Get selected genes'

Note:

Full BLAST raw output including alignments follows below the summary table

Hit NamePillarLength (aa)HSP LengthHSP ScoreHSP Significance
PYAR_135711475866666630710.0
PYAP_177631475879466720740.0
PYU1_G0017331475873262715670.0
PYIR_134181475874751115470.0
PYIW_199691475873349315320.0
PPTG_171291475874571314200.0
PITG_184581475874771313950.0
PHYCA_5114151475874471113930.0
PHYSO_3489031475876672913840.0
PHYRA_810981475874151013611e-178
PHYKE_839514758142071413824e-174
HYAP_071041475872151412747e-166
PHALS_064761475872647412286e-159
PYVX_235901475868954910961e-139
CCI44111147585765088432e-103
CCA22843147585865128214e-100
SPRG_06355147587134545331e-57
SDRG_01763147587364625061e-53
H257_117731382110264201802e-12
H310_082921382110074131703e-11
SPRG_126211382110034091596e-10
H257_0193413355510224101571e-09
SDRG_079831335559913951571e-09
SDRG_045751382110032211552e-09
SPRG_1903013355510003951453e-08
PYVX_215131382114463831382e-07
PHYSO_4705331382110844651337e-07
PYAP_222301382111164571292e-06
PYIR_141071382111764661274e-06
PITG_172501382110462301231e-05
PYIW_157171382111211731203e-05
PPTG_113651382111064551185e-05
SDRG_083341252820741830.32
PYAR_1478813821795142840.44
PYIR_2336012528227106800.71
PHYRA_828581252822429771.7
SPRG_019551252820733743.5
PHYKE_5458840743881763.8
PPTG_070251252822476744.7
PHYKE_54591252820158735.1
PHALS_000541252822429735.2
CCA227791252822241735.4
PITG_155251252822437735.5
PHYSO_5453781252822429735.7
PHYCA_5718411252824129727.2
SDRG_13750423070451738.7
BLAST Hit Colour Codes
Same Pillar
Hit is in a Tandem Cluster
Same Species
Pillar Without Query Species
Singleton Pillar
Nearby Pillar
BLASTP 2.9.0+

Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.

Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.

Database: blastdb
           319,881 sequences; 135,609,681 total letters

Query= PYAR_13571

Length=666
                                                                      Score        E
Sequences producing significant alignments:                          (Bits)     Value

PYAR_13571                                                            1187       0.0   
PYAP_17763                                                            803        0.0   
PYU1_G001733                                                          608        0.0   
PYIR_13418                                                            600        0.0   
PYIW_19969                                                            594        0.0   
PPTG_17129                                                            551        0.0   
PITG_18458                                                            541        0.0   
PHYCA_511415                                                          541        0.0   
PHYSO_348903                                                          537        0.0   
PHYRA_81098                                                           528        1e-178
PHYKE_8395                                                            536        4e-174
HYAP_07104                                                            495        7e-166
PHALS_06476                                                           477        6e-159
PYVX_23590                                                            426        1e-139
CCI44111                                                              329        2e-103
CCA22843                                                              320        4e-100
SPRG_06355                                                            209        1e-57 
SDRG_01763                                                            199        1e-53 
H257_11773                                                            73.9       2e-12 
H310_08292                                                            70.1       3e-11 
SPRG_12621                                                            65.9       6e-10 
H257_01934                                                            65.1       1e-09 
SDRG_07983                                                            65.1       1e-09 
SDRG_04575                                                            64.3       2e-09 
SPRG_19030                                                            60.5       3e-08 
PYVX_21513                                                            57.8       2e-07 
PHYSO_470533                                                          55.8       7e-07 
PYAP_22230                                                            54.3       2e-06 
PYIR_14107                                                            53.5       4e-06 
PITG_17250                                                            52.0       1e-05 
PYIW_15717                                                            50.8       3e-05 
PPTG_11365                                                            50.1       5e-05 
SDRG_08334                                                            36.6       0.32  
PYAR_14788                                                            37.0       0.44  
PYIR_23360                                                            35.4       0.71  
PHYRA_82858                                                           34.3       1.7   
SPRG_01955                                                            33.1       3.5   
PHYKE_5458                                                            33.9       3.8   
PPTG_07025                                                            33.1       4.7   
PHYKE_5459                                                            32.7       5.1   
PHALS_00054                                                           32.7       5.2   
CCA22779                                                              32.7       5.4   
PITG_15525                                                            32.7       5.5   
PHYSO_545378                                                          32.7       5.7   
PHYCA_571841                                                          32.3       7.2   
SDRG_13750                                                            32.7       8.7   

>PYAR_13571
Length=666

 Score = 1187 bits (3071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/666 (100%), Positives = 666/666 (100%), Gaps = 0/666 (0%)

Query  1    MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTssamsydddndsmysgyssdRS  60
            MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRS
Sbjct  1    MLVPEDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTSSAMSYDDDNDSMYSGYSSDRS  60

Query  61   TATTPSNARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaapaytpmpa  120
            TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAAPAYTPMPA
Sbjct  61   TATTPSNARTTENLRATGLETLNELEEEPVDRSTARYIGEQGDFTPMPTTAAPAYTPMPA  120

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPP  180
            IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPP
Sbjct  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPP  180

Query  181  LLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDR  240
            LLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDR
Sbjct  181  LLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDR  240

Query  241  VQEWLDSRFNVGSDVLLAMVGDAGTGKTHFCKFERKGKSSPRNVLLSVVNQLTATLPTFK  300
            VQEWLDSRFNVGSDVLLAMVGDAGTGKTHFCKFERKGKSSPRNVLLSVVNQLTATLPTFK
Sbjct  241  VQEWLDSRFNVGSDVLLAMVGDAGTGKTHFCKFERKGKSSPRNVLLSVVNQLTATLPTFK  300

Query  301  SQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLD  360
            SQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLD
Sbjct  301  SQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLD  360

Query  361  FLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFP  420
            FLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFP
Sbjct  361  FLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFP  420

Query  421  TEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEI  480
            TEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEI
Sbjct  421  TEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEI  480

Query  481  FEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDI  540
            FEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDI
Sbjct  481  FEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDI  540

Query  541  ISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpa  600
            ISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPA
Sbjct  541  ISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGTPA  600

Query  601  seratttsrspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
            SERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR
Sbjct  601  SERATTTSRSPASPESSSSTASSDRSSGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660

Query  661  TTTSAF  666
            TTTSAF
Sbjct  661  TTTSAF  666

>PYAP_17763
Length=794

 Score = 803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/667 (64%), Positives = 496/667 (74%), Gaps = 69/667 (10%)

Query  62   ATTPSNARTTENLRATGletlneleeePVDRSTARYIG------------EQGDFtpmpt  109
            + T S  R T +LRATGLETLNE+EEE VDRSTARY+G              GD   +  
Sbjct  127  SATNSGLRGT-DLRATGLETLNEMEEEVVDRSTARYVGPGVTPTTPAAVIRAGDADLLRA  185

Query  110  taapaytpmpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLI------------------  151
                    M AI+REMMNEMH +RYDVLKEVTMLKGTI QL+                  
Sbjct  186  ELREMKQEMQAIKREMMNEMHLTRYDVLKEVTMLKGTIMQLVSVIQQSGGVHFDTATAAA  245

Query  152  -----------------ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAP  194
                             E ++R+TTTV SK TKERITTTR+D +PP+LR+TS RLTQLAP
Sbjct  246  MGIDVPPQANELSPEEKEALSRKTTTVVSKVTKERITTTREDQIPPVLRSTSSRLTQLAP  305

Query  195  VDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSD  254
            VDDSALSTPL QEQID++FPL+DFSAEVQ+Q+RIR+ G+REW FDRVQEWLDSRFNVG+D
Sbjct  306  VDDSALSTPLHQEQIDDMFPLIDFSAEVQIQSRIRETGSREWVFDRVQEWLDSRFNVGAD  365

Query  255  VLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLP  297
            V+LAMVGDAG+GKT                 HFCKF+RK KSSPRNVLLS+VNQLT++LP
Sbjct  366  VVLAMVGDAGSGKTVAAASVCDKYEDQVVAKHFCKFDRKAKSSPRNVLLSLVNQLTSSLP  425

Query  298  TFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYND  357
             FKSQLARLNLKYVLEETDV AL+RKVL+DPL +LEEPLT KFV+ D +DQC    GYND
Sbjct  426  MFKSQLARLNLKYVLEETDVPALSRKVLIDPLNALEEPLTPKFVVFDAIDQCRTGVGYND  485

Query  358  LLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVA  417
            L DFLS ++PECP WLGFL+++KPSPEFA  VPV+S+LDFSA+NA Y+NDT  L+ DI A
Sbjct  486  LQDFLSAIIPECPKWLGFLVSSKPSPEFAVSVPVSSVLDFSAQNANYMNDTVFLINDIAA  545

Query  418  IFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIY  477
            +F   DQA+A QILKTKS GNYSYLEFT+QA+SNPGME   G VPVDVLHDLPQSLYEIY
Sbjct  546  VFHDNDQAEAKQILKTKSGGNYSYLEFTKQALSNPGMEEASGFVPVDVLHDLPQSLYEIY  605

Query  478  EEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAF  537
            EEIFEDKFGKGRTR+WRKALPVLQLIFTAASGPYAQITEQ++MDSLSY KD+VRMLRRAF
Sbjct  606  EEIFEDKFGKGRTRVWRKALPVLQLIFTAASGPYAQITEQNIMDSLSYTKDEVRMLRRAF  665

Query  538  IDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHG  597
            IDIISIRHGTY IVSSA++DWLTD QRKGE Y +DV L+VKVLR+VLRGEKL +PGT+  
Sbjct  666  IDIISIRHGTYAIVSSAVYDWLTDQQRKGEQYFIDVNLYVKVLRKVLRGEKLNMPGTSSS  725

Query  598  tpaseratttsrspaspesssstassdrssGGGKTRVTSMTT---PPKRHEPNMAPREKP  654
              +     + S +  S  S+SS+  S   S    T  T  ++   P K HEPN+ P  KP
Sbjct  726  GTSERSTMSRSGASISTSSTSSSDRSSGGSNNHSTPSTRTSSSSYPAKLHEPNLNP-SKP  784

Query  655  VGILKRT  661
            VGILK T
Sbjct  785  VGILKNT  791

>PYU1_G001733
Length=732

 Score = 608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/627 (51%), Positives = 414/627 (66%), Gaps = 64/627 (10%)

Query  5    EDAEDTFYTRGRENNGTDISVRSDYQIPSARSTTssamsydddndsmysgyssdRSTATT  64
            +D ED FY     N G  I+ RS     + R+T+S   +   +           RST+  
Sbjct  69   DDVEDMFY-----NGGGGIT-RSTSDYTTGRTTSSMRDANGMN-----------RSTSLR  111

Query  65   PSNA-RTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaapaytpmpaIRR  123
             ++  RTTE LR T L  LNE E  P    T        +   +          M  IRR
Sbjct  112  VTDVYRTTEQLRNTNLMPLNEDEVLPAAMRTTTGAAGGSEADALRAELVEMKQEMQTIRR  171

Query  124  EMMNEMHTSRYDVLKEVTMLKGTITQLI----------------------------ETMA  155
            EMMNEMH +RYDVLKE+TMLKGTI QL+                            +T+ 
Sbjct  172  EMMNEMHVTRYDVLKEITMLKGTIIQLVAALESKGVRTLDAGGVAEPQPELSPAQLDTIT  231

Query  156  RRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPL  215
            R T    SK+TK+R+       +P ++R T+ RLTQLAPV D ALSTPL Q QID++FPL
Sbjct  232  RTTAVHTSKATKDRLAAREVTAIPTIIRGTNSRLTQLAPVADDALSTPLLQHQIDDMFPL  291

Query  216  LDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-------  268
            +DFSA++Q+ A+  D  +REWAF+R Q+W+DSRFNVG D LLA+VGD G+GK+       
Sbjct  292  VDFSADLQLHAQKFDPTSREWAFERFQDWVDSRFNVGGDNLLALVGDGGSGKSTLVGALC  351

Query  269  ----------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVL  318
                      H CKF+RK KSSPRNVLLS+VNQL A LP FK+QLARLNLKYVLEETD L
Sbjct  352  DRFHDNIVALHLCKFDRKSKSSPRNVLLSLVNQLIANLPLFKNQLARLNLKYVLEETDPL  411

Query  319  ALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGFLIT  378
             LARKVLVDPL +LEEPLTAK +L+DG+DQC  +   NDLLDFL+ ++PE P+WLG  IT
Sbjct  412  VLARKVLVDPLCALEEPLTAKVLLVDGIDQCK-SKDRNDLLDFLAAIIPEFPTWLGIFIT  470

Query  379  TKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGN  438
            +KPSPE   K+ +TSLLDFS KNA Y+NDT +L+ DI+  F  +D ++A  ILK KS GN
Sbjct  471  SKPSPELPAKLAITSLLDFSPKNANYMNDTIILINDIIGNFSDKDVSEARDILKRKSGGN  530

Query  439  YSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALP  498
            +++L+FT+QA+S+PGME   G VP+DVLHDLP+S+YEIY+EIFEDKFGKG  RLW+K  P
Sbjct  531  FTFLDFTKQALSHPGMEEENGYVPLDVLHDLPESIYEIYDEIFEDKFGKGHNRLWKKVQP  590

Query  499  VLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDW  558
            +L LI TAASGPYA ITE+   +  S ++DD+RM+RRAF DII +RHGTY + +SA+++W
Sbjct  591  LLDLIVTAASGPYALITEEQAQEQFSLSRDDIRMIRRAFTDIIDVRHGTYRMETSAMYEW  650

Query  559  LTDPQRKGEPYHVDVTLHVKVLRRVLR  585
            L DPQR GE ++V+++  + +LRR+ R
Sbjct  651  LVDPQRSGEQFYVNISASMDILRRLHR  677

>PYIR_13418
Length=747

 Score = 600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/511 (58%), Positives = 370/511 (72%), Gaps = 51/511 (10%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLI-----------------------------  151
            IRREMMNEMH +RYDVLKE+TMLKGTI QL+                             
Sbjct  186  IRREMMNEMHVTRYDVLKEITMLKGTIIQLVTALESKGVRSLDASGAAVGAEAQPELSSD  245

Query  152  --ETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQI  209
              +T++R T    SK+TKER   TR+D  P L+RA+S RLTQLAPV D ALSTPL Q QI
Sbjct  246  ELDTISRTTALYTSKATKER-RATREDSAPVLVRASS-RLTQLAPVADDALSTPLLQHQI  303

Query  210  DELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-  268
            DE+FPL++ S E+Q  A+  D  +REWA +R QEW+DSRFNVG D LLA+VGD G+GK+ 
Sbjct  304  DEMFPLVECSTELQAFAQNYDPSSREWAIERFQEWVDSRFNVGVDNLLALVGDGGSGKST  363

Query  269  ----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVL  312
                            H C F+RK KSSPRNVLLS+VNQL + LP FK+QLARLNLKYVL
Sbjct  364  LTGALCDKFHDNVVAMHLCVFDRKSKSSPRNVLLSLVNQLISNLPLFKNQLARLNLKYVL  423

Query  313  EETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSW  372
            EETD L LARKVLVDPL +LEEPLTAK  + DG+DQC  + G NDLLDFL+V++PE P+W
Sbjct  424  EETDPLVLARKVLVDPLCALEEPLTAKVFVFDGIDQCK-SKGRNDLLDFLAVIIPELPTW  482

Query  373  LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
            +G  IT+KPSPE   K+ +TSLLDFSAKN  Y+NDT +L+ DI+  F  +D   A +ILK
Sbjct  483  VGVFITSKPSPELPAKLAITSLLDFSAKNTNYMNDTIILINDIIGNFSDKDVPQAREILK  542

Query  433  TKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRL  492
             KS GN+++L+FT+QA+S+PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR+R+
Sbjct  543  RKSGGNFTFLDFTKQALSHPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRSRI  602

Query  493  WRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVS  552
            W+K  P+L+LI TAASGPYA ITE    +  S +K+D+R +RRAF+DII++ HGTY I +
Sbjct  603  WKKVQPLLELIVTAASGPYALITENQAQEQFSLSKEDIRTIRRAFVDIIAVNHGTYRIET  662

Query  553  SALFDWLTDPQRKGEPYHVDVTLHVKVLRRV  583
            SALF+WL DPQR GE ++VDV+  + +LR++
Sbjct  663  SALFEWLVDPQRAGEQFYVDVSGGMNLLRQL  693

>PYIW_19969
Length=733

 Score = 594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 364/493 (74%), Gaps = 32/493 (6%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQL-------------IETMARRTTTVASKSTK  167
            IRREMMNEMH +RYDVLKEVTMLKGTI QL             I T++R T    SK+TK
Sbjct  189  IRREMMNEMHVTRYDVLKEVTMLKGTILQLVTALETKGLSTDEINTISRTTALFTSKATK  248

Query  168  ERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQAR  227
            +R   TRD+   P+L   S RLTQLAPV D ALSTPL Q QIDE+FPL++ S E+   +R
Sbjct  249  DR-RATRDESSSPMLVRASSRLTQLAPVADEALSTPLLQHQIDEMFPLIECSDELVALSR  307

Query  228  IRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-----------------HF  270
              D  +REWA +R QEW+DSRFNVG D LLA+VG+ G+GK+                 H 
Sbjct  308  TYDSSSREWAVERFQEWIDSRFNVGVDNLLALVGEGGSGKSTLAGALSDKFHDNIVAIHL  367

Query  271  CKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLA  330
            C F+RK KSSPRNVLLS+VNQ+ + LP FK+QLARLNLKYVLEE+D + LARK+LVDPL 
Sbjct  368  CTFDRKSKSSPRNVLLSLVNQMISNLPLFKNQLARLNLKYVLEESDPVVLARKLLVDPLC  427

Query  331  SLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVP  390
            +LEEP+TAK  ++DGLDQC  + G NDLLDFL+V++PE P+W+G  IT+KPSPE   ++ 
Sbjct  428  ALEEPMTAKVFMIDGLDQCK-SRGRNDLLDFLAVIIPELPTWIGVFITSKPSPELPARLA  486

Query  391  VTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMS  450
            ++SLLDFSAKN  Y+NDT +++ DI+  F  +D   A +ILK KS GN+++L+FT+QA+S
Sbjct  487  ISSLLDFSAKNTNYMNDTVIMINDIIGSFSDKDVPQAREILKRKSGGNFTFLDFTKQALS  546

Query  451  NPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGP  510
            +PGME   G +P+DVLHDLP+S+YEIYEEIFEDKFGKGR R+W+K  P+L+LI TAASGP
Sbjct  547  HPGMEEDNGYIPLDVLHDLPESIYEIYEEIFEDKFGKGRNRIWKKVQPLLELIVTAASGP  606

Query  511  YAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYH  570
            YA ITE    +  + +K+D+R +RR+F+DII +RHGTY I +SALF+WL DPQR GE ++
Sbjct  607  YALITETQAQEQFALSKEDIRTIRRSFVDIIDVRHGTYRIENSALFEWLVDPQRAGEQFY  666

Query  571  VDVTLHVKVLRRV  583
            VDV+  +  LR++
Sbjct  667  VDVSGGMSALRQL  679

>PPTG_17129
Length=745

 Score = 551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/713 (44%), Positives = 441/713 (62%), Gaps = 79/713 (11%)

Query  3    VPEDAEDTFYTRGRENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdRST  61
            V +D E+ FY R   N  +D+   R+  QI +   T S+     + ++      S  + +
Sbjct  56   VTDDVEEMFYGRSTSNTSSDMPQYRTTEQIRANNMTLSALHEDVEASNVSNVSSSFSQFS  115

Query  62   ATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmp--ttaapaytp  117
             TTPSN  A T  N  +T              R+ +      GDF      +        
Sbjct  116  TTTPSNYAASTPGNFSSTYHGFNTVHSTTGTSRAVS------GDFELERLRSEVLEVKEE  169

Query  118  mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
            + AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                        
Sbjct  170  VKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHSAPPSVSSTESSSSDPLSAEER  229

Query  154  --MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
              + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL+ +Q
Sbjct  230  AALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALSTPLSPQQ  288

Query  209  IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
            I+E+FPL+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D LLA+VG+ GTGK+
Sbjct  289  INEMFPLIDFTSELAAHARGLTPGTRTWALTRVEEWLDARFNVGNDTLLAVVGEGGTGKS  348

Query  269  -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                             H C+F+RK KSSPRNVLLS+V+QL   LP+FK+QLARLNLKYV
Sbjct  349  AFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPSFKNQLARLNLKYV  408

Query  312  LEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECP  370
            LEE D   LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL+F + V+P+ P
Sbjct  409  LEEADPFLLAGKVLVDPLNAMEEPMHATFMLVDGIDQCAAGLNGRNELLEFFAQVIPQLP  468

Query  371  SWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQI  430
            SW+GFLI++KPS + A+++PV+S+LDFSAKN A+V D + ++ DI   F  +D A+A ++
Sbjct  469  SWVGFLISSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSIVDDIARNFSDDDTAEAKKV  528

Query  431  LKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
            LK KS GN++YLEFT+QA+S+PGM A   +G+VP++VLH+LP++LY+IY EIFEDKFG+G
Sbjct  529  LKKKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  588

Query  489  RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
            R R+W KA P+LQLI  AA+GPY+ +TE+   +   +  +D+RMLRR+F+D+++++HG Y
Sbjct  589  RARVWGKAKPLLQLIVGAAAGPYSPMTEEQAKEHFKFTAEDLRMLRRSFVDLVAVKHGAY  648

Query  549  HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaserattts  608
             I SSAL  WL+DP R  E ++  +   ++ LR++ R               S   +++ 
Sbjct  649  RIESSALCAWLSDPARSEEQFYFSIDDALQALRKMRR--------------VSSSGSSSG  694

Query  609  rspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRT  661
             S +S +  ++  +S R     KT   + T    RHEP   P  KPVGILKR 
Sbjct  695  HSGSSSDGKATHRASSRVKTSSKTHQRAHT----RHEPRANPDFKPVGILKRN  743

>PITG_18458
Length=747

 Score = 541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/713 (43%), Positives = 443/713 (62%), Gaps = 73/713 (10%)

Query  3    VPEDAEDTFYTRGRENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdRST  61
            V +D E+ FY R   N  +D+   R+  Q+     T S+     + ++      S  + +
Sbjct  52   VTDDVEEMFYGRSTSNTSSDMPQYRTTEQLRGNNITLSALHEDVEASNVSNVSSSFSQFS  111

Query  62   ATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmp--ttaapaytp  117
            ATTPSN  A T     +T            + R+ +      GDF      +        
Sbjct  112  ATTPSNYAASTPGKFTSTHQGLNTAQTTTGMSRAVS------GDFELERLRSEVLEVKEE  165

Query  118  mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
            + AIRRE+MNE+H +RYDVLKE+ +LKG I QL  T                        
Sbjct  166  VKAIRREVMNELHVTRYDVLKELALLKGAIAQLTATQHIAPASVSSTESSSSDPLSPDER  225

Query  154  --MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
              + R+T+T  S++T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL  +Q
Sbjct  226  AALTRQTSTKTSQATRDRLAASRTNIHKTPPPAARA-SVRLTQLAPVADNALSTPLNPQQ  284

Query  209  IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
            I+E+FPL+D ++E+   AR    GTR WA  RV+EWLD+R+N+G+D LLA+VG+ GTGK+
Sbjct  285  INEMFPLIDSTSELAAHARGLTPGTRTWALTRVEEWLDARYNLGNDTLLAVVGEGGTGKS  344

Query  269  -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                             H C+F+RK KSSPRNVLLS+V+QL  +LP+FK+QLARLNLKYV
Sbjct  345  TFCGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPSFKNQLARLNLKYV  404

Query  312  LEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECP  370
            LEE D   LA KVLVDPL ++EEP+ A F+L+DG+DQC V +NG N+LL+  + V+P+ P
Sbjct  405  LEEADPFLLAGKVLVDPLNAVEEPMHATFILVDGIDQCAVGSNGRNELLELFAQVIPQLP  464

Query  371  SWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQI  430
            SW+GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++
Sbjct  465  SWVGFLVSSKPSSKLAKRLPVSSVLDFSAKNGAFVADASSLVDDIARNFSDDDAAEAKKV  524

Query  431  LKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
            LK KS GN++YLEFT+QA+S+PG+ A   +G+VP++VLH+LP++LY+IY EIFEDKFG+G
Sbjct  525  LKKKSGGNFAYLEFTKQALSHPGIAAASKEGAVPLEVLHELPETLYDIYAEIFEDKFGQG  584

Query  489  RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
            R R+W KA P+LQL+  AA+GPY+ +TE+   +  +   +D+RMLRR+F+D++S++HG+Y
Sbjct  585  RARVWGKAKPLLQLVVGAAAGPYSPVTEEQAKEHFNLTTEDLRMLRRSFVDLVSVKHGSY  644

Query  549  HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaserattts  608
             I SSAL  WL+DP R  E ++  V   +  LR++ R            + +S  +  +S
Sbjct  645  RIESSALCAWLSDPARSEEQFYFSVDDALLALRKIRR--------VGSSSSSSGHSGNSS  696

Query  609  rspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKRT  661
               A+    +S+  S+R     KT   + T    R+EP  +P  KPVGILKR 
Sbjct  697  DGKAAKNGHASSRPSNRVKTSSKTHQRAHT----RYEPRTSPDYKPVGILKRN  745

>PHYCA_511415
Length=744

 Score = 541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/711 (44%), Positives = 441/711 (62%), Gaps = 73/711 (10%)

Query  3    VPEDAEDTFYTRG--RENNGTDI-SVRSDYQIPSARSTTssamsydddndsmysgyssdR  59
            V +D E+ FY R   R    +++   R+  QI     T S+         +     S  +
Sbjct  51   VTDDVEEMFYGRNTNRSTTASEMPQYRTTEQIRGNNLTLSALHEEAVTPSASNVSSSFSQ  110

Query  60   STATTPSN--ARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaapaytp  117
             +ATTPSN  A T  N+   G  T +          T+R I E  +   + +        
Sbjct  111  FSATTPSNYAASTPGNV---GNNTYHGFSSALNTAGTSRVISEDFELERLRSEVLEVKEE  167

Query  118  mpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET------------------------  153
            + AIRRE+MNE+H +RYDVLKE+T+LKG I QL                           
Sbjct  168  VKAIRREVMNELHVTRYDVLKELTLLKGAIAQLTAAQHSSPSVSSTESSSSDPLSAEERA  227

Query  154  -MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQI  209
             + R+T+T  S +T++R+  +R ++    PP  RA SVRLTQLAPV D+ALSTPL+ +QI
Sbjct  228  ALTRQTSTKTSAATRDRLAASRLNVHKTPPPAARA-SVRLTQLAPVADNALSTPLSSQQI  286

Query  210  DELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT-  268
            +E+FPL+DF++++   AR    G+R WA  RV+EWLD+RFNVG+D LLA+VG+ GTGK+ 
Sbjct  287  NEMFPLIDFTSDLAAHARGLTPGSRTWALTRVEEWLDARFNVGTDTLLAVVGEGGTGKSA  346

Query  269  ----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVL  312
                            H C+F+RK KSSPRNVLLS+V+QL   LP FK+QLARLNLKYVL
Sbjct  347  FLGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDNLPLFKNQLARLNLKYVL  406

Query  313  EETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPS  371
            EE D + LA KVLVDPL ++EEP+ A F+L+DG+DQC    NG N+LL F + V+P+ PS
Sbjct  407  EEADPILLAGKVLVDPLNAMEEPVHATFMLVDGIDQCSAGPNGRNELLQFFAQVIPQLPS  466

Query  372  WLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQIL  431
            W+GFL+++KPS + A+++PV+S+LDFSAKN A+V D + L+ DI   F  +D A+A ++L
Sbjct  467  WIGFLMSSKPSSKLAKRLPVSSVLDFSAKNGAFVADVSSLVDDIARNFSDDDAAEAKKVL  526

Query  432  KTKSCGNYSYLEFTRQAMSNPGMEA--PQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGR  489
            K KS GN++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR
Sbjct  527  KHKSGGNFAYLEFTKQALSHPGMTATSKEGAVPLGVLHELPETLYDIYAEIFEDKFGQGR  586

Query  490  TRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYH  549
             R+W KA P+LQL+  AASGPY+ +TE+   +      +D+RMLRR+F+D+++++HG+Y 
Sbjct  587  ARVWGKAKPLLQLVVGAASGPYSPVTEEQAKEHFKLTAEDLRMLRRSFVDLVAVKHGSYR  646

Query  550  IVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaseratttsr  609
            I SSAL  WL+DP R  E ++  +   +  LR++ R              +S  + + S 
Sbjct  647  IESSALCAWLSDPARSEEQFYFSIDDALHALRKMRR-----------NVSSSGHSHSGSS  695

Query  610  spaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
            S +S    +S+ +S R +   K++  S T    RHEP   P  KPVGILKR
Sbjct  696  SDSSATHHTSSRASSRVTASSKSQQRSHT----RHEPRTNP-GKPVGILKR  741

>PHYSO_348903
Length=766

 Score = 537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/729 (42%), Positives = 437/729 (60%), Gaps = 90/729 (12%)

Query  3    VPEDAEDTFYTRGRENNGTDISVRSDYQIPSARST----------Tssamsydddndsmy  52
            V +D ED FY R   NN +  S  SD  +P  R+T          ++     +  + +  
Sbjct  59   VTDDVEDMFYGR---NNRSTASAASD--VPQYRTTEQLRDTHLTLSALHEDAETPSATNN  113

Query  53   sgyssdRSTATTPSN--ARTTENLRATGletlneleeePVDR-------STARYIGEQGD  103
               S  + + TTPSN  A T  N      +  N  +     R       +    + E+G+
Sbjct  114  LSSSFSQFSVTTPSNYAASTPGNFSNHNGQNNNTNQSTTFARGFSAIPTTVGSAVAEEGE  173

Query  104  FtpmpttaapaytpmpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET----------  153
               +          + AIRRE+MNE+H +RYDVLKE+ +LKG + QL             
Sbjct  174  LERLRAEVLEVKEEVKAIRREVMNELHVTRYDVLKELALLKGAVAQLTAAQHSSPPSVSS  233

Query  154  ----------------MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAP  194
                            + R+T+T  S +T+ER+  +R ++    PP  RA SVRLTQLAP
Sbjct  234  TDSSSLDPLSADDRAKLVRQTSTKTSPATRERLAASRANVQKTPPPFARA-SVRLTQLAP  292

Query  195  VDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSD  254
            V D ALSTPLT +QI+E+FPL+DF++E+   AR    G+R WA  RV+EWLDSRFN GSD
Sbjct  293  VADDALSTPLTSQQINEMFPLIDFTSELAAHARGLTPGSRTWALTRVEEWLDSRFNTGSD  352

Query  255  VLLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLP  297
            +LLA+VG+ GTGK+                 H C+F+RK KS+PRNVLLS+V+Q+    P
Sbjct  353  ILLAVVGEGGTGKSAFCGTVAQQFRGNMLAAHCCQFDRKSKSTPRNVLLSMVHQIVDNYP  412

Query  298  TFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYN  356
             FK+QLARLNLKYVLEE D + LA KVLVDPL +LEEP+ A F+++DG+DQC   A G N
Sbjct  413  PFKNQLARLNLKYVLEEADPMLLAAKVLVDPLNALEEPVQAAFMMVDGIDQCAAGAQGRN  472

Query  357  DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIV  416
            +LL+F + ++P+ P+W+GFL+++KPS + A+++PV+S+LDFSA+N A+V D A L+ DI 
Sbjct  473  ELLEFFAQIIPQLPTWVGFLLSSKPSSKLAKRLPVSSVLDFSAENDAFVADVAPLVEDIA  532

Query  417  AIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLY  474
              F  +D   A  +LK KS GN++YLEFT+QA+S+PGM A   +G+VP+ VL+DLP++LY
Sbjct  533  RNFSDDDFVKAKSMLKQKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLGVLNDLPETLY  592

Query  475  EIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLR  534
            +IY EIFEDKFG+GR R+W KA P+LQL+  AASGPY+ +TE+   +  +   +D+RMLR
Sbjct  593  DIYAEIFEDKFGQGRARVWGKAKPLLQLVVGAASGPYSPVTEEQAREHFNLTAEDLRMLR  652

Query  535  RAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGT  594
            R+F+D++++RHG+Y I SSAL  WL+DP R  E ++  +   ++ LR++ R         
Sbjct  653  RSFVDLVAVRHGSYRIESSALCAWLSDPARSEEQFYFSIDDALQALRQMRRSGSSG----  708

Query  595  AHGtpaseratttsrspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKP  654
                     ++  S S +   +S+ T S   S G  K+   S      +HEP   P  KP
Sbjct  709  --------SSSGHSGSSSDGTTSAPTLSRTTSRGATKSHHRSHV----KHEPRANPDYKP  756

Query  655  VGILKRTTT  663
            VGILKR TT
Sbjct  757  VGILKRGTT  765

>PHYRA_81098
Length=741

 Score = 528 bits (1361),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/510 (50%), Positives = 355/510 (70%), Gaps = 51/510 (10%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET---------------------------  153
            IRRE+MNE+H +RYDVLKE+ +LKG I QL  T                           
Sbjct  163  IRREVMNELHVTRYDVLKELALLKGAIAQLAATQHLSPAASVSSTESSSSDPLSADERAA  222

Query  154  MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQID  210
            + R+T+T  S +T+ER+  +R ++    PP  RA SVRLTQLAPV D+ALSTPLT +QI+
Sbjct  223  LTRQTSTKTSSATRERLAASRANIHKTPPPAARA-SVRLTQLAPVADNALSTPLTPQQIN  281

Query  211  ELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
            ++FPL+DF++E+   AR    G+R WA  RV+EWLD+RFNVG D LLA+VG+ GTGK+  
Sbjct  282  DMFPLIDFTSELAAHARSLTPGSRTWALTRVEEWLDARFNVGHDTLLAVVGEGGTGKSAF  341

Query  269  ---------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLE  313
                           H C+F+RK KSSPRNVLLS+V+QL  +LP FK+QLARLNLKYVLE
Sbjct  342  LGTVAQQFRGNLLAAHCCQFDRKSKSSPRNVLLSMVHQLVDSLPPFKNQLARLNLKYVLE  401

Query  314  ETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSW  372
            E D   LA KVLVDPL ++EEP+ A F+L+DG+DQC     G N+LL+F + V+P  PSW
Sbjct  402  EADPFVLAGKVLVDPLNAMEEPMHATFMLVDGIDQCSAGPRGRNELLEFFAQVIPLLPSW  461

Query  373  LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
            +GF++++KPS + A+++PV+S+LDFSAKN A+V+D + L+ D+   F   D A+A ++LK
Sbjct  462  VGFMVSSKPSSKLAKRLPVSSVLDFSAKNGAFVSDVSSLVEDVARNFSDNDAAEAKKVLK  521

Query  433  TKSCGNYSYLEFTRQAMSNPGMEAP--QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRT  490
             KS GN++YLEFT+QA+S+PGM A   +G+VP+ VLH+LP++LY+IY EIFEDKFG+GR 
Sbjct  522  QKSGGNFAYLEFTKQALSHPGMAAASKEGAVPLSVLHELPETLYDIYAEIFEDKFGQGRA  581

Query  491  RLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHI  550
            R+W KA P+LQLI  AA+GPY+ +TE+      +   +D+RMLR +F+D++++RHG Y I
Sbjct  582  RVWGKAKPLLQLIVGAAAGPYSLVTEEQAKKHFNLTAEDLRMLRHSFVDLVAVRHGAYRI  641

Query  551  VSSALFDWLTDPQRKGEPYHVDVTLHVKVL  580
             SSAL  WL+DP R  E ++  +   ++ L
Sbjct  642  ESSALCGWLSDPARSEEQFYFAIDDAIQAL  671

>PHYKE_8395
Length=1420

 Score = 536 bits (1382),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 300/714 (42%), Positives = 432/714 (61%), Gaps = 73/714 (10%)

Query  3     VPEDAEDTFYTRGRENNGTDISVRSDYQIPSARST----------Tssamsydddndsmy  52
             V +D ED FY  GR    + +S  SD  +PS R+T          T+          + +
Sbjct  721   VSDDVEDMFY--GRSTTQSQLSNTSD--VPSYRTTEQMRGTNSTLTALHEEEAMTPSASH  776

Query  53    sgyssdRSTATTPSNARTTENLRATGletlneleeePVDRSTARYIGEQGDFtpmpttaa  112
                S   S A+TP N +                    + R+ +       + + +     
Sbjct  777   LSNSFASSYASTPGNYQNPPTFNGFNTTHSTG-----LSRTISEDTYNNNEVSRLRAELQ  831

Query  113   paytpmpaIRREMMNEMHTSRYDVLKEVTMLKGTITQLIET-------------------  153
                  +  IRRE+MNE+H +RYDVLKE+T+LKG + QL                      
Sbjct  832   EVKAEVQTIRREVMNELHMTRYDVLKELTLLKGAVAQLSAAQTTGSVSPSTSSSSDPLSA  891

Query  154   -----MARRTTTVASKSTKERITTTRDDM--VPPLLRATSVRLTQLAPVDDSALSTPLTQ  206
                  + R  + + SK+TK+R+  +R ++  VPP     SVRLTQLAPV D+ALSTPL  
Sbjct  892   EDRAALTRVPSKLTSKTTKDRLAKSRVNIHTVPPPAARASVRLTQLAPVADNALSTPLNP  951

Query  207   EQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTG  266
             +QI+E+FPL+DF++E+   AR    GTR WA  RV+EWLD+RFNVG+D +LA+VGD GTG
Sbjct  952   QQINEMFPLIDFTSELAAHARGLVPGTRTWALTRVEEWLDARFNVGNDTVLAVVGDGGTG  1011

Query  267   KT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLK  309
             K+                 H C+F+RK KS+PRNVLLS V+QL   LP FK+QLARLNLK
Sbjct  1012  KSAFCGTVAQQFRGNLLAAHCCQFDRKSKSTPRNVLLSFVHQLVDNLPPFKNQLARLNLK  1071

Query  310   YVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPE  368
             YVLEE+D   LA KV VDPL ++EEP+ A F+L++GLDQC    NG N+LL+FLS ++P+
Sbjct  1072  YVLEESDPFLLAAKVFVDPLNAVEEPIHATFMLVEGLDQCSAGPNGRNELLEFLSQIIPQ  1131

Query  369   CPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADAT  428
              PSW+GF+I++KP  +FA+++PV+S+LDFSAKN A+V+D + L+ DI   F  ED A+A 
Sbjct  1132  LPSWVGFMISSKPFSKFAKRLPVSSVLDFSAKNGAFVSDVSSLVDDIARNFSDEDSAEAK  1191

Query  429   QILKTKSCGNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFG  486
             ++LK KS GN++YLEFT+QA+S+PGM   + +G+VP++VL DLPQSL++IY EIFEDKFG
Sbjct  1192  RVLKRKSGGNFAYLEFTKQALSHPGMAMASKEGAVPLEVLDDLPQSLFDIYTEIFEDKFG  1251

Query  487   KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHG  546
             +GR R+W KA P+LQLI  AA+GPY+ +TE    +   +  +D+RMLRR+F+D++ ++HG
Sbjct  1252  QGRARIWAKAKPLLQLIVGAAAGPYSPVTEGQAKEHFGFTTEDLRMLRRSFVDLVEVKHG  1311

Query  547   TYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRGEKLQLPGTAHGtpaseratt  606
              Y + SSAL  WL+DP R  E +++ V   +  LR++ R         ++   +   +++
Sbjct  1312  AYRLESSALCSWLSDPARSEEQFYLSVDDALTALRKLRRSRSS----GSNSDHSHSGSSS  1367

Query  607   tsrspaspesssstassdrssGGGKTRVTSMTTPPKRHEPNMAPREKPVGILKR  660
             +  S  S  S + + ++   +   K+   + T    RHEP + P  KP+GILKR
Sbjct  1368  SDGSVPSTTSHTPSRATSSRAASSKSHQRAHT----RHEPRVNPEFKPMGILKR  1417

>HYAP_07104
Length=721

 Score = 495 bits (1274),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 345/514 (67%), Gaps = 49/514 (10%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIET---------------------------  153
            IR+ ++NE+H +RYDVLKE+ +LKG I QL  T                           
Sbjct  163  IRQHVVNELHVTRYDVLKELALLKGAIAQLTGTFPPPTTSVPLSIQRSVSNPLSSADRGA  222

Query  154  MARRTTTVASKSTKERITTTRDDMV---PPLLRATSVRLTQLAPVDDSALSTPLTQEQID  210
            + R+T+T+ S +T++R+  +R +     PP  RA SVRLTQLAPV DSALSTPL+  Q++
Sbjct  223  LTRQTSTMTSSATRDRLAASRVNTYKPPPPAARA-SVRLTQLAPVADSALSTPLSSVQMN  281

Query  211  ELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
            +LFPL+DF+ E+   AR    G+R WA  R +EWL+SRF  G D LLA+VG+ G+GK+  
Sbjct  282  DLFPLIDFTTELAAHARRLTPGSRTWALTRAEEWLESRFKAGMDPLLAVVGEGGSGKSAF  341

Query  269  ---------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLE  313
                           H C+F+RKGKSSPRNVLLSVV+QL   LP FK+QLARLNLKYVLE
Sbjct  342  CGTVAQQYRGQLVAAHCCQFDRKGKSSPRNVLLSVVHQLVVNLPLFKNQLARLNLKYVLE  401

Query  314  ETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVA-NGYNDLLDFLSVVVPECPSW  372
            E D + LA KVLVDPL +LE+P+   F+L+DG+DQC V   G N+LL+FL+ ++P+ PSW
Sbjct  402  EADPVLLASKVLVDPLNALEDPVDVAFMLVDGIDQCNVGPAGRNELLEFLAQLIPQLPSW  461

Query  373  LGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILK  432
            LG ++++KPS + A+++PV+S+LDFSAKN A+V D + L+ +I   F  ED  +A ++LK
Sbjct  462  LGVIVSSKPSSKLAKRLPVSSVLDFSAKNEAFVADVSSLVDEIACHFKHEDVEEAKEVLK  521

Query  433  TKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRL  492
             KS GN++YLEFT+QA+S     + +G V +DVL +LP++LY+IY EIFEDKFG GR R+
Sbjct  522  HKSGGNFAYLEFTKQALSGMASVSKEGVVAIDVLRELPETLYDIYAEIFEDKFGHGRARV  581

Query  493  WRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVS  552
            W KA  VLQL   A +GPY+ +TE+   +      +D+R+LRR+F+D+++++HG Y I +
Sbjct  582  WSKAEQVLQLAIGATAGPYSPVTEEQAQEHFRLTTEDLRLLRRSFVDLVAVKHGIYRIEN  641

Query  553  SALFDWLTDPQRKGEPYHVDVTLHVKVLRRVLRG  586
            SAL  WL DP R  E ++ ++   ++ LR++ R 
Sbjct  642  SALCAWLCDPARAEEQFYFNIDDALQALRKMRRA  675

>PHALS_06476
Length=726

 Score = 477 bits (1228),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 321/474 (68%), Gaps = 49/474 (10%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIE---------------------------T  153
            IRRE+MNE+H +RYDVLKE+T+LKG I QL                              
Sbjct  171  IRREVMNELHVTRYDVLKELTLLKGAIAQLASTKSLNSSSSVSSTDSSSSDPLSSDERAA  230

Query  154  MARRTTTVASKSTKERITTTR--DDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDE  211
            + R+T T  S++T++R+   R   +  PP     S RLTQLAPV D ALSTPL  +QI+E
Sbjct  231  LTRQTPTKTSQATRDRLAAPRINTNKAPPRAIRASARLTQLAPVADDALSTPLNSQQINE  290

Query  212  LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268
             FPL+DF++E+   AR    G+R WA  R+QEWLD+RF++G+D LLA+VG+ G+GK+   
Sbjct  291  SFPLIDFTSELAAHARSLTPGSRSWALTRIQEWLDARFHMGNDTLLAVVGEGGSGKSAFC  350

Query  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314
                          H C+F+RK KS PRNVLLS+V+QL   LP FK+QLARLNL+YVLEE
Sbjct  351  GTVAQQFRGNLLAAHCCQFDRKSKSRPRNVLLSMVHQLVDNLPLFKNQLARLNLRYVLEE  410

Query  315  TDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGV-ANGYNDLLDFLSVVVPECPSWL  373
            TD   LA KVL+DPL +LEEP  + F+L+DG+DQC   +NG N+LL+F+S ++   PSW+
Sbjct  411  TDPFLLANKVLIDPLNALEEPTHSTFILIDGIDQCATGSNGRNELLEFISQIISLLPSWV  470

Query  374  GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433
            GFL+++KPS + A+ +PV+S+LDFSAKN A+V D + L+ DI   F  +D  +A ++L  
Sbjct  471  GFLVSSKPSSKLAKCLPVSSVLDFSAKNGAFVADASSLVEDISQYFSDDDAVEAKRMLTK  530

Query  434  KSCGNYSYLEFTRQAMSNPGME--APQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTR  491
            KS GN++YLEFT+QA+S+PGM   +  G VP+ VL +LP++LY+IY EIFEDKFG+G  R
Sbjct  531  KSGGNFAYLEFTKQALSHPGMAVTSTNGVVPLSVLRELPETLYDIYAEIFEDKFGQGHAR  590

Query  492  LWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545
             W KA P+LQLI  AA+GPY+ +TE+     L    DD+RMLRR+F+DI++++H
Sbjct  591  AWGKAKPLLQLIVGAAAGPYSLVTEEQAKKQLDLNADDLRMLRRSFVDIVAVKH  644

>PYVX_23590
Length=689

 Score = 426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 254/549 (46%), Positives = 328/549 (60%), Gaps = 79/549 (14%)

Query  69   RTTENLRATGletlneleeeP-------VDRSTARYIGEQGDFtpmpttaapaytpmpaI  121
            RTTE LR+TGLE L E    P       V  ++  +    G    +    A       AI
Sbjct  106  RTTEQLRSTGLEPLAEDRVLPPAVPYGSVPHTSGPHADGPGGLAALRAELADVRAETQAI  165

Query  122  RREMMNEMHTSRYDVLKEVTMLKGTITQLIETM-------ARRTTTVASKSTKERITTTR  174
            RRE+MNE+H  RYDVLKEVT+LKG + QL+  +         R  +  S ++     ++ 
Sbjct  166  RREVMNELHVLRYDVLKEVTVLKGAVAQLLAALAPGGGDAGSRPGSAGSATSAATTASSS  225

Query  175  DDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTR  234
               + P  RA       LAPVDD+ALS PL  EQ+DELFPL+D S ++   AR R  GTR
Sbjct  226  SAELSPADRAAIGVAPTLAPVDDAALSAPLRPEQLDELFPLVDASTDIAAFARARAPGTR  285

Query  235  EWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGK-----------------THFCKFERKG  277
            +WA  RVQEWLDSRFNVG D LL +VG  GTGK                 THFCKF+RK 
Sbjct  286  DWATARVQEWLDSRFNVGQDTLLGVVGGPGTGKSTFCGSVCDMLQGNVLATHFCKFDRKA  345

Query  278  KSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLT  337
            KS+PR VLLS+V Q+ A LP FK QLARLNLKYVLEE DV  LA KVL+DPLA+ EEP+T
Sbjct  346  KSTPRVVLLSLVRQVVANLPPFKRQLARLNLKYVLEEPDVFVLAGKVLIDPLAACEEPIT  405

Query  338  AKFVLLDGLDQCGVA---NGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSL  394
            AK ++LDGLDQC  +      N+LL+FL+ VVP+ PSWLG L+++KP+PE A ++  TSL
Sbjct  406  AKCLVLDGLDQCKTSRRGGVRNELLEFLAHVVPQLPSWLGVLVSSKPAPELATQLKFTSL  465

Query  395  LDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGM  454
            LDFS KN  +V D   L+ DI A F     A+A ++L+TK+ GN++YL+FTRQA+S+PG+
Sbjct  466  LDFSGKNKLFVQDARFLVDDIAANFADAHAAEARRLLETKAGGNFAYLDFTRQALSSPGL  525

Query  455  EAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQI  514
            +   G + +D+LHDLP+SLYEIY EIFED                               
Sbjct  526  D--DGELELDMLHDLPESLYEIYLEIFED-------------------------------  552

Query  515  TEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVDVT  574
                         DD+R+++R+F+DII++R G Y I SSALF+WL+DP R GE +  D  
Sbjct  553  ------------NDDMRLVKRSFVDIIAVRGGCYRIESSALFEWLSDPARSGESFFFDAD  600

Query  575  LHVKVLRRV  583
              V  LRR+
Sbjct  601  AGVDELRRL  609

>CCI44111
Length=576

 Score = 329 bits (843),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 289/508 (57%), Gaps = 48/508 (9%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKG---------------TITQLIETMARRTTT-----  160
            +R+E++  +  +RYD+LKE+  LKG                I +L  T A  +       
Sbjct  70   VRQELIEAIQCTRYDILKEIVTLKGQVATMSIKIDSPINAKINKLNHTTANGSACSEGAD  129

Query  161  ----VASKSTKERITTTRD-DMVPPLLRATSV----RLTQLAPVDDSALSTPLTQEQIDE  211
                +++  T +R T   D   +  L+  +S+     L  L  +D++ LS PL++++IDE
Sbjct  130  DNEILSNFVTPDRSTVLSDCSHITRLVSQSSILRESGLPTLMTMDEANLSKPLSKDEIDE  189

Query  212  LFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT---  268
            +FPL+D S +V+  A     GTR WA D + +W+ S F  G++ +L +VG+ G GK+   
Sbjct  190  MFPLIDCSGDVESNALKLASGTRGWALDHITKWIQSNFENGNERVLTIVGEGGAGKSTLA  249

Query  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEE  314
                          HF +F+RK  SS R+V+LS+V+Q  + L  +K QL RLNL+Y+L E
Sbjct  250  GYVCQKFAANLHAYHFFQFDRKLGSSSRDVVLSLVSQFASKLQLYKRQLTRLNLRYILAE  309

Query  315  TDVLALARKVLVDPLASL-EEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWL  373
            ++ L +A K+L+DPL ++ E   T  FVL DG+DQC V N  NDLL+ LS +    PSW+
Sbjct  310  SNPLVMATKLLIDPLRAIPESDSTFGFVLFDGIDQCLVKNQSNDLLELLSHITERFPSWI  369

Query  374  GFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKT  433
            GF++T+K  P FA ++   S++     N  ++ D+ +L+ +++  F  +   +A  IL  
Sbjct  370  GFVVTSKAFPAFAARLKTNSVIHLDGSNVHFLQDSRILMENLLLYFEPKHTNEACDILMR  429

Query  434  KSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLW  493
            KS GN  YL+F  +A+S+P +   Q  + +DVL +LP+S+ EI   IF+DKFG+G  R+W
Sbjct  430  KSGGNSLYLQFINRALSHPILHGEQTFLSLDVLDELPESVDEIIFTIFDDKFGQGHQRVW  489

Query  494  RKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSS  553
            + A P+L++I  AA+GPY  + E  +       +++ RM+ RAF DII      Y I++S
Sbjct  490  KNAKPILEVIVAAAAGPYPLVGESQIKQQFELRENEWRMINRAFTDIIHCGTDGYRIINS  549

Query  554  ALFDWLTDPQRKGEPYHVDVTLHVKVLR  581
            +L+DWL   +++ + +H++     K LR
Sbjct  550  SLYDWLV-VEKRSQHFHLNPQAVFKFLR  576

>CCA22843
Length=586

 Score = 320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 287/512 (56%), Gaps = 55/512 (11%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMAR-----------RTTTVASKS----  165
            +R+E++  + ++RYD++KE+  L+G +T +   + +              T A+K+    
Sbjct  77   VRQELLEAIQSTRYDLVKEIIALQGKVTGIGNGLTKIDVKSSPTGTNENHTTANKTAFSE  136

Query  166  ------------TKERITTTRD-----DMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQ  208
                        T ER T   D       V   L       +   P+D+S LS PL +++
Sbjct  137  SAEDDEIISRFITPERSTIVADCSYKSGFVTERLNTKDSSFSTSVPLDESQLSKPLDKDE  196

Query  209  IDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT  268
             DE+FP +D  ++++  A     GTR WA DRV+EW++S F   +D +L ++G+ G+GK+
Sbjct  197  FDEMFPCIDCFSDLKSNALKLARGTRVWALDRVKEWIESNFKSENDHILTIIGEGGSGKS  256

Query  269  -----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYV  311
                             HFC+F+RK +SS R+V+LS+V+Q  +  P +K QL  LNL+Y+
Sbjct  257  TLAGYICQKFDAKLHAYHFCQFDRKSRSSSRDVVLSLVSQFASKNPLYKRQLTCLNLRYI  316

Query  312  LEETDVLALARKVLVDPLASLEEPL---TAKFVLLDGLDQCGVANGYNDLLDFLSVVVPE  368
            L+E++ L +A K+L++PL ++  P+   T  FVL DG+DQC V N  NDLLD +S +   
Sbjct  317  LKESNPLVMANKLLIEPLRAI--PVSNSTRGFVLFDGIDQCLVENESNDLLDLISHITQR  374

Query  369  CPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADAT  428
             PS +GF++T+K SP F  K    S++    +N  ++ND+ +L+ + +  F  +   +A 
Sbjct  375  FPSCIGFVVTSKASPAFDAKFKSKSIIHLHERNGKFMNDSRILMENSILNFEPKHTNEAC  434

Query  429  QILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKG  488
             IL  KS GN  YL+FT +A+S+P +   +  + +DVL +LP S+ +I+  IFEDKFG+G
Sbjct  435  DILMRKSGGNGLYLQFTERALSHPILHGERTFLSLDVLDELPDSVDDIFFTIFEDKFGQG  494

Query  489  RTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTY  548
              R+W+   P+L+ I  AA+G +  + E+ +       K++ RM++R+F DII      Y
Sbjct  495  HQRVWKNVKPILEAIVAAAAGSHPLVGERQIKQRFQLGKEEWRMMKRSFTDIICCGTEGY  554

Query  549  HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVL  580
             I++S+LF WL   + + + +++D    +K L
Sbjct  555  RIITSSLFAWLI-VENRSQHFYIDPKAGIKFL  585

>SPRG_06355
Length=713

 Score = 209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 236/454 (52%), Gaps = 38/454 (8%)

Query  153  TMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDEL  212
            T+ R +   +SK ++E    +R+        +   R +   P+ D AL+ P  +  +++ 
Sbjct  257  TVVRESIRASSKLSRESSKLSRESSKISRESSKLFRESTRQPIKDQALTQPW-ENVLNQH  315

Query  213  FPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT----  268
             P L+     Q  A      TR WA ++  +W           +L +VG AG GK+    
Sbjct  316  LPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESRVLNVVGGAGAGKSTLLS  371

Query  269  -------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLNLKYVLEET  315
                         HF +++ +  +S   +L+S+ +Q++  LP F+ QL RLNL Y+++E 
Sbjct  372  HLVSNYPEQIMASHFVRYDERHATSA--ILMSLAHQISCKLPDFQQQLVRLNLAYLIQEP  429

Query  316  DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDFLSVVVPECPSWLGF  375
            D + LA K+L++PL S+  PL ++ ++LD +D+     G N L+  L+ V  E PSW+ F
Sbjct  430  DPVVLATKLLIEPLRSMPAPLESQVIVLDAVDEDASTPGTN-LISLLADVALEFPSWVLF  488

Query  376  LITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKS  435
            L++++P     + +P   +L F  ++  +  D  + ++ ++     +D+ +   +LK KS
Sbjct  489  LLSSRPVDSVLKALPTHDVLHFHMEHRPFAADCTIAVQSLMDKHGLDDK-NILFLLKAKS  547

Query  436  CGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRK  495
             G++ YL+F  QA +    E   G     ++ +LP++LYEIY+++FE+K+GKGR R+W+K
Sbjct  548  QGSFLYLQFVDQAFAMIHSEIDAG-----MILELPKTLYEIYDQVFEEKYGKGRRRVWQK  602

Query  496  ALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH--GTY  548
              PVL+ I  AA+  + +     +TE  V       + D+ ++ R+F DI+++    G Y
Sbjct  603  VQPVLEAIVGAATLSHEKNACPFVTESDVQHIFKLGQPDLALIARSFEDIVAVDEETGVY  662

Query  549  HIVSSALFDWLTDPQRKGEPYHVDVTLHVKVLRR  582
             + S  LFD+L D  R  E  H++V   V  L +
Sbjct  663  RLQSKGLFDYLVDTSRSQEVAHINVERGVHYLTK  696

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 34/43 (79%), Gaps = 0/43 (0%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTTTVAS  163
            IRR++M E+HT++YD+LKE+TML+G + QL++ M ++    A+
Sbjct  156  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQPRAAAT  198

>SDRG_01763
Length=736

 Score = 199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 130/462 (28%), Positives = 240/462 (52%), Gaps = 48/462 (10%)

Query  136  VLKEVTMLKGTITQLIETMARRTTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPV  195
            V +E T     +++    ++R ++ ++ +S+K    +++      LL   S R     P+
Sbjct  273  VFRESTRASSKLSRESSKLSRESSKLSRESSKLSRESSK------LLFRESTR----QPI  322

Query  196  DDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
             D AL+ P  +  +++  P L+     Q  A      TR WA ++  +W           
Sbjct  323  KDQALTQPW-ENVLNQHLPFLN----TQRPAMEMLPSTRTWAINQYIKWAQDAGPTNESR  377

Query  256  LLAMVGDAGTGKT-----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPT  298
            +L +VG AG GK+                 HF +++ +   +P  +L+S+ +Q++  LP 
Sbjct  378  VLNVVGGAGAGKSTLLSHLVSNYPEQIMASHFVRYDER--HAPSAILMSLAHQISCKLPD  435

Query  299  FKSQLARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDL  358
            ++ QL RLNL Y+++E D + LA K+L++PL S+  PL ++ ++LD +D+     G N L
Sbjct  436  YQQQLVRLNLPYLIQEPDPIVLATKLLIEPLRSMPAPLESQVIVLDAVDEDVSTPGAN-L  494

Query  359  LDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVTSLLDFSAKNAAYVNDTAVLLRDIVAI  418
            +  L+ V  E PSW+ FL++++      + +P   +L F  ++  +  D  + ++ ++  
Sbjct  495  ISLLADVALEFPSWVLFLLSSRLVESVLKALPAHDVLHFHMEHRPFAADCTIAVQSVMDK  554

Query  419  FPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYE  478
               +D+ +   +LK KS G++ YL+F  QA S    E   G     ++ +LP++L+EIY+
Sbjct  555  HGLDDK-NILFLLKAKSQGSFLYLQFVDQAFSMIHSEIDAG-----MILELPKTLHEIYD  608

Query  479  EIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQ-----ITEQHVMDSLSYAKDDVRML  533
            ++FE+K+GKGR R+W+K   VL+ I  AA+  + +     +TE  V       + D+ ++
Sbjct  609  QVFEEKYGKGRRRVWQKVQAVLEAIVGAATISHEKNACPFVTESDVQHIFKLGQPDLALI  668

Query  534  RRAFIDIISIRH--GTYHIVSSALFDWLTDPQRKGEPYHVDV  573
             R+F DI+++    G Y + S  LFD+L D  R  E  H++V
Sbjct  669  ARSFEDIVTVDEDTGVYRLQSKGLFDYLVDTARSQEVTHINV  710

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 34/39 (87%), Gaps = 0/39 (0%)

Query  121  IRREMMNEMHTSRYDVLKEVTMLKGTITQLIETMARRTT  159
            IRR++M E+HT++YD+LKE+TML+G + QL++ M +++T
Sbjct  169  IRRDVMMELHTTKYDLLKEMTMLRGAVMQLVDAMHQQST  207

>H257_11773
Length=1026

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 98/420 (23%), Positives = 164/420 (39%), Gaps = 46/420 (11%)

Query  186  SVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWL  245
            +VRL QL       L     Q ++  +F    F AE+      +    REW  D++ EW 
Sbjct  424  AVRLPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIS--KFTQGFAGREWVMDQLTEW-  480

Query  246  DSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVV  289
                   S     + G  GTGKT                H    E +   + R  +LS+ 
Sbjct  481  ----KASSSQTFWITGQIGTGKTAVAASVIQNQPEVRAFHLVSKEDEQTQNHRRCVLSLA  536

Query  290  NQLTATLPTFKSQLARLN--LKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLL-DGL  346
             QLT  LP + + L + +  L+ ++  + V  L   +LV PL ++ +P T   V+L DGL
Sbjct  537  YQLTTQLPDYAAFLQQGDQPLEEIVSVSCVAELVHSLLVVPLNAIAQPSTVPLVILIDGL  596

Query  347  DQCGVANGY-NDLLDFLSVVVPECPSWLGFLITTKPSPEFAQK----VPVTSLLDFSAKN  401
            D    +N   N  +  L+  V   P W+ +++T++  P   QK    VP  +L     + 
Sbjct  597  DAFQDSNAVENCFVSSLAAAVRNLPPWVRWVLTSREDPSVMQKLQGLVPQVALDKCGHQT  656

Query  402  A-AYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGS  460
                +    + L   VA    +  A   + +  +S G + Y      A+S       Q  
Sbjct  657  RDDMLKYLQLALVQFVANADKDVPAATLRFIVERSEGLFLYASHIVNALS-------QKR  709

Query  461  VPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVM  520
            + +D L   P  +     + FED+F            P+L+ +  AA  P    T  ++M
Sbjct  710  LTLDKLESFPVGMGGYLRQYFEDQFTALHYE--TSVRPLLE-VLCAAFEPLHMSTLHNIM  766

Query  521  DSLSYAKDDVRMLRRAFIDIISIR-HGTYHIVSSALFDWLTDPQRKGEPYHVDVTLHVKV  579
               SYA  D      +F  ++ +          +++F+WL D    G  +      H ++
Sbjct  767  KWDSYAHRD---FLGSFKSLLYVSDENELKPFHTSVFEWLEDAHAAGRFFVCAANGHERI  823

>H310_08292
Length=1007

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 94/413 (23%), Positives = 161/413 (39%), Gaps = 58/413 (14%)

Query  186  SVRLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWL  245
            +VR+ QL       L     Q ++  +F    F AE+      +    REW  D++ +W 
Sbjct  409  AVRMPQLVTALRGNLDHDGQQARLFSIFSPFSFQAEIA--KFTQGFAGREWVMDQLTQW-  465

Query  246  DSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVV  289
                   +     + G  GTGKT                H    + +   +PR  +LS+ 
Sbjct  466  ----KASASQTFWVTGQIGTGKTALAAYIIQSQPEVRAFHLVSKDDEQTQNPRRCILSLA  521

Query  290  NQLTATLPTFKSQLARLN-LKYVLEETDVLALARKVLVDPLASLEEPLTAKFV-LLDGLD  347
             QLT  LP + + L +   L+ ++  + V  L   +LV PL ++ +P T   V LLDGLD
Sbjct  522  YQLTTQLPAYAAFLQQGEPLEEIVAVSSVTELVTTLLVVPLNAIAQPTTVPLVILLDGLD  581

Query  348  QCGVANGY-NDLLDFLSVVVPECPSWLGFLITTKPSPEFAQK----VPVTSLLDFSAKNA  402
                A    N  +  L  +V + PSW+  + T++  P   +K    VP  +L     +++
Sbjct  582  AFQDAAALDNCFVSSLVALVRKLPSWVRMIWTSREDPSVMRKLQGLVPQVALDKCVDQSS  641

Query  403  AYVNDTAVLLRDIVAIFPTEDQA-----DATQILKTKSCGNYSYLEFTRQAMSNPGMEAP  457
            A   D    L+  +  F   D+      +    +  +S G + Y      A+        
Sbjct  642  A---DMLKYLQAALVPFVRPDEGAVVPLETLHAIVARSEGLFLYASHIVHALH-------  691

Query  458  QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQ  517
            Q  + +D L   P  +     + FED+F       +  ++  L  +  AA  P       
Sbjct  692  QKRLTLDKLESFPVGMGGYLRQFFEDQFSAHH---YETSIRPLLEVLCAALEPMPMAMLH  748

Query  518  HVMDSLSYAKDDVRMLRRAFIDIISIRHG----TYHIVSSALFDWLTDPQRKG  566
             VM   +Y+  D      AF  ++ +        +H   +++F+WL D    G
Sbjct  749  DVMKWDTYSHRDC---LGAFKSLLYVSESDDIKPFH---TSVFEWLQDANAAG  795

>SPRG_12621
Length=1003

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 91/409 (22%), Positives = 163/409 (40%), Gaps = 56/409 (14%)

Query  188  RLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDS  247
            RL Q+A      L     Q ++  +F    F    Q     +    REW  D++ +W  +
Sbjct  419  RLAQIATALRGKLDHDGLQARLFSIFSPFSF----QTNKYTQGFAGREWVLDQLDQWKQT  474

Query  248  RFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQ  291
                  D +  + G  GTGK+                H    E +   S R  +LS+  Q
Sbjct  475  H-----DQVFWVTGQIGTGKSALAAYIIQSRPEVRAFHLVCKEDEQTQSHRRCVLSLAYQ  529

Query  292  LTATLPTFKSQLARLN-LKYVLEETDVLALARKVLVDPLASLEEPLTAKFV-LLDGLDQC  349
            LT  LP + S L + + L+ V+  + V+ L   +LV PL ++ EP T   V LLDGLD  
Sbjct  530  LTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLRAIAEPATTPLVILLDGLDSL  589

Query  350  -GVANGYNDLLDFLSVVVPECPSWLGFLITTKPSP-------EFAQKVPVTSLLDFSAKN  401
                   N L+  L  ++ + PSW+  ++T++  P        FA ++ +    D S ++
Sbjct  590  EDTQETDNCLVSALPALLQKLPSWVRVILTSREDPVVMRKLQGFAPQIALDKCADHSRQD  649

Query  402  AAYVNDTAVLLRDIVAIFPTEDQA---DAT-QILKTKSCGNYSYLEFTRQAMSNPGMEAP  457
                   + L + ++   P+       +AT Q +  ++ G + Y      A+S       
Sbjct  650  I-----MSYLQKALLPYLPSTTAGVVPEATLQFIAGRAEGLFLYASHIVHALS-------  697

Query  458  QGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQ  517
            Q  + +D L   P  +     + FE +F     +      P+L+ +  AA  P      +
Sbjct  698  QHRLTLDNLEGFPTGMGGYLRQFFESQFTPEHYK--EHIRPLLE-VLCAAYEPLTLDMLR  754

Query  518  HVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWLTDPQRKG  566
             +M   SY + ++    ++ + +            +++ +WL D    G
Sbjct  755  AIMQWDSYVQHEMLASFKSLLYVTD--SNVLKPFHTSVLEWLQDSNAAG  801

>H257_01934
Length=1022

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 97/410 (24%), Positives = 168/410 (41%), Gaps = 68/410 (17%)

Query  204  LTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVG  261
            L QE Q   LF LL  FS + Q+    +    R W      EW+ S  +    V L + G
Sbjct  431  LDQEGQQARLFSLLSPFSFQSQISTATQGYCGRAWVLHEFDEWVTSPPSNARRVFL-LTG  489

Query  262  DAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLAR  305
              G+GKT                H    E +   + R  +L++V QLT  LP + + L  
Sbjct  490  VIGSGKTALAAHIIQNRPEVVAFHLASHEGEQTQNGRRCVLNLVYQLTTQLPAYANVLK-  548

Query  306  LNLKYVLEET----DVLALARKVLVDPLASLEEPLTAKFVLLDGLDQCGVANGYNDLLDF  361
             + K  LEET    ++  L +++L+ PL  +  P +   +L+DG++    A+  ++L+  
Sbjct  549  -SQKEPLEETVFVGNLADLVQELLIAPLERIATPPSTMVILIDGIECFPCAD--DNLVAI  605

Query  362  LSVVVPECPSWLGFLITTKPSPEFAQKVPVTSL----LDFSAKNAA-----YVNDTAVLL  412
            L+  +   P+W+ F+ T++  P     +    L    LD +   +      Y++      
Sbjct  606  LTASLNRWPAWMRFVFTSREDPRVLSLLQAYMLPPIALDLACAQSKRDVRQYLDTALGSH  665

Query  413  RDIVAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQS  472
             DI    P         +L  ++ G + Y      ++S+       G   +D L ++P +
Sbjct  666  FDISPPMPPH----VIDLLVDRTQGLFLYARHLVDSISS-------GQWNLDNLDNVPTT  714

Query  473  LYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKD-DVR  531
            +     + F  +F     +      PVL+++  A         E   +D+LS     DV 
Sbjct  715  MGGFLHQNFATQF-PVVDKYKVDVRPVLEVVCAA--------HEPLTLDALSAIMHFDVY  765

Query  532  MLRRAFIDIISIRHGT-------YHIVSSALFDWLTDPQRKGEPYHVDVT  574
              ++   D  S+ H         +H+   +L DWL DP+  G+ Y VDV 
Sbjct  766  QAQKLQSDFGSLFHAGEGGVILPFHL---SLLDWLQDPRSAGD-YFVDVC  811

>SDRG_07983
Length=991

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 88/395 (22%), Positives = 163/395 (41%), Gaps = 56/395 (14%)

Query  208  QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTG  266
            Q   LF LL  FS + Q+    +    REW   +   W+ +    GS + + M G  G+G
Sbjct  415  QQARLFSLLSPFSFQSQISKLTQLFVAREWVLAKYDAWVQT--PNGSRIFV-MSGVIGSG  471

Query  267  KT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQL-ARLNLK  309
            K+                H    E     S R  +LS+V QL+  LP + + + ++  L+
Sbjct  472  KSAIMAQIIQNRPEIAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANVINSQEPLE  531

Query  310  YVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLD--QCGVANGYNDLLDFLSVVVP  367
             ++    ++ L   +L+ PL+++  P +   +L+DG+D  + G        +D       
Sbjct  532  EIVPVKSLVDLIHALLIAPLSAIAHPASILVLLIDGIDCFEPGFVATLTAHMDLW-----  586

Query  368  ECPSWLGFLITTKPSPEFAQKV----PVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTED  423
              PSW+ F+  T+  P   Q +    P    LD S  ++  ++  A L   +     +E 
Sbjct  587  --PSWVRFVFGTREDPSVLQTLQAYMPPAVSLDPSLPDSK-LDIKAYLHLALTPQLTSES  643

Query  424  QADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFED  483
            Q+   +I+   +  +     + R  ++   +    G + ++ L   P S+    +  F+ 
Sbjct  644  QSKRNEIVDFIAARSEGLFLYARHLVNAIAV----GQLQLNQLDAFPTSMGGCLQHCFDA  699

Query  484  KFGKGRTRLWRKAL-PVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFI----  538
            +F       ++K + PVL+ +  AA+ P      + ++    Y + D+     +      
Sbjct  700  QFPS--IEYYKKTIRPVLE-VLCAANEPLPLSMFRSILALAVYEQQDILAWFGSLFYITD  756

Query  539  -DIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVD  572
             DII   H       S++ DWL D +  G PY VD
Sbjct  757  SDIIKPFH-------SSVLDWLQDAKSAG-PYFVD  783

>SDRG_04575
Length=1003

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 99/221 (45%), Gaps = 26/221 (12%)

Query  188  RLTQLAPVDDSALSTPLTQEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWLDS  247
            RL Q+A      L     Q ++  +F    FS + Q+    +    REW   ++ +W  +
Sbjct  404  RLAQIATALRGKLDHDGLQARLFSIFS--PFSFQNQISKYTQGFAGREWVLHQLDQWKQT  461

Query  248  RFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQ  291
                  D +  + G  GTGK+                H    E +   S R  +LS+  Q
Sbjct  462  H-----DQVFWITGQIGTGKSALAAYIIQSRPEIRAFHLVCKEDEQTQSHRRCILSLAYQ  516

Query  292  LTATLPTFKSQLARLN-LKYVLEETDVLALARKVLVDPLASLEEPLTAKFV-LLDGLDQC  349
            LT  LP + S L + + L+ V+  + V+ L   +LV PL+++ EP T   V LLDGLD  
Sbjct  517  LTTQLPEYASFLQQGSPLEEVVPVSTVVELLDILLVAPLSAIAEPATTPLVILLDGLDSL  576

Query  350  -GVANGYNDLLDFLSVVVPECPSWLGFLITTKPSPEFAQKV  389
                   N L+  L  ++ + PSW+  ++T++  P   +K+
Sbjct  577  EDTQETDNCLVSALPGLLQKLPSWVRVILTSREDPVVMRKL  617

>SPRG_19030
Length=1000

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 88/395 (22%), Positives = 160/395 (41%), Gaps = 56/395 (14%)

Query  208  QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTG  266
            Q   LF LL  FS + Q+    +    REW   +   W+ +    GS + + + G  G+G
Sbjct  423  QQARLFSLLSPFSFQSQISKLTQLFVAREWVLAKYDAWVQT--PNGSRIFV-VSGVIGSG  479

Query  267  KT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQL-ARLNLK  309
            K+                H    E     S R  +LS+V QL+  LP + + L ++  L+
Sbjct  480  KSAIMAQIIQNRPEIAAFHLASHEEDQTQSARRCVLSLVYQLSTQLPEYANVLNSQEPLE  539

Query  310  YVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGLD--QCGVANGYNDLLDFLSVVVP  367
             ++    ++ L   +L+ PL+++  P +   +L+DG++  + G        +D       
Sbjct  540  EIVPVKSLVDLIHALLIAPLSAIAHPASILVLLIDGIECFEPGFVATLTAHMDLW-----  594

Query  368  ECPSWLGFLITTKPSPEFAQKV----PVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTED  423
              PSW+ F+  T+  P   Q +    P    LD S   +  ++  A L   +     TE 
Sbjct  595  --PSWVRFVFGTREDPSVLQTLQAYMPPAVSLDPSLYESK-LDIKAYLHLALTPQLTTES  651

Query  424  QADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFED  483
            Q    +I+   +        + R  ++   +    G + ++ L   P S+    +  F+ 
Sbjct  652  QGKRNEIVDFIAARAEGLFLYARHLVNAIAV----GQLQLNELDAFPTSMGGCLQHCFDA  707

Query  484  KFGKGRTRLWRKAL-PVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFI----  538
            +F       ++K + PVL+ +  AA+ P      + ++    Y + D+     +      
Sbjct  708  QFPS--IGYYKKTIRPVLE-VLCAANEPLPLSMFRSILSLDVYEQHDILAWFGSLFYITD  764

Query  539  -DIISIRHGTYHIVSSALFDWLTDPQRKGEPYHVD  572
             DII   H       S++ DWL D +  G PY VD
Sbjct  765  SDIIKPFH-------SSVLDWLQDAKSAG-PYFVD  791

>PYVX_21513
Length=1446

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 85/383 (22%), Positives = 147/383 (38%), Gaps = 66/383 (17%)

Query  186  SVRLTQLAPVDDSALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQE  243
            + R  QLA    +AL   L  E Q   LF LL  FS + Q+         R+W F RVQ+
Sbjct  392  AARKDQLA----TALRGQLDHEGQQARLFSLLSPFSFQQQISKLTYRFTGRDWLFKRVQQ  447

Query  244  WLDSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLS  287
            W++   +     +  + G  G+GKT                HF   E       R  +LS
Sbjct  448  WINDSSSGTDHRVFWITGQIGSGKTSVAARMVQTFPEIAAFHFALQEDDQTHIARRCVLS  507

Query  288  VVNQLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAKFVLLDGL  346
            +  QLT  LP +   L +R  L+ ++  +    L   +LV+PL +++ P     +L+DGL
Sbjct  508  LAYQLTTQLPEYGVFLQSREPLEEIVPVSTFHTLVTHLLVEPLNTIKRPAKPLILLIDGL  567

Query  347  DQCGVANGY-----------------NDLLDFLSVVVPECPSWLGFLITTKPSPEFAQK-  388
             +C V+                      L+  L  +V   PSW+  ++ ++   +   + 
Sbjct  568  -ECIVSGATLSAPGLSLGGPPPAVLDGCLVTMLPSLVARLPSWVRLVLLSREDHDVMTRL  626

Query  389  ---VPVTSLLDFSAKNAAYVNDTAVLLRDIVAIFPTEDQADATQILKTKSCGN------Y  439
               +P   +  F+ +N   +           A+ P +  AD  +    ++ G        
Sbjct  627  QTYIPSVVIDHFAQENECDIKKFVG-----SALAPKKSLADIVEAATAETSGRSRLTTLA  681

Query  440  SYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFGKGRTRLWRKALPV  499
             ++ F R   + PG    Q    ++++    + L+ +Y         +GR      AL  
Sbjct  682  RHVSFIRSPRNRPGATTEQ----IEMIARRAEGLF-LYAANIVQGIEEGRV-----ALNE  731

Query  500  LQLIFTAASGPYAQITEQHVMDS  522
            L  + T   G   Q  + H  D+
Sbjct  732  LDKLPTGMGGCLRQFFDSHFDDN  754

>PHYSO_470533
Length=1084

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 98/465 (21%), Positives = 179/465 (38%), Gaps = 92/465 (20%)

Query  198  SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
            SAL   L  E Q   LF LL  F+ + Q+         REW F+R Q+W+     + +  
Sbjct  434  SALEGTLDHEGQQARLFSLLAPFNFQRQISQLTERFIGREWLFERFQQWVQGSTTLSTST  493

Query  256  ---------LLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVN  290
                     +  +VG  G+GKT                HF + E +   + R  +LS+  
Sbjct  494  QTGELINRRVFWLVGQIGSGKTSVAAQMVQTCPEIAAFHFARQEDEQTHNARRCVLSLAY  553

Query  291  QLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD  347
            QLT  LP +   L +   L+ ++     + L  ++L+ PL ++  P T K   +L+DG++
Sbjct  554  QLTTQLPEYAHYLQSHEPLEEMVPVASFVELVSQLLIGPLNAIARPTTYKSLVLLIDGIE  613

Query  348  QC------------GVANGYND---LLDFLSVVVPECPSWLGFLITTKPSPEFAQKVPVT  392
                           ++ G  D   L+  L  +    P W+  ++ ++  P    K+   
Sbjct  614  WLIPNSSSSAPSMPTLSGGSKDEECLVSMLPALASRLPDWVRVVVLSREDPPVLSKLHAF  673

Query  393  SLLDFSAKNAAYVND-----------TAVLLRDIVAIFPTEDQAD------------ATQ  429
               D    +  + ND           + + L ++     +E   D              +
Sbjct  674  EPADVIIDHFQHENDHDIRRYLNLSLSKLPLSEVDFAKASEQAVDVPANNHEFGLEQVVE  733

Query  430  ILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFG---  486
            ++  +S G + Y     QA++       +G + +  L +LP  +    ++ F   F    
Sbjct  734  LIARRSEGLFLYAVNVVQAIT-------EGRLRLHELAELPVGMGAYLQQFFASHFSDHD  786

Query  487  --KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIR  544
              K R R      PVL+ +  AA  P    T   V++   Y + D   +  +   I +  
Sbjct  787  MYKQRVR------PVLE-VLCAAYEPLPLATLARVLEWDVYEQRDASSVLGSLFCIEAGY  839

Query  545  HGTYHIV---SSALFDWLTDPQRKGEPYHVDV-TLHVKVLRRVLR  585
                 ++    S++ DW+ D    G+ + VDV + H ++ R  +R
Sbjct  840  DANSQLLRPFHSSVLDWIQDSNSSGD-FFVDVASGHERLGRWAVR  883

>PYAP_22230
Length=1116

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 92/457 (20%), Positives = 172/457 (38%), Gaps = 111/457 (24%)

Query  212  LFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDVLLAMVGDAGTGKT--  268
            LF LL  FS ++Q+    +    R W  + +++W+++    GS V   + G  G+GKT  
Sbjct  473  LFSLLSPFSFQLQISQLTQRFTGRAWLLESIRQWINTPVTSGSKVFW-VTGQIGSGKTSV  531

Query  269  --------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQLARLN-LKYVLE  313
                          HF   +       R  +LS+  QLT  LP +   L   + L+ ++ 
Sbjct  532  AARMVQLMPEIAAFHFALQDDDQTQLARRCVLSLAYQLTTQLPEYAVFLQTGDPLEEIVP  591

Query  314  ETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLDQ-----------------------  348
             + V AL   +LV+PL ++  P + K   +L+DGL+                        
Sbjct  592  VSSVQALLTHLLVNPLNAIARPKSDKPVVLLIDGLEHLVSTNDNVAGGPPALRPSLGRGT  651

Query  349  ----------CGVANGYND--LLDFLSVVVPECPSWLGFLITTKPSPEFAQKV----PVT  392
                      C  ++G +D  L+  L  ++   P W+  ++ ++  P    K+    P  
Sbjct  652  GSTNSTTASLCDESSGSSDECLVSLLPSLISRLPLWVRVILLSREDPSILLKLQVYTPSI  711

Query  393  SLLDFSAKNAAYVND---------------------------------TAVLLRDIVAIF  419
            +L     +N A + +                                 TA+ + D     
Sbjct  712  ALDRHERENEADIREFVEMALCSPDPQSSHISRTVQVAPPIRHRSPSITALSVSDNT---  768

Query  420  PTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEE  479
            P +  A+  +++  +S G + Y     QA+        +G + VD L  LP  L     +
Sbjct  769  PRKISAEQVEVITKRSEGLFLYAANIVQAIE-------EGRLAVDQLETLPVGLGGYLRQ  821

Query  480  IFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFID  539
             FE  F     +   K  PVL+++  A    Y  +T   +     ++  + + +  +F  
Sbjct  822  FFESHFDDATYK--TKIRPVLEVLCAA----YEPMTTAMLASIFHWSTYEQQEMASSFSA  875

Query  540  IISIRHGTY-HIVSSALFDWLTDPQRKGEPYHVDVTL  575
            ++ +    Y     S++ +W+ D +  G  +  DV L
Sbjct  876  LLFVSDDDYVRPFHSSVLEWVQDFKTAGA-FLTDVAL  911

>PYIR_14107
Length=1176

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 99/466 (21%), Positives = 185/466 (40%), Gaps = 98/466 (21%)

Query  186  SVRLTQLAPVDDSALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQE  243
            S+R  QL     +AL   L  E Q   LF +L   S + Q+         REW F +++ 
Sbjct  504  SIRKDQLV----TALKGKLDHEGQQARLFSILSPLSFQQQISKLTSRFAGREWLFMQLEN  559

Query  244  WLDSRFNVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLS  287
            W+ S     +  +  + G  G+GKT                HF   E +   + R  +LS
Sbjct  560  WIASP---TATQVFWVTGQIGSGKTALAARMVQVIPEIAAFHFALQEDEQTQNARRCVLS  616

Query  288  VVNQLTATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLD  344
            +  QLT  LP +   L +R  L+ ++  ++   L  ++LV+PL  +  P + K   +L+D
Sbjct  617  LAYQLTTQLPQYALFLQSREPLEEIVPVSNFATLVTRLLVEPLNEIARPQSTKPLVLLID  676

Query  345  GL--------------------------------DQCGVA-NGYNDLLDFLSVVVPECPS  371
            GL                                D C  + +G   L+  L  +V   P+
Sbjct  677  GLEHLSSGKNSQLMTPGTSMGRPSFARSSGSNFGDCCNSSPSGDECLVSALPSLVARLPN  736

Query  372  WLGFLITTKPSPEFAQK-------VPVTSLLDFSAKNAA-YVND------TAVLLRDI--  415
            W+  ++ ++  P    K       + + SL   S ++   YV +         L R I  
Sbjct  737  WVRVVLLSRLDPAIVAKLQGYTPSIVLDSLKSESQQDIKRYVENMLGESPATTLRRGIYG  796

Query  416  ------VAIFPTEDQADATQILKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDL  469
                   ++F  +   +   ++  +S G + Y     Q++        +  + VD L  L
Sbjct  797  SASSTGASVFSNKLSPEQVDLIVKRSEGLFLYAVNIVQSIE-------EKRLAVDQLESL  849

Query  470  PQSLYEIYEEIFEDKFGKGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDD  529
            P  +   + + F+  F + + +      PVL+ +  A+  P++     +++  L++   D
Sbjct  850  PIGMGGYFRQFFDGHFDEQQYQ--DSIRPVLE-VLCASFEPFSL---WNIVSILNWDVYD  903

Query  530  VRMLRRAFIDIISI-RHGTYHIVSSALFDWLTDPQRKGEPYHVDVT  574
             + +  +F  ++SI   G      S++ DW+ DP   G+ Y V++ 
Sbjct  904  QQKIALSFGSLLSIGADGNIRPFHSSMCDWVQDPATAGK-YFVNIA  948

>PITG_17250
Length=1046

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 94/230 (41%), Gaps = 38/230 (17%)

Query  198  SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLD----SRFNV  251
            SAL   L  E Q   LF LL  FS + Q+         REW F   Q W+     S   +
Sbjct  412  SALEGTLDHEGQQTRLFSLLSPFSFQRQISHLTETFVGREWLFQLFQRWVQGSAASTREL  471

Query  252  GSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTAT  295
             +  +  ++G  G+GK+                HF   E +   + R  +LS+  QLT  
Sbjct  472  SNQRVFWVIGQIGSGKSSVAACMVQACPEIAAFHFATQEDEQTHNARRCVLSLAYQLTTQ  531

Query  296  LPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLD-----  347
            LP +   L +   L+ ++     + L   +L+ PL ++  P   K   +L+DG++     
Sbjct  532  LPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLNAIARPSKYKSLVLLIDGVEWLLPA  591

Query  348  QCGVANGYN--------DLLDFLSVVVPECPSWLGFLITTKPSPEFAQKV  389
             C   NG +         L+  L ++V   P W+  ++ ++  P    K+
Sbjct  592  SCTPVNGGSWRESKDEECLVSMLPMLVSRLPEWVRIVLLSREEPPVLSKL  641

>PYIW_15717
Length=1121

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/173 (28%), Positives = 78/173 (45%), Gaps = 25/173 (14%)

Query  198  SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWLDSRFNVGSDV  255
            +AL   L  E Q   LF +L   S + Q+         REW F +++ W+ S     +  
Sbjct  487  TALKGKLDHEGQQTRLFSILSPLSFQQQISKLTSRFAGREWLFAQLESWIASP---SAAQ  543

Query  256  LLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTF  299
            +  + G  G+GKT                HF   E +   + R  +LS+  QLT  LP +
Sbjct  544  VFWVTGQIGSGKTALAARMVQLIPEIAAFHFALQEDEQTQNARRCVLSLAYQLTTQLPQY  603

Query  300  KSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK---FVLLDGLDQ  348
             S L +R  L+ ++  ++   L  ++LV+PL  +  P TA     +L+DGL+ 
Sbjct  604  ASFLQSREPLEEIVPVSNFNTLVTRLLVEPLNDIARPQTATKPLVLLIDGLEH  656

>PPTG_11365
Length=1106

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 98/455 (22%), Positives = 171/455 (38%), Gaps = 96/455 (21%)

Query  198  SALSTPLTQE-QIDELFPLLD-FSAEVQVQARIRDDGTREWAFDRVQEWL------DSRF  249
            SAL   L  E Q   LF LL  F+ + Q+     +   REW F++ Q W+       S  
Sbjct  465  SALEGTLDHEGQQARLFSLLAPFNFQRQISHLTENFIGREWLFEQFQRWVQGSAASSSTR  524

Query  250  NVGSDVLLAMVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLT  293
             + +  +  +VG  G+GKT                H    E +   + R  +LS+  QLT
Sbjct  525  ELSNQRVFWVVGQIGSGKTSVAACMVQSCPEIAAFHLATQEDEQTHNARRCILSLAYQLT  584

Query  294  ATLPTFKSQL-ARLNLKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLDQCG  350
              LP +   L +   L+ ++     + L   +L+ PL ++  P   K   +L+DG++   
Sbjct  585  TQLPEYAHYLQSHEPLEEMVPVASFVELVTHLLIGPLTAIARPSKYKSLVLLIDGVEWLI  644

Query  351  VANGYNDLLDF-----------------LSVVVPECPSWLGFLITTKPSPEFAQKV----  389
             A+  + +  F                 L ++V   P W+  ++ ++  P    K+    
Sbjct  645  PASSSSQMPPFSGGSWRENKDEECFVSMLPMLVSRLPEWVRIVLLSREEPPVLSKLRAFD  704

Query  390  -PVTSLLDFSAKNAA----YVND-------TAVLLRDIVAIFPTEDQAD-------ATQI  430
             P  ++  F  +N      Y+N        + V      A   T+   +         ++
Sbjct  705  PPDVTIEQFKHENDQDIRRYINHSLSKLQLSEVEFEKAAAQIGTDSGNNHEFGMEQVVEL  764

Query  431  LKTKSCGNYSYLEFTRQAMSNPGMEAPQGSVPVDVLHDLPQSLYEIYEEIFEDKFG----  486
            +  +S G + Y     QA+S       +G + +  L +LP  +    ++ F   F     
Sbjct  765  IARRSEGLFLYAVNVVQAIS-------EGRLHLHELAELPVGMGAYLQQFFASHFADHDM  817

Query  487  -KGRTRLWRKALPVLQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRH  545
             K R R      PVL+ +  AA  P    T   V++   Y + D   +      + SI  
Sbjct  818  YKHRVR------PVLE-VCCAAYEPLPVATIARVLEWDVYEQRDAATV---LGSLFSIEA  867

Query  546  G------TYHIVSSALFDWLTDPQRKGEPYHVDVT  574
            G      T     +++ DW+ D    G  + VDV 
Sbjct  868  GNDPETQTLRPFHTSVLDWVRDSSSSG-VFFVDVA  901

>SDRG_08334
Length=207

 Score = 36.6 bits (83),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query  231  DGTREWAFDRVQEWLDS-RFNVGSDVLLAMVGDAGTGKTHF  270
            D T+E  FD+V+EWL   R +V SD++LA+VG+     T+F
Sbjct  88   DVTKEDTFDKVKEWLSELRKHVDSDIVLALVGNKCDLPTNF  128

>PYAR_14788
Length=795

 Score = 37.0 bits (84),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 34/142 (24%), Positives = 59/142 (42%), Gaps = 20/142 (14%)

Query  259  MVGDAGTGKT----------------HFCKFERKGKSSPRNVLLSVVNQLTATLPTFKSQ  302
            + G  G GKT                HF   E       R  +LS+  QLT  LP +   
Sbjct  421  VTGQIGAGKTSVAAKMVQTIPEIAAFHFALQEDDQTQLARRCVLSLAYQLTTQLPAYAVF  480

Query  303  LARLN-LKYVLEETDVLALARKVLVDPLASLEEPLTAK--FVLLDGLDQCGV-ANGYNDL  358
            L     L+ ++  + V +L   +L+ PL ++  P + K   +L+DGL+       G    
Sbjct  481  LQTGEPLEEIVPVSSVQSLIAHLLITPLNAIARPKSDKPLILLIDGLEHLASNTGGAGGG  540

Query  359  LDFLSVVVPECPSWLGFLITTK  380
            +  L  ++   PSW+  ++ ++
Sbjct  541  VSLLPSLIARLPSWVRVILLSR  562

>PYIR_23360
Length=227

 Score = 35.4 bits (80),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query  158  TTTVASKSTKERITTTRDDMVPPLLRATSVRLTQLAPVDDSALSTPLTQEQIDELFPLLD  217
            + T+ +   ++RI    D+      RA   R      + D+A      QE+   + P+  
Sbjct  37   SATIGASFLQKRIIVGGDEASGG--RAGGTRRKMTLQIWDTA-----GQERFRSMAPMYY  89

Query  218  FSAEVQVQARIRDDGTREWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
             +A+  +   +  D   E  F++V+EWL D R +VG D++LA+VG+
Sbjct  90   RNAKAAI---LVFDLLNEATFEKVKEWLQDLRHHVGDDIVLAIVGN  132

>PHYRA_82858
Length=224

 Score = 34.3 bits (77),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 24/29 (83%), Gaps = 1/29 (3%)

Query  235  EWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
            E +FD+++EWL D + +VG D++LA+VG+
Sbjct  97   EASFDKIKEWLQDLQHHVGDDIVLAVVGN  125

>SPRG_01955
Length=207

 Score = 33.1 bits (74),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 25/33 (76%), Gaps = 1/33 (3%)

Query  231  DGTREWAFDRVQEWLDS-RFNVGSDVLLAMVGD  262
            D T++  FD+V+EWL   R +V +D++LA+VG+
Sbjct  88   DVTKQDTFDKVKEWLSELRKHVDNDIVLALVGN  120

>PHYKE_5458
Length=438

 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 8/81 (10%)

Query  500  LQLIFTAASGPYAQITEQHVMDSLSYAKDDVRMLRRAFIDIISIRHGTYHIVSSALFDWL  559
            + L+ T   GPY+++ +Q         +DD++  ++A  D+I I+     +   +L+D +
Sbjct  34   IALLKTYGLGPYSRVIKQ--------VEDDIKKAQKAVNDLIGIKESDTGLSLPSLWDLV  85

Query  560  TDPQRKGEPYHVDVTLHVKVL  580
            +D Q   E   + V    K++
Sbjct  86   SDKQMMQEEQPLQVARCTKII  106

>PPTG_07025
Length=224

 Score = 33.1 bits (74),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 41/76 (54%), Gaps = 12/76 (16%)

Query  196  DDSALSTPLT--------QEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWL-D  246
            DDS     LT        QE+   + P+   +A+  +   +  D   E +F++++EWL D
Sbjct  53   DDSGARRKLTLQIWDTAGQERFRSMAPMYYRNAKAAI---LVFDLQSEASFEKIKEWLQD  109

Query  247  SRFNVGSDVLLAMVGD  262
             + +VG D++LA+VG+
Sbjct  110  LQHHVGDDIVLAVVGN  125

>PHYKE_5459
Length=201

 Score = 32.7 bits (73),  Expect = 5.1, Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 4/58 (7%)

Query  206  QEQIDELFPLLDFSAEVQVQARIRDDGTREWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
            QE+   + P+   +A+  +   +  D   E +F++++EWL D + +VG D++LA+VG+
Sbjct  47   QERFRSMAPMYYRNAKAAI---LVFDLQSEASFEKIKEWLQDLQHHVGDDIVLAVVGN  101

>PHALS_00054
Length=224

 Score = 32.7 bits (73),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 24/29 (83%), Gaps = 1/29 (3%)

Query  235  EWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
            E +F++++EWL D + +VG D++LA+VG+
Sbjct  97   EASFEKIKEWLQDLQHHVGDDIVLAVVGN  125

>CCA22779
Length=222

 Score = 32.7 bits (73),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (61%), Gaps = 1/41 (2%)

Query  231  DGTREWAFDRVQEWL-DSRFNVGSDVLLAMVGDAGTGKTHF  270
            D   E  F+++ EWL D R +V SD++LA+VG+     + F
Sbjct  93   DLQHEITFEKIIEWLQDLRHHVSSDIVLAVVGNKSDCASQF  133

>PITG_15525
Length=224

 Score = 32.7 bits (73),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 27/37 (73%), Gaps = 1/37 (3%)

Query  235  EWAFDRVQEWL-DSRFNVGSDVLLAMVGDAGTGKTHF  270
            E +F++++EWL D + +VG D++LA+VG+     ++F
Sbjct  97   EASFEKIKEWLQDLQHHVGDDIVLAVVGNKSDVTSNF  133

>PHYSO_545378
Length=224

 Score = 32.7 bits (73),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 24/29 (83%), Gaps = 1/29 (3%)

Query  235  EWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
            E +F++++EWL D + +VG D++LA+VG+
Sbjct  97   EASFEKIKEWLQDLQHHVGDDIVLAVVGN  125

>PHYCA_571841
Length=241

 Score = 32.3 bits (72),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 24/29 (83%), Gaps = 1/29 (3%)

Query  235  EWAFDRVQEWL-DSRFNVGSDVLLAMVGD  262
            E +F++++EWL D + +VG D++LA+VG+
Sbjct  97   EASFEKIKEWLQDLQHHVGDDIVLAVVGN  125

>SDRG_13750
Length=704

 Score = 32.7 bits (73),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (55%), Gaps = 2/51 (4%)

Query  246  DSRFNVGSDVLLAMVGDAGTGKTHFCKFERKGKSSPRNVLLSVVNQLTATL  296
            D+      D  + ++GD GTGK+ F +F    + SPR+VL + +   +A L
Sbjct  296  DTGMKTRGDSHMLLIGDPGTGKSQFLRF--TAELSPRSVLTTGIGTTSAGL  344

Lambda      K        H        a         alpha
   0.318    0.133    0.382    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 52541804256

  Database: blastdb
    Posted date:  Feb 23, 2018 11:26 PM
  Number of letters in database: 135,609,681
  Number of sequences in database:  319,881

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40