRANLFVDP-----DGSVHVT  516

Query  494  STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550
            ST   L    G   R  +AF  PQT  PH+AV GA  A G+LL E   + GY S+D  + 
Sbjct  517  STLNMLATGGGGLNRRTVAFTFPQTAAPHEAVKGACSAAGKLLVETNVW-GYVSLDFVVF  575

Query  551  RDETSG----LYLLPSPAVDTSAPLSPATPLVLQEAHllarssrplaspsasprCFVSVD  606
            +D+ S     L+ L      T +  S A   +L    L A S     + +++PRCFV   
Sbjct  576  QDDKSNGAPRLWALAVHPFLTDSAASFACFHLLARGVLDANSGVYRMAAASTPRCFVVCS  635

Query  607  WAVHPNLCTMPTAAFFLACRRRGVCFDVTR  636
            +  HP++ TM   AFF ACR  GVCFDV R
Sbjct  636  YVFHPHVTTMQYTAFFHACRLHGVCFDVER  665

>PITG_18457
Length=1170

 Score = 272 bits (696),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 159/302 (53%), Positives = 206/302 (68%), Gaps = 28/302 (9%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            L  NV+KIRGYNELLD YSLHQF+IHKGR MR+TPEF SF+RV QE+WG+V+E +RALE 
Sbjct  374  LGANVDKIRGYNELLDVYSLHQFLIHKGRTMRDTPEFVSFRRVTQELWGSVEEALRALET  433

Query  144  LLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LL +YF+                    F    LLSC+VNEDQV S+LRRPGQRYKG+DRK
Sbjct  434  LLAQYFVPLAYVDGQRLLALAGTGQPRFSKRELLSCIVNEDQVMSVLRRPGQRYKGRDRK  493

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
            RRAATT++A  RM   R R+ R      +A++IQ  WR ++   SL+  L     E+L  
Sbjct  494  RRAATTIEACVRMWLVRRRYARTRASDFNASKIQLAWRAYSCHTSLKARLREVHLEKLEK  553

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-aavvdat  304
            W+ +M  L+S W +I+ +RRVVVHVPSLSLDEH+R+  ++FA+QQNLQL R+ AA +D+ 
Sbjct  554  WEKRMHNLKSHWPQIAGRRRVVVHVPSLSLDEHSRLGAENFAIQQNLQLTRVCAAALDSN  613

Query  305  veyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYS  355
            VE ++YVSPFEL +D+S          G+ ++  RVK+V PE    FP HFSL++ LLYS
Sbjct  614  VELLLYVSPFELTSDVSQYFLKLLQLGGLVDSRPRVKLVFPEQTTRFPAHFSLSSLLLYS  673

Query  356  PH  357
            PH
Sbjct  674  PH  675

 Score = 166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 124/388 (32%), Positives = 170/388 (44%), Gaps = 109/388 (28%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
             A++D+S +  +RE+RR  + P YW+QPG RD  A+ +L ELER   +  +A P  +E FP
Sbjct  783   AVVDLSNMQAMRELRREKRTPEYWRQPGPRDAAAKLILAELERPGMLARIATPMQTEIFP  842

Query  447   DWRAFAQAIGRDGVVIEALPARVRGV-------------VRVNIFVTPASSDHDADVPVV  493
              WR F  A+G  G V+EA+P                   VR N+FV P     D  V + 
Sbjct  843   KWREFIDAVGHFGCVVEAVPPTAIAASSEASTVLVEPAYVRANLFVDP-----DGSVHIS  897

Query  494   STQEALRASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLC  550
             STQ  L A  G   R  +AF  PQT  P++A+ GA  A G+LL E   + GY S+D  + 
Sbjct  898   STQNVLAAGGGGLNRKTVAFTFPQTAAPYEAIKGACNAAGKLLVETNVW-GYVSLDFVVF  956

Query  551   RDETSG-----------------------LYLLPSPAVDTSAPL----------------  571
             +DE S                         +LL    +DT++ +                
Sbjct  957   QDEKSNDAPRLWALAVHPFLTDSATSFACFHLLARGVLDTNSGVYRVANKSLTTANSGRK  1016

Query  572   ---SPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRR  628
                  AT L+L+EA          +S   + RCFV+  +  HP++ TM   AFF ACR  
Sbjct  1017  SESGSATDLLLREA------LLAKSSLVGARRCFVACSYVFHPHVITMQYTAFFHACRLH  1070

Query  629   GVCFDVTRR---------------------------AMQYLRTAFEVLAREVGS------  655
             GVCFDV R                            A+ +LRTA EV+ RE GS      
Sbjct  1071  GVCFDVERTLGTLFLLADSLTAGVFGILSIGETTEGALAFLRTALEVIGREAGSTISVAS  1130

Query  656   ----STPSSDGNFGDVLALLRHRVGVEK  679
                 S  S  GNF  +L+ +R   G  K
Sbjct  1131  SPSRSVASRSGNFAQILSAIRVSTGGGK  1158

>PHALS_06477
Length=1166

 Score = 256 bits (655),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 203/299 (68%), Gaps = 28/299 (9%)

Query  87   NVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLT  146
            NV KIR YN+L+D YSLHQ +I+KGRA+R+TPEF SF+RV  ++WG+V+EV+RALEA+L 
Sbjct  380  NVAKIREYNDLVDAYSLHQILIYKGRAIRDTPEFTSFRRVVHDLWGSVEEVLRALEAILF  439

Query  147  RYF-------------MAS-----FPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRA  188
            +YF             +AS     F    LLSC+VN++QV S+LRRPGQRY G+DRK RA
Sbjct  440  QYFVPLAHVDGQRLIALASTNQPQFSRRELLSCIVNKEQVMSVLRRPGQRYNGRDRKHRA  499

Query  189  ATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQL  248
            ATT+QA  RM    +R+ +      +A +IQ+ +R ++   +L+  L   R E+   W+ 
Sbjct  500  ATTIQACARMWMVHHRYVKSRSSNINAIKIQSAFRAYSRCTALKARLREIRCEKAAKWEA  559

Query  249  QMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARL-aavvdatvey  307
            +M   +SQW +I+ +RR+VVHVPS+SL EH+R++ ++FAVQQNLQL R+ AA +D  V+ 
Sbjct  560  RMYEFKSQWSQIAARRRIVVHVPSMSLGEHSRLNAENFAVQQNLQLTRICAAALDLQVDL  619

Query  308  vvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPH  357
            +VYVSP+EL  D+S          G A++  RVK V PE AA FP HFSL++ +LYSP+
Sbjct  620  LVYVSPYELTADVSQYFHKLLQLSGPADSRPRVKFVYPEQAARFPAHFSLSSLILYSPY  678

 Score = 160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 120/377 (32%), Positives = 161/377 (43%), Gaps = 101/377 (27%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELER--AIGTLAKPCHSERFP  446
             A++D+S++  +RE+ R  + P YW+QPG RD  A   L E ER   +  L  P H+E +P
Sbjct  786   AVVDLSSMQAMRELHREKRTPEYWRQPGTRDAAANLFLTEFERPGKLARLTTPIHTELYP  845

Query  447   DWRAFAQAIGRDGVVIEALPARVRGV-------VRVNIFVTPASSDHDADVPVVSTQEAL  499
              WR +A AIG  G VIEA+P             +R NIFV P  + H     + STQ  L
Sbjct  846   TWREYAAAIGHFGCVIEAVPPTASAASMEEPTYLRANIFVDPNGTVH-----MTSTQNVL  900

Query  500   RASAG---RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQL-------  549
               + G   R    FA PQT+ PH A+ GA  A+G+ L E   + GY S+D  +       
Sbjct  901   TTTRGGLSRKSEIFAFPQTVAPHAAIKGACNAVGKQLAETNVW-GYVSLDFVVFQDIKSN  959

Query  550   ------------------------------CRDETSGLYLLPSPAVDTSAPLSP------  573
                                           C D  SG+Y +P      +A  +       
Sbjct  960   AAVRLWALAIHPFLTNSAATFACFHLLTRGCLDANSGIYRVPGTKKLQTACTAEQSGNHD  1019

Query  574   ATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFD  633
             A  L+L+EA      S   A    + RC+V   +  HPN+       FF  CR  GVCFD
Sbjct  1020  AMDLLLREA------SLTKAIFQGATRCYVVCSYVFHPNVTATQYTTFFQNCRLHGVCFD  1073

Query  634   VTR---------------------------RAMQYLRTAFEVLAREVG-------SSTPS  659
             V+R                            A+ YLRTA EV+ RE G       SS+ S
Sbjct  1074  VSRALGTLFLLADSLTAGVFGILSIGETAQDALSYLRTALEVIGREAGATKGIVSSSSRS  1133

Query  660   SDGNFGDVLALLRHRVG  676
               GNF DVL+ +R   G
Sbjct  1134  VLGNFADVLSTVRASTG  1150

>SPRG_06354
Length=884

 Score = 247 bits (631),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 164/429 (38%), Positives = 225/429 (52%), Gaps = 82/429 (19%)

Query  1    NGAVRLYRREEQPVRAVPDISprppppQQLN-----------------------------  31
            N  +RLY R EQPV++ P ++        L                              
Sbjct  3    NSKLRLYDRSEQPVKSQPYMNSSGFNVASLKLDLAPPPTEPDAVPPTRPAVARKRKSTVA  62

Query  32   TVTISFTDGESPPQQST--DEPEMDESPPQ-LDTEHAQHIddadasesdanamddLRKNV  88
            TV +SF   +     +   ++P  D+ P +  DT                  +D+LR NV
Sbjct  63   TVQLSFPGAKDELVDAVPVEDPATDDGPIEPTDT------------------IDELRNNV  104

Query  89   EKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRY  148
            EKIRGYN+LLDTYSLHQFII KG+ + ETPEF SFKR+ +++WG+V   IR LE LL  Y
Sbjct  105  EKIRGYNDLLDTYSLHQFIIRKGQTLSETPEFISFKRITEDLWGSVSMAIRELETLLVHY  164

Query  149  FM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAAT  190
             +                   S   S LL+CV+N D+V + + RPGQR+KG D +  AA 
Sbjct  165  SVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGGDGRHAAAI  224

Query  191  TLQAFFRMLFHrnrfrrvcrrGAS-ATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQ  249
             +Q+ +RM  HR R       G S AT IQ  +R +   + ++ +L L R    R W+ Q
Sbjct  225  VIQSVYRM--HRTRRLLRQHHGHSYATHIQRVYRTYKCVKDIQVKLRLAREADARTWETQ  282

Query  250  MARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatveyvv  309
            M    + W +I  QRRVVVHVPS S +E AR+++D+FA++QNLQ+ARL   +      V+
Sbjct  283  MTTFHANWDKIKMQRRVVVHVPSFSAEERARLNMDNFAIRQNLQMARL-CAIADPNVDVI  341

Query  310  yvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTL  360
            Y+SPFEL  D+           GVA+   RV+++ PE+A  FP HFSLAT LLYSPH  L
Sbjct  342  YISPFELSVDIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPH-CL  400

Query  361  EKLGRCSRA  369
            +K+ R  R 
Sbjct  401  KKIKRYVRG  409

 Score = 103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/380 (26%), Positives = 150/380 (39%), Gaps = 89/380 (23%)

Query  389  ALLDVSALTTLREIR---RAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERF  445
            A +D+ AL  + ++R   RA K   Y+ QP I++ + RA++ EL      L  PC  + +
Sbjct  506  AAIDMHALECVNKVRAEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVY  565

Query  446  PDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR  505
            P W+     + R G VIEA P +V   VR N+F+ P+   H     V S QE L     +
Sbjct  566  PTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVH-----VTSAQEQLMHVKNK  620

Query  506  -APLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVD------------------  546
               +    P T VP+ A+ GA+ A+ + +       GYAS+D                  
Sbjct  621  HQSVGAVYPPTAVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPH  679

Query  547  -----LQL--------------------CRDETSGLYLLPSPAVDTSAPLSPATPLVLQE  581
                 LQL                      D  +G   LP PA   S+   P      Q 
Sbjct  680  LRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPLPAPRPSSLAGPPATET-QL  738

Query  582  AHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDV-------  634
            A          A+   + R +++ ++  HPN+ T+  A FF  CR  GV FD+       
Sbjct  739  AVEKILGESSPAATMGAERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGAA  798

Query  635  --------------------TRRAMQYLRTAFEVLAREVGSSTPSSD-------GNFGDV  667
                                 + A++  R A E++  +VG   P+ D       GNF  V
Sbjct  799  FVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ-PAPDALTGERLGNFAAV  857

Query  668  LALLRHRVGVEKEREKEAAS  687
            L  +R R     +R K+A S
Sbjct  858  LGAIRLRHDDMVKRAKKARS  877

>SDRG_01764
Length=1092

 Score = 246 bits (628),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 164/431 (38%), Positives = 228/431 (53%), Gaps = 87/431 (20%)

Query  1    NGAVRLYRREEQPVRAVPDISprppppQQLN-----------------------------  31
            N  +RLY R EQPV++ P ++        L                              
Sbjct  216  NSKLRLYDRSEQPVKSQPYMNSSSFNVASLKLDLAPPPTEPDPTPLTRLAVARNKKSAVA  275

Query  32   TVTISF----TDGESPPQQSTDEPEMDESPPQ-LDTEHAQHIddadasesdanamddLRK  86
            TV ++F     +G+  P    ++P  D+ P +  DT                  +D+LR 
Sbjct  276  TVQLTFPGAKDEGDVVP---VEDPTTDDGPIEPTDT------------------IDELRN  314

Query  87   NVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLT  146
            NVEKIRGYN+LLDTYSLHQFII KG+ + ETPEF SFKR+ +++WG+V   IR LE LL 
Sbjct  315  NVEKIRGYNDLLDTYSLHQFIIRKGQTLAETPEFISFKRITEDLWGSVSMAIRELETLLI  374

Query  147  RYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRA  188
             Y +                   S   S LL+CV+N D+V + + RPGQR+KG+D +  A
Sbjct  375  NYSVPLAYIDGQKLLKIAAMDAVSRSKSELLTCVLNVDEVTTFMARPGQRFKGEDSRHAA  434

Query  189  ATTLQAFFRMLFHrnrfrrvcrrGAS-ATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQ  247
            A  LQ+ +RM  H  R R     G S A+ IQ  +R + + + ++ +L L R    R W+
Sbjct  435  AILLQSVYRM--HLTRRRLRQHHGHSYASHIQRVYRTYKSVKEIQVKLRLAREADARTWE  492

Query  248  LQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatvey  307
             QM    + W +I  QRRVVVHVPS S +E  R+++D+FA++QNLQ+ARL   +      
Sbjct  493  TQMTAFHANWDKIKMQRRVVVHVPSFSAEERTRLNMDNFAIRQNLQMARL-CAIADPNVD  551

Query  308  vvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHL  358
            V+Y+SPFEL  D+           GVA+   RV+++ PE+A  FP HFSLAT LLYSPH 
Sbjct  552  VIYISPFELSADIQKYMMRLLQLGGVADPHSRVRMLHPENAERFPEHFSLATILLYSPH-  610

Query  359  TLEKLGRCSRA  369
             L+K+ R  R 
Sbjct  611  CLKKIKRYVRG  621

 Score = 105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 102/379 (27%), Positives = 153/379 (40%), Gaps = 90/379 (24%)

Query  389   ALLDVSALTTLREIR---RAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERF  445
             A +D+ AL  + ++R   RA K   Y+ QP I++ + RA++ EL      L  PC  + +
Sbjct  718   ASIDMHALECVNKVRTEKRAMKNDEYYSQPNIKEGIVRAIVAELSEQFHRLISPCFPDVY  777

Query  446   PDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL-RASAG  504
             P W+     + R G VIEA P +V   VR N+F+ P+   H     + S QE L +A   
Sbjct  778   PTWQHMRPVVNRIGAVIEAYPPKVLARVRANVFIEPSGGVH-----LTSAQEQLMQAKNK  832

Query  505   RAPLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVD------------------  546
                +    P T VP+ A+ GA+ A+ + +       GYAS+D                  
Sbjct  833   HQSVGAVYPSTTVPYAAIRGASLAVAQAMYAS-GIIGYASIDYVAFLDVKTVNGKAGPPH  891

Query  547   -----LQL--------------------CRDETSGLYLLPSPAVDTSAPLSPATPLV-LQ  580
                  LQL                      D  +G   LP PA   S P +   P+   Q
Sbjct  892   LRLWALQLLPCLTPTAMSFVLFTFLSCATLDAATGRSFLPQPAPHPS-PATGQLPVTETQ  950

Query  581   EAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDV------  634
              A     S  P +S     R +++ ++  HPN+ T+  A FF  CR  GV FD+      
Sbjct  951   LAVEKILSESPRSSNVGPERAYIAHEYIFHPNMATLQYAVFFNMCRVHGVSFDLQKSIGA  1010

Query  635   ---------------------TRRAMQYLRTAFEVLAREVGSSTPSSD-------GNFGD  666
                                   + A++  R A E++  +VG   P+ D       GNF  
Sbjct  1011  AFVLADSLTAGVVGLLCIGESDKEAVRLTRAALELIGDQVGVQ-PAPDALTGERLGNFAA  1069

Query  667   VLALLRHRVGVEKEREKEA  685
             VL  +R R     +R K+A
Sbjct  1070  VLGAIRSRHDDMVKRAKKA  1088

>H310_09212
Length=1113

 Score = 241 bits (615),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 188/316 (59%), Gaps = 36/316 (11%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            LR+NVEKIRGYNELLDTYSLHQFII KG+ + +TPEF SF+R  +++WG+V + I+ LEA
Sbjct  328  LRRNVEKIRGYNELLDTYSLHQFIIRKGKTLADTPEFISFQRTTEDLWGSVSKSIQELEA  387

Query  144  LLTRYFMASFP---------------------TSVLLSCVVNEDQVASLLRRPGQRYKGK  182
            +LT Y   S P                     T  LLSC++N D+V+SL+RRPGQR+KGK
Sbjct  388  MLTNY---SVPLAYVDGQKLMKIAAMDGTARGTMELLSCILNMDEVSSLMRRPGQRFKGK  444

Query  183  DRKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQ  242
                 AA  LQ+ +RM +   +  +       A  IQ  +R +     L++ L   R   
Sbjct  445  SGPDLAAVLLQSVWRM-YITKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKSVREAD  503

Query  243  LRVWQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvd  302
            LR+W  QM R R+ W  I  QRRVVVHVPS S +E  R+ +++F++QQNLQ+AR+   + 
Sbjct  504  LRIWDAQMQRFRANWDSIKMQRRVVVHVPSFSSEERTRLKMENFSIQQNLQMARM-CAIA  562

Query  303  atveyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLL  353
                 ++Y+SPFEL  D+           G+A+   R++++ PE+   FP HFSL T LL
Sbjct  563  DPNVDIIYISPFELSPDIQKYQVRLLQLGGIADPQTRIRMLHPENVDRFPEHFSLTTVLL  622

Query  354  YSPHLTLEKLGRCSRA  369
            YSPH  L+K+ R  R 
Sbjct  623  YSPH-CLKKIKRFVRG  637

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 142/355 (40%), Gaps = 88/355 (25%)

Query  400   REIRRAHKPPAYWKQPGIRDTVARALLQEL-ERAIGTLAKPCHSERFPDWRAFAQAIGRD  458
             RE++  H    Y++QP +RD V R++  EL E        PC  E +  W A      R 
Sbjct  752   REMK--HGAAEYFQQPDVRDAVLRSVYSELNESYFAANVTPCFPEMYASWAAMRPIALRV  809

Query  459   GVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR-APLAFACPQTLV  517
             GVVIEA P++V   VR NIF+ P+   H     + S  +       +  P     PQ+ V
Sbjct  810   GVVIEAYPSKVLSHVRTNIFIEPSGGVH-----ITSAHDVFMCPVNKHLPQCAVFPQSSV  864

Query  518   PHDAVVGAAQAIGRLLREDYAFCGYASVD---------------------LQLCRDET--  554
             P+ A+ GA+ AI   +       GYAS+D                     +Q+    T  
Sbjct  865   PYQAIRGASLAIASSMFIK-GIIGYASIDYISFADPKAMVSGRPRQRLWAMQVVPGLTNT  923

Query  555   ---------------------SGLYLLPSPAVDTSAPLSPATPLVLQEAHllarssrpla  593
                                  S L + P+P    S   +P TP   + A +L+  S   A
Sbjct  924   AVSFVMFAFLSCSQFNPITGKSHLQVAPAPVATLSTANAPITPTQQEIATILSPPSSAAA  983

Query  594   sps-asprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCFDVTR----------------  636
             +      R ++ +D+  HPN+ T+  A FF  CR  GV FD+ R                
Sbjct  984   ASVCGPERTYMVLDYIYHPNMATLQFATFFNTCRLHGVSFDLQRAIGAAYILADSLTAGV  1043

Query  637   -----------RAMQYLRTAFEVLAREVG-SSTPSS-----DGNFGDVLALLRHR  674
                         A +  R A E++  +VG  + P+S      GNF  +LA++R++
Sbjct  1044  VGLICIGESDKEAFRIARQAVELIGDQVGVQALPNSLSGERLGNFPHLLAIVRNK  1098

>H257_06305
Length=1099

 Score = 238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/419 (36%), Positives = 223/419 (53%), Gaps = 59/419 (14%)

Query  1    NGAVRLYRREEQPVRAVPDISprppppQQLNTVTISFTDGESPPQQSTDEP---------  51
            N  V++Y R  QPV+++P        P   N  ++ F D  + P  ST  P         
Sbjct  214  NSRVKIYDRASQPVKSMP-----YTNPSGFNMASLKF-DMSTTPATSTPSPVAAVVSGGD  267

Query  52   --EMDESP------------PQLDTEHAQHIddadasesdanamddLRKNVEKIRGYNEL  97
              +M  +P            P ++          D +  D++ + +LR+NVEKIRGYNEL
Sbjct  268  VSKMVVTPIDISFDAPSSSHPPVEQPKGGATGGDDTNGGDSSTIHNLRRNVEKIRGYNEL  327

Query  98   LDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFM-------  150
            LDTYSLHQFII KG+ + +TPEF SF+R  +++WG+V   I+ LE +LT Y +       
Sbjct  328  LDTYSLHQFIIRKGKTLSDTPEFISFQRTTEDLWGSVSTSIQELETMLTSYSVPLAYVDG  387

Query  151  -----------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRML  199
                        +  T+ LLSC++N D+V+SL+RRPGQRYKG      A   +Q+ +RM 
Sbjct  388  QKLMKIAAMDATTRGTTELLSCILNMDEVSSLMRRPGQRYKGSQGPDLAVVLIQSVWRM-  446

Query  200  FHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWRE  259
            F   +  +       A  IQ  +R +     L++ L L R   LR+W  QM R R+ W  
Sbjct  447  FLTKKRLKNHHGNEDAAVIQRIYRSYRCFSQLQQRLKLVREADLRIWDAQMQRFRANWDT  506

Query  260  ISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatveyvvyvSPFELPTD  319
            +  QRRVVVHVPS + D+  R+ +D+F+++QNLQ+AR+   +      ++Y+SPFEL  D
Sbjct  507  MKMQRRVVVHVPSFASDDRTRLKMDNFSIRQNLQMARM-CAIADPNVDIIYISPFELSPD  565

Query  320  LSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTLEKLGRCSRA  369
            +           G+ +   R++++ PE+   FP HFSL T LLYSPH  L+K+ R  R 
Sbjct  566  IQRYQVRLLQLGGITDPQTRIRMLHPENVDRFPEHFSLTTLLLYSPH-CLKKIKRFVRG  623

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 68/143 (48%), Gaps = 8/143 (6%)

Query  406  HKPPAYWKQPGIRDTVARALLQEL-ERAIGTLAKPCHSERFPDWRAFAQAIGRDGVVIEA  464
            H    Y++QP +RD V R++  EL E        PC  + +  W        R GVVIEA
Sbjct  742  HMAAEYFQQPDVRDAVLRSIFNELTESYFAANITPCFPDVYASWAELRPVALRVGVVIEA  801

Query  465  LPARVRGVVRVNIFVTPASSDHDADVPVVSTQEALRASAGR-APLAFACPQTLVPHDAVV  523
             P++V   VR N+F+ P+   H     + S  +   + A +  P     PQT VP+ A+ 
Sbjct  802  YPSKVLSQVRANVFIEPSGGVH-----ITSAHDLFMSPANKHLPQCALFPQTSVPYQAIR  856

Query  524  GAAQAIGRLLREDYAFCGYASVD  546
            GA+ AI   +       GYAS+D
Sbjct  857  GASLAIASSMFIK-GIIGYASID  878

>CCI45122
Length=1105

 Score = 201 bits (511),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/293 (38%), Positives = 169/293 (58%), Gaps = 29/293 (10%)

Query  104  HQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEALLTRYFM-------------  150
            + F+IH+G   R+ PEF++F+R+   IW +VD V+ AL  +L+ YF+             
Sbjct  338  YDFVIHQGIIDRKRPEFEAFQRIANPIWSSVDVVLEALARILSLYFIPIAYINGQRILTL  397

Query  151  -----ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRKRRAATTLQAFFRMLFHrnrf  205
                     T  L+SC+ NED+V  LL +PGQR++G +R +RA   LQ+F RM  HR RF
Sbjct  398  AQADNVPLTTKDLISCIRNEDEVKMLLSKPGQRFQGAERTKRATIALQSFIRMAMHRKRF  457

Query  206  rrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRVWQLQMARLRSQWREISTQRR  265
              +  +    T IQ  WR+F+A ++ + ++  +R  Q  V+   M    S W +I  QRR
Sbjct  458  LVMRYKYWKVTAIQRNWRRFSAHKATKLKIEAKREHQEMVFTDSMRSFCSNWDKIRMQRR  517

Query  266  VVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatveyvvyvSPFELPTDLSH---  322
             ++H+PS+S+D   R+  + F++QQNLQL RL   V      ++Y+ PFEL  D+     
Sbjct  518  TIIHIPSISIDSRQRMKTEQFSIQQNLQLQRL-CAVIDENVELIYICPFELTDDIVQYYM  576

Query  323  ------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSPHLTLEKLGRCSRA  369
                  G+++AA R+K++ PE+A+ FP HFSL++ +LYSP  TL +L RC R 
Sbjct  577  KLLQLGGISDAAARIKLICPENASRFPSHFSLSSVVLYSPR-TLNRLSRCIRG  628

 Score = 105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 134/304 (44%), Gaps = 59/304 (19%)

Query  389   ALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSERFPDW  448
             AL+D+S L +++E+R   K    W QP I+  + R L+ E++  I +     H E FP  
Sbjct  725   ALMDISRLQSVKEVRLRTKTLESWLQPPIQAKLIRNLVLEMQNNISSFIFVVHPEIFPSS  784

Query  449   RAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPA-----SSDHDADVPVVSTQEALR---  500
             ++F QAI   GV+IE  P + +G VR N+F+ P+     SS H+       T+   R   
Sbjct  785   KSFLQAIRIYGVIIELSPKKRQGHVRANLFIEPSRRVCVSSTHEIHSLETDTKIDDRVRK  844

Query  501   -----ASAGRA-PLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASVDLQLCRDE-  553
                  ASA +        PQTL+ H+ +  A+ AIG+ L +D   CGY SVD  +C D+ 
Sbjct  845   FGLDKASAAKMRTFGVTFPQTLIDHEVLKDASLAIGQALAKD-GICGYISVDFVVCLDDQ  903

Query  554   -------------------------------------TSGLYL---LPSPAVDTSAPLS-  572
                                                  T  L+L   +P   V    P S 
Sbjct  904   TQKKTLYATGLQPFLTNTAASFALFQLLSRGGSYNSMTGSLHLPQEVPLVGVQNDPPSSL  963

Query  573   PATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAFFLACRRRGVCF  632
              AT L+++EA L    S  L         +  +++  +P + T+  ++FF  CR RGV F
Sbjct  964   SATDLMIREARLSGIVSNVLPPTPTRT--YALIEYVCNPCVATLSCSSFFQHCRSRGVYF  1021

Query  633   DVTR  636
             D  R
Sbjct  1022  DTER  1025

>CCA18898
Length=1147

 Score = 174 bits (440),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 166/313 (53%), Gaps = 34/313 (11%)

Query  84   LRKNVEKIRGYNELLDTYSLHQFIIHKGRAMRETPEFQSFKRVGQEIWGAVDEVIRALEA  143
            +  + E  +G N      S H F IH+G   R   +F+SF+    ++W  V+EV+  LE 
Sbjct  363  INTDTESHKGNNS-----SNHDFTIHQGIVDRRRSDFKSFQCFANDVWNNVEEVVTTLER  417

Query  144  LLTRYFM------------------ASFPTSVLLSCVVNEDQVASLLRRPGQRYKGKDRK  185
            LL+ YF+                         LLSCV NE +V  LL +PGQR++G ++ 
Sbjct  418  LLSVYFIPIAHINGQRILTLSQENNKIITNRDLLSCVKNEHEVRMLLLKPGQRFQGVEKC  477

Query  186  RRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAEQLRV  245
             RAA  +Q+F RM+  R  +  +         IQ  WR++AA ++ + ++   R  Q  V
Sbjct  478  TRAAMAVQSFMRMITFRRTYLLMISNHRKVRAIQQNWRRYAAYKATKIKIEAIRERQDIV  537

Query  246  WQLQMARLRSQWREISTQRRVVVHVPSLSLDEHARVSLDHFAVQQNLQLARLaavvdatv  305
            +   M    S W +I TQRR V+H+PS+S+D   R+  + F++QQNLQL RL   +    
Sbjct  538  FNEIMRSFCSNWDKIRTQRRTVMHIPSISIDPRHRMKTEQFSIQQNLQLQRL-CALIDEN  596

Query  306  eyvvyvSPFELPTDLSH---------GVANAAHRVKIVVPEHAATFPGHFSLATQLLYSP  356
              ++Y+ PFEL  D+           G+++AA R+K++ PE+A+ FP HFSL+  +L SP
Sbjct  597  VELIYICPFELTDDIVQYYMKLLQLAGISDAAARIKLMCPENASRFPSHFSLSNVVLCSP  656

Query  357  HLTLEKLGRCSRA  369
            H T+++L R  R 
Sbjct  657  H-TMKRLSRYIRG  668

 Score = 123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 143/315 (45%), Gaps = 71/315 (23%)

Query  385   RARTALLDVSALTTLREIRRAHKPPAYWKQPGIRDTVARALLQELERAIGTLAKPCHSER  444
             R  TAL+D+S L +++ +R   +   YW+QP I++ + R ++QE++  I +L    + E 
Sbjct  761   RTGTALVDISQLQSIQVLRLRTRTLDYWRQPPIQNKLIRNIVQEMQSIISSLVFMVNPEV  820

Query  445   FPDWRAFAQAIGRDGVVIEALPARVRGVVRVNIFVTPASSDHDADVPVVSTQEAL-----  499
             +P W++F QAI   GVVIE  P   +G VR N+F+ P+       V + STQE L     
Sbjct  821   YPSWKSFLQAIRMYGVVIEVCPKNRQGYVRANLFIEPSRR-----VCISSTQEFLSFENI  875

Query  500   -------------RASAGRA-PLAFACPQTLVPHDAVVGAAQAIGRLLREDYAFCGYASV  545
                          +A A +   + F  PQTL+ H+ +  A+  IG+ L +D   CGY SV
Sbjct  876   HENDDRARKVVFDKAFAAKMRTIGFTFPQTLIDHEVLKSASLVIGQALAKD-GICGYISV  934

Query  546   DLQLCRDE-------------------------------------TSGLYLLP----SPA  564
             D  +  D+                                      +GL+ LP    S  
Sbjct  935   DFLVILDDQTQNKILYAMALQPFLTNSAASFSLFQFLSRGGGYNSKTGLFHLPRAITSHG  994

Query  565   VDTSAP---LSPATPLVLQEAHllarssrplaspsasprCFVSVDWAVHPNLCTMPTAAF  621
             V +  P      AT L+++EA L    S  L         +V +++  +PN+ T+   +F
Sbjct  995   VTSDTPSSSSLSATDLMIREARLSGIVSNELPLTPTRS--YVLLEYVCNPNVATLSYGSF  1052

Query  622   FLACRRRGVCFDVTR  636
             F  CR RGV FD+ R
Sbjct  1053  FQNCRSRGVYFDIER  1067

>PHYKE_8394
Length=428

 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 10/70 (14%)

Query  284  DHFAVQQNLQLARL-aavvdatveyvvyvSPFELPTDLSH---------GVANAAHRVKI  333
            ++FAVQQNLQL R+ AA +D+ V+ +VYVSPFEL  D+S          G+A++  RVK+
Sbjct  178  ENFAVQQNLQLTRICAAALDSNVDLLVYVSPFELTADVSQYFLKLLQLGGLADSRPRVKL  237

Query  334  VVPEHAATFP  343
            V PE A  FP
Sbjct  238  VFPEQALRFP  247

 Score = 42.4 bits (98),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 0/31 (0%)

Query  389  ALLDVSALTTLREIRRAHKPPAYWKQPGIRD  419
            A++D+S +  +RE+RR  + P YW+QPG RD
Sbjct  346  AIIDLSGMQAMRELRREKRAPEYWRQPGPRD  376

 Score = 34.7 bits (78),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/19 (74%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  84   LRKNVEKIRGYNELLDTYS  102
            L  NV+KIRGYNELLD Y+
Sbjct  159  LGANVDKIRGYNELLDAYT  177

>PPTG_12879
Length=1298

 Score = 40.8 bits (94),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 41/84 (49%), Gaps = 0/84 (0%)

Query  182  KDRKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRELTLRRAE  241
            ++RK+RAA  +QAFFR +      R+       AT IQ  W++F   +   R L  R+ E
Sbjct  431  ENRKQRAAQRIQAFFRDIRSALDARQQAAENRGATCIQAAWKRFVHLKEYPRRLEARKQE  490

Query  242  QLRVWQLQMARLRSQWREISTQRR  265
               +  +Q  R   QW +   ++R
Sbjct  491  VEMLLMVQSEREMRQWMDDMEKKR  514

>PYIR_19102
Length=1498

 Score = 36.6 bits (83),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (51%), Gaps = 5/93 (5%)

Query  184   RKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKFAAQQSLRRE----LTLRR  239
             R R A  TLQ  FR     +R  +V R   +ATRI T WR F A     R     L L+ 
Sbjct  948   RFRHAVLTLQCHFRRR-QASRRVQVLREACAATRISTAWRCFNATTKYNRIRSAILALQC  1006

Query  240   AEQLRVWQLQMARLRSQWREISTQRRVVVHVPS  272
             AE++RV + Q+  LR + + ++  +   +H+ S
Sbjct  1007  AERMRVAKKQLTELRLESKNVAKLKEDNIHLKS  1039

>PITG_02796
Length=1597

 Score = 33.9 bits (76),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 21/120 (18%)

Query  171   LLRRPGQRYKGKDRKRRAATTLQAFFRMLFHrnrfrrvcrrG---ASATRIQTTWRKFAA  227
             ++RR         R+R AATT+Q+ FR L  +     + R     A+ATRIQ + R++ A
Sbjct  924   MVRRKFAEMLTHKRQREAATTIQSCFRRLVAQRVLAEMLRDRRQIAAATRIQASARRWLA  983

Query  228   QQSLRRELTLRRAEQLRV------------W--QLQMARLRSQWREISTQRRVVVHVPSL  273
             Q    R+L   R ++ RV            W  QL++AR R +   I+   R+  H   L
Sbjct  984   Q----RQLAELREQKFRVVAASCLQRNCRRWLAQLELARCRKRQLRITAAVRIQAHCRRL  1039

>PHYCA_547508
Length=1024

 Score = 33.9 bits (76),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  184  RKRRAATTLQAFFRMLFHrnrfrrvcrrGASATRIQTTWRKF  225
            R++RAA  LQ FFR L  + + +R      +AT +QT WR+F
Sbjct  227  REQRAARRLQLFFRHLNQQIQTQRRTVETQAATLVQTAWRRF  268

>PYU1_G008807
Length=91

 Score = 31.2 bits (69),  Expect = 5.7, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query  416  GIRDTVA-RALLQELERAIGTLAKPCHSERFPDWRAFAQAIGR-DGVVIEALPARVRGVV  473
            G+R TVA RA ++   R  G+L+K  H E + +WR  ++   + DG    ++ A   GV+
Sbjct  6    GVRRTVALRARVENQRRFGGSLSKNKHIENYSNWRGDSEKRFKFDGEFFTSMAA--WGVI  63

Query  474  RVNIFVTPASSD-HDAD  489
               I+   AS + H+ D
Sbjct  64   PFTIYYAVASGERHNRD  80

>PHYCA_102977
Length=120

 Score = 31.6 bits (70),  Expect = 7.1, Method: Composition-based stats.
 Identities = 14/33 (42%), Positives = 20/33 (61%), Gaps = 0/33 (0%)

Query  481  PASSDHDADVPVVSTQEALRASAGRAPLAFACP  513
            P S  +DA   + S++ AL + AG+AP   ACP
Sbjct  23   PVSVQYDATYTIPSSRGALCSGAGKAPAGTACP  55

>PITG_00360
Length=703

 Score = 32.7 bits (73),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 24/83 (29%), Positives = 41/83 (49%), Gaps = 13/83 (16%)

Query  213  ASATRIQTTWRKFAAQQS-------LRRELTLRRAEQLRVWQLQMARLRSQWREISTQRR  265
            A+A +IQ  WR F A++S       LR ++    A+ +R + ++  +++ Q   IS Q  
Sbjct  243  AAALKIQAIWRMFIAKKSRLILESLLRDQVGSNAAKVIRRFSVEAIQVKGQKTMISIQED  302

Query  266  VVVHVPSLSLDEHARVSLDHFAV  288
             V       + E  R S+D FA+
Sbjct  303  AV------DISEQQRKSIDIFAI  319

Lambda      K        H        a         alpha
   0.322    0.133    0.395    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 58432441026

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40